-- dump date   	20140619_042244
-- class       	Genbank::misc_feature
-- table       	misc_feature_note
-- id	note
31964000001	YcfA-like protein; Region: YcfA; pfam07927
31964000002	Predicted helix-turn-helix motif with score 1234.000, SD 3.39 at aa 105-126, sequence VTAEEAGIVLGITKQRVFQLEK
31964000003	ATPases involved in chromosome partitioning [Cell division and chromosome partitioning]; Region: Soj; COG1192
31964000004	ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the...; Region: ParA; cd02042
31964000005	Magnesium ion binding site [ion binding]; other site
31964000006	HMMPfam hit to PF01656, Cobyrinic acid a,c-diamide synthase, score 4.1e-12
31964000007	AAA-like domain; Region: AAA_10; pfam12846
31964000008	Signal peptide predicted for pCS0007 by SignalP 2.0 HMM (Signal peptide probability 0.938) with cleavage site probability 0.488 between residues 29 and 30
31964000009	4 probable transmembrane helices predicted for pCS0007 by TMHMM2.0 at aa 15-37, 50-72, 102-124 and 254-276
31964000010	PS00017 ATP/GTP-binding site motif A (P-loop).
31964000011	Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to...; Region: HTH_ARSR; cd00090
31964000012	putative DNA binding site [nucleotide binding]; other site
31964000013	putative Zn2+ binding site [ion binding]; other site
31964000014	2 probable transmembrane helices predicted for pCS0010 by TMHMM2.0 at aa 61-83 and 103-125
31964000015	Signal peptide predicted for pCS0011 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.329 between residues 60 and 61
31964000016	1 probable transmembrane helix predicted for pCS0011 by TMHMM2.0 at aa 13-32
31964000017	6 probable transmembrane helices predicted for pCS0012 by TMHMM2.0 at aa 91-113, 136-158, 193-215,222-240, 255-277 and 284-306
31964000018	1 probable transmembrane helix predicted for pCS0013 by TMHMM2.0 at aa 32-54
31964000019	AAA-like domain; Region: AAA_10; pfam12846
31964000020	PS00017 ATP/GTP-binding site motif A (P-loop).
31964000021	Signal peptide predicted for pCS0015 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.987 between residues 28 and 29
31964000022	1 probable transmembrane helix predicted for pCS0015 by TMHMM2.0 at aa 7-29
31964000023	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964000024	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964000025	Signal peptide predicted for pCS0017 by SignalP 2.0 HMM (Signal peptide probability 0.985) with cleavage site probability 0.642 between residues 21 and 22
31964000026	5 probable transmembrane helices predicted for pCS0017 by TMHMM2.0 at aa 34-56, 69-91, 95-114, 121-139 and 149-171
31964000027	Protein of unknown function (DUF1524); Region: DUF1524; pfam07510
31964000028	Signal peptide predicted for pCS0018 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.520 between residues 41 and 42
31964000029	1 probable transmembrane helix predicted for pCS0018 by TMHMM2.0 at aa 7-29
31964000030	leucine-zipper of insertion element IS481; Region: LZ_Tnp_IS481; pfam13011
31964000031	Winged helix-turn helix; Region: HTH_29; pfam13551
31964000032	Integrase core domain; Region: rve; pfam00665
31964000033	Integrase core domain; Region: rve_3; pfam13683
31964000034	HMMPfam hit to PF00665, Integrase, catalytic region, score 3.5E-36
31964000035	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964000036	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964000037	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964000038	PS00092 N-6 Adenine-specific DNA methylases signature.
31964000039	Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. Alignment contains also inactive enzymes that have substitutions of the catalytic triad...; Region: Tryp_SPc; cl00149
31964000040	PS00135 Serine proteases, trypsin family, serine active site.
31964000041	Signal peptide predicted for pCS0022 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.724 between residues 38 and 39
31964000042	1 probable transmembrane helix predicted for pCS0022 by TMHMM2.0 at aa 12-34
31964000044	Homeodomain-like domain; Region: HTH_23; cl17451
31964000045	Winged helix-turn helix; Region: HTH_29; pfam13551
31964000046	Integrase core domain; Region: rve; pfam00665
31964000047	Integrase core domain; Region: rve_3; pfam13683
31964000048	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964000049	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964000050	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964000051	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.6e-38
31964000052	HMMPfam hit to PF00239, Resolvase, N-terminal,score 6.3e-27
31964000053	PS00397 Site-specific recombinases active site.
31964000054	Signal peptide predicted for pCS0028 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.622 between residues 43 and 44
31964000055	2 probable transmembrane helices predicted for pCS0028 by TMHMM2.0 at aa 13-35 and 40-58
31964000056	3 probable transmembrane helices predicted for pCS0029 by TMHMM2.0 at aa 20-42, 124-146 and 151-173
31964000057	Signal peptide predicted for pCS0029 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.312 between residues 49 and 50
31964000058	2 probable transmembrane helices predicted for pCS0033 by TMHMM2.0 at aa 5-27 and 84-106
31964000059	Signal peptide predicted for pCS0033 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.900 between residues 24 and 25
31964000060	1 probable transmembrane helix predicted for pCS0036 by TMHMM2.0 at aa 290-312
31964000061	PS00135 Serine proteases, trypsin family, serine active site.
31964000062	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
31964000063	non-specific DNA binding site [nucleotide binding]; other site
31964000064	salt bridge; other site
31964000065	sequence-specific DNA binding site [nucleotide binding]; other site
31964000066	HMMPfam hit to PF01381, Helix-turn-helix motif,score 3.8e-10
31964000067	Predicted helix-turn-helix motif with score 1774.000, SD 5.23 at aa 25-46, sequence LTQAMVGELMGTSQQAVNKIER
31964000068	Fic/DOC family; Region: Fic; cl00960
31964000069	HMMPfam hit to PF02661, Filamentation induced by cAMP protein Fic, score 8.2e-13
31964000070	contains stop codons
31964000071	ParB-like nuclease domain; Region: ParBc; pfam02195
31964000072	ParB/RepB/Spo0J family partition protein; Region: parB_part; TIGR00180
31964000073	HMMPfam hit to PF02195, ParB-like nuclease, score 3.9e-13
31964000074	2 probable transmembrane helices predicted for pCS0051 by TMHMM2.0 at aa 4-21 and 28-50
31964000075	Signal peptide predicted for pCS0051 by SignalP 2.0 HMM (Signal peptide probability 0.676) with cleavage site probability 0.159 between residues 46 and 47
31964000076	Domain of unknown function (DUF1738); Region: DUF1738; pfam08401
31964000077	Antirestriction protein [DNA replication, recombination, and repair]; Region: COG4227
31964000078	HMMPfam hit to PF00436, Single-strand binding protein/Primosomal replication protein n, score 0.00014
31964000079	Protein of unknown function (DUF1524); Region: DUF1524; pfam07510
31964000080	Signal peptide predicted for pCS0058 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.775 between residues 49 and 50
31964000081	1 probable transmembrane helix predicted for pCS0058 by TMHMM2.0 at aa 7-26
31964000082	PS00017 ATP/GTP-binding site motif A (P-loop).
31964000083	1 probable transmembrane helix predicted for pCS0059 by TMHMM2.0 at aa 28-50
31964000084	lacks appropriate stop codon
31964000085	Cellulase (glycosyl hydrolase family 5); Region: Cellulase; pfam00150
31964000086	Endoglucanase [Carbohydrate transport and metabolism]; Region: BglC; COG2730
31964000087	CBD_II domain; Region: CBD_II; smart00637
31964000088	Rare lipoprotein A (RlpA)-like double-psi beta-barrel; Region: DPBB_1; pfam03330
31964000089	Pollen allergen; Region: Pollen_allerg_1; cl08320
31964000090	HMMPfam hit to PF00150, Glycoside hydrolase, family 5, score 4.6e-65
31964000091	PS00659 Glycosyl hydrolases family 5 signature.
31964000092	HMMPfam hit to PF00553, Cellulose-binding,bacterial type, score 5.1e-05
31964000093	HMMPfam hit to PF03330, Rare lipoprotein A, score 8.6e-16
31964000094	Helix-Turn-Helix DNA binding domain of transcription regulators from the MerR superfamily; Region: HTH_MerR-SF; cl02600
31964000095	Predicted transcriptional regulators [Transcription]; Region: SoxR; COG0789
31964000096	DNA binding residues [nucleotide binding]
31964000097	HMMPfam hit to PF00376, Bacterial regulatory protein, MerR, score 0.00015
31964000098	multiple promoter invertase; Provisional; Region: mpi; PRK13413
31964000099	Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and...; Region: SR_ResInv; cd03768
31964000100	catalytic residues [active]
31964000101	catalytic nucleophile [active]
31964000102	Presynaptic Site I dimer interface [polypeptide binding]; other site
31964000103	Synaptic Antiparallel dimer interface [polypeptide binding]; other site
31964000104	Synaptic Flat tetramer interface [polypeptide binding]; other site
31964000105	Synaptic Site I dimer interface [polypeptide binding]; other site
31964000106	DNA binding site [nucleotide binding]
31964000107	Helix-turn-helix domain of Hin and related proteins, a family of DNA-binding domains unique to bacteria and represented by the Hin protein of Salmonella. The basic HTH domain is a simple fold comprised of three core helices that form a right-handed...; Region: HTH_Hin_like; cd00569
31964000108	DNA-binding interface [nucleotide binding]; DNA binding site
31964000109	HMMPfam hit to PF02796, Resolvase helix-turn-helix region, score 5.5e-10
31964000110	Predicted helix-turn-helix motif with score 1502.000, SD 4.30 at aa 167-188, sequence HSVSELVELFGIGRATVYRALD
31964000111	HMMPfam hit to PF00239, Resolvase, N-terminal,score 2.9e-45
31964000112	PS00398 Site-specific recombinases signature 2.
31964000113	PS00397 Site-specific recombinases active site.
31964000114	1 probable transmembrane helix predicted for pCS0065 by TMHMM2.0 at aa 18-40
31964000115	Dicarboxylate transport; Region: DctA-YdbH; cl14674
31964000116	chromosomal replication initiator protein DnaA; Region: DnaA; TIGR00362
31964000117	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
31964000118	Walker A motif; other site
31964000119	ATP binding site [chemical binding]; other site
31964000120	Walker B motif; other site
31964000121	arginine finger; other site
31964000122	C-terminal domain of bacterial DnaA proteins. The DNA-binding C-terminal domain of DnaA contains a helix-turn-helix motif that specifically interacts with the DnaA box, a 9-mer motif that occurs repetitively in the replication origin oriC. Multiple...; Region: Bac_DnaA_C; cd06571
31964000123	DnaA box-binding interface [nucleotide binding]; other site
31964000124	HMMPfam hit to PF00308, Bacterial chromosomal replication initiator protein, DnaA, score 4.8e-194
31964000125	PS00017 ATP/GTP-binding site motif A (P-loop).
31964000126	PS01008 DnaA protein signature.
31964000127	DNA polymerase III subunit beta; Validated; Region: PRK07761
31964000128	Beta clamp domain.  The beta subunit (processivity factor) of DNA polymerase III holoenzyme, refered to as the beta clamp, forms a ring shaped dimer that encircles dsDNA (sliding clamp) in bacteria.  The beta-clamp is structurally similar to the trimeric...; Region: beta_clamp; cd00140
31964000129	putative DNA binding surface [nucleotide binding]; other site
31964000130	dimer interface [polypeptide binding]; other site
31964000131	beta-clamp/clamp loader binding surface; other site
31964000132	beta-clamp/translesion DNA polymerase binding surface; other site
31964000133	HMMPfam hit to PF00712, DNA polymerase III, beta chain, score 6.7e-47
31964000134	HMMPfam hit to PF02767, DNA polymerase III, beta chain, score 1.4e-18
31964000135	HMMPfam hit to PF02768, DNA polymerase III, beta chain, score 4.9e-11
31964000136	Homeodomain-like domain; Region: HTH_23; cl17451
31964000137	Winged helix-turn helix; Region: HTH_29; pfam13551
31964000138	Integrase core domain; Region: rve; pfam00665
31964000139	Integrase core domain; Region: rve_3; pfam13683
31964000140	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.1e-38
31964000141	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964000142	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964000143	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964000144	6-phosphogluconate dehydrogenase-like protein; Reviewed; Region: PRK09599
31964000145	6-phosphogluconate dehydrogenase-like protein; Reviewed; Region: PRK12490
31964000146	HMMPfam hit to PF03446, 6-phosphogluconate dehydrogenase, NAD-binding, score 1.3e-13
31964000147	HMMPfam hit to PF00393, 6-phosphogluconate dehydrogenase, C-terminal, score 5e-06
31964000148	recombination protein F; Reviewed; Region: recF; PRK00064
31964000149	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
31964000150	Walker A/P-loop; other site
31964000151	ATP binding site [chemical binding]; other site
31964000152	Q-loop/lid; other site
31964000153	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
31964000154	ABC transporter signature motif; other site
31964000155	Walker B; other site
31964000156	D-loop; other site
31964000157	H-loop/switch region; other site
31964000158	HMMPfam hit to PF02463, SMC protein, N-terminal,score 8.2e-06
31964000159	PS00017 ATP/GTP-binding site motif A (P-loop).
31964000160	PS00618 RecF protein signature 2.
31964000161	Protein of unknown function (DUF721); Region: DUF721; cl02324
31964000162	HMMPfam hit to PF05258, Protein of unknown function DUF721, score 1.6e-20
31964000163	DNA gyrase subunit B; Validated; Region: gyrB; PRK05644
31964000164	TopoIIA_Trans_DNA_gyrase: Transducer domain, having a ribosomal S5 domain 2-like fold, of the type found in proteins of the type IIA family of DNA topoisomerases similar to the B subunits of E. coli DNA gyrase and E. coli Topoisomerase IV which are; Region: TopoII_Trans_DNA_gyrase; cd00822
31964000165	anchoring element; other site
31964000166	dimer interface [polypeptide binding]; other site
31964000167	ATP binding site [chemical binding]; other site
31964000168	TOPRIM_TopoIIA_GyrB: topoisomerase-primase (TOPRIM) nucleotidyl transferase/hydrolase domain of the type found in proteins of the type IIA family of DNA topoisomerases similar to the Escherichia coli GyrB subunit. TopoIIA enzymes cut both strands of the...; Region: TOPRIM_TopoIIA_GyrB; cd03366
31964000169	active site
31964000170	putative metal-binding site [ion binding]; other site
31964000171	DNA gyrase B subunit, carboxyl terminus; Region: DNA_gyraseB_C; pfam00986
31964000172	HMMPfam hit to PF02518, ATP-binding region,ATPase-like, score 2.7e-28
31964000173	HMMPfam hit to PF00204, DNA topoisomerase II, score 5e-84
31964000174	PS00177 DNA topoisomerase II signature.
31964000175	HMMPfam hit to PF01751, TOPRIM, score 3.4e-10
31964000176	PS00037 Myb DNA-binding domain repeat signature 1.
31964000177	HMMPfam hit to PF00986, DNA gyrase, subunit B,C-terminal, score 2.5e-41
31964000178	DNA gyrase subunit A; Validated; Region: PRK05560
31964000179	DNA Topoisomerase, subtype IIA; domain A'; bacterial DNA topoisomerase IV (C subunit, ParC), bacterial DNA gyrases (A subunit, GyrA),mammalian DNA toposiomerases II. DNA topoisomerases are essential enzymes that regulate the conformational changes...; Region: TOP4c; cd00187
31964000180	CAP-like domain; other site
31964000181	active site
31964000182	primary dimer interface [polypeptide binding]; other site
31964000183	DNA gyrase C-terminal domain, beta-propeller; Region: DNA_gyraseA_C; pfam03989
31964000184	DNA gyrase C-terminal domain, beta-propeller; Region: DNA_gyraseA_C; pfam03989
31964000185	DNA gyrase C-terminal domain, beta-propeller; Region: DNA_gyraseA_C; pfam03989
31964000186	DNA gyrase C-terminal domain, beta-propeller; Region: DNA_gyraseA_C; pfam03989
31964000187	DNA gyrase C-terminal domain, beta-propeller; Region: DNA_gyraseA_C; pfam03989
31964000188	DNA gyrase C-terminal domain, beta-propeller; Region: DNA_gyraseA_C; pfam03989
31964000189	HMMPfam hit to PF00521, DNA gyrase/topoisomerase IV, subunit A, score 4.9e-270
31964000190	HMMPfam hit to PF03989, DNA gyrase C-terminal repeat, beta-propeller, score 1.1e-15
31964000191	HMMPfam hit to PF03989, DNA gyrase C-terminal repeat, beta-propeller, score 2.6e-11
31964000192	HMMPfam hit to PF03989, DNA gyrase C-terminal repeat, beta-propeller, score 1.3e-11
31964000193	HMMPfam hit to PF03989, DNA gyrase C-terminal repeat, beta-propeller, score 2.3e-11
31964000194	HMMPfam hit to PF03989, DNA gyrase C-terminal repeat, beta-propeller, score 3.2e-12
31964000195	HMMPfam hit to PF03989, DNA gyrase C-terminal repeat, beta-propeller, score 2.7e-07
31964000196	Transmembrane domain of unknown function (DUF3566); Region: DUF3566; pfam12089
31964000197	2 probable transmembrane helices predicted for CMS0009 by TMHMM2.0 at aa 37-59 and 95-117
31964000198	1 probable transmembrane helix predicted for CMS0010 by TMHMM2.0 at aa 161-183
31964000199	cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases. This family contains eukaryotic, bacterial and archeal proteins which exhibit a peptidylprolyl cis- trans isomerases activity (PPIase, Rotamase) and in addition bind the...; Region: cyclophilin; cd00317
31964000200	active site
31964000201	HMMPfam hit to PF00160, Peptidyl-prolyl cis-trans isomerase, cyclophilin type, score 1.1e-57
31964000202	PS00170 Cyclophilin-type peptidyl-prolyl cis-trans isomerase signature.
31964000203	Membrane associated serine protease [Amino acid transport and metabolism]; Region: COG0705
31964000204	7 probable transmembrane helices predicted for CMS0012 by TMHMM2.0 at aa 74-96, 126-148, 161-183,188-207, 214-231, 235-254 and 266-285
31964000205	HMMPfam hit to PF01694, Rhomboid-like protein,score 1.5e-31
31964000206	Uncharacterized protein family (UPF0233); Region: UPF0233; pfam06781
31964000207	HMMPfam hit to PF06781, Protein of unknown function UPF0233, score 7.3e-28
31964000208	2 probable transmembrane helices predicted for CMS0013 by TMHMM2.0 at aa 24-46 and 56-73
31964000209	Sortase D (SrtD) is a membrane transpeptidase found in gram-positive bacteria that anchors surface proteins to peptidoglycans of the bacterial cell wall envelope. This involves a transpeptidation reaction in which the surface protein substrate is cleaved...; Region: Sortase_D_5; cd05830
31964000210	active site
31964000211	catalytic site [active]
31964000212	1 probable transmembrane helix predicted for CMS0014 by TMHMM2.0 at aa 31-53
31964000213	HMMPfam hit to PF04203, Peptidase C60, sortase A and B, score 2.4e-26
31964000214	1 probable transmembrane helix predicted for CMS0015 by TMHMM2.0 at aa 13-35
31964000215	Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase; Region: GATase1_Anthranilate_Synthase; cd01743
31964000216	Glutamine amidotransferase class-I; Region: GATase; pfam00117
31964000217	glutamine binding [chemical binding]; other site
31964000218	catalytic triad [active]
31964000219	HMMPfam hit to PF00117, Glutamine amidotransferase class-I, score 5.9e-69
31964000220	PS00442 Glutamine amidotransferases class-I active site.
31964000221	Serine/Threonine protein kinases, catalytic domain; Region: S_TKc; smart00220
31964000222	Catalytic domain of Protein Kinases; Region: PKc; cd00180
31964000223	active site
31964000224	ATP binding site [chemical binding]; other site
31964000225	substrate binding site [chemical binding]; other site
31964000226	activation loop (A-loop); other site
31964000227	PASTA domain of bacterial serine/threonine kinase pknB-like proteins. PknB is a member of a group of related transmembrane sensor kinases present in many gram positive bacteria, which has been shown to regulate cell shape in Mycobacterium tubercolosis; Region: PASTA_pknB; cd06577
31964000228	PASTA domain of bacterial serine/threonine kinase pknB-like proteins. PknB is a member of a group of related transmembrane sensor kinases present in many gram positive bacteria, which has been shown to regulate cell shape in Mycobacterium tubercolosis; Region: PASTA_pknB; cd06577
31964000229	PASTA domain; Region: PASTA; pfam03793
31964000230	HMMPfam hit to PF03793, PASTA, score 1.7e-05
31964000231	HMMPfam hit to PF03793, PASTA, score 5e-10
31964000232	HMMPfam hit to PF03793, PASTA, score 8e-13
31964000233	1 probable transmembrane helix predicted for CMS0017 by TMHMM2.0 at aa 332-354
31964000234	HMMPfam hit to PF00069, Protein kinase, score 8.7e-55
31964000235	PS00108 Serine/Threonine protein kinases active-site signature.
31964000236	PS00107 Protein kinases ATP-binding region signature.
31964000237	Serine/Threonine protein kinases, catalytic domain; Region: S_TKc; smart00220
31964000238	Catalytic domain of Protein Kinases; Region: PKc; cd00180
31964000239	active site
31964000240	ATP binding site [chemical binding]; other site
31964000241	substrate binding site [chemical binding]; other site
31964000242	activation loop (A-loop); other site
31964000243	PASTA domain. This domain is found at the C-termini of several Penicillin-binding proteins (PBPs) and bacterial serine/threonine kinases. It is a small globular fold consisting of 3 beta-sheets and an alpha-helix. The name PASTA is derived from PBP and...; Region: PASTA; cl02768
31964000244	1 probable transmembrane helix predicted for CMS0018 by TMHMM2.0 at aa 351-373
31964000245	HMMPfam hit to PF00069, Protein kinase, score 4.8e-50
31964000246	PS00108 Serine/Threonine protein kinases active-site signature.
31964000247	Penicillin binding protein transpeptidase domain; Region: Transpeptidase; pfam00905
31964000248	HMMPfam hit to PF00905, Penicillin-binding protein,transpeptidase, score 6.2e-77
31964000249	PS00017 ATP/GTP-binding site motif A (P-loop).
31964000250	PS00343 Gram-positive cocci surface proteins 'anchoring' hexapeptide.
31964000251	1 probable transmembrane helix predicted for CMS0019 by TMHMM2.0 at aa 7-29
31964000252	Bacterial cell division membrane protein [Cell division and chromosome partitioning]; Region: FtsW; COG0772
31964000253	HMMPfam hit to PF01098, Cell cycle protein, score 1.4e-69
31964000254	12 probable transmembrane helices predicted for CMS0020 by TMHMM2.0 at aa 7-29, 39-61, 66-88, 98-120,132-149, 164-186, 207-226, 230-247, 254-276, 340-362,374-396 and 406-428
31964000255	Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence...; Region: PP2Cc; cd00143
31964000256	active site
31964000257	1 probable transmembrane helix predicted for CMS0021 by TMHMM2.0 at aa 323-345
31964000258	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964000259	HMMPfam hit to PF00481, Protein phosphatase 2C-like, score 2.2e-06
31964000260	FOG: FHA domain [Signal transduction mechanisms]; Region: COG1716
31964000261	Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins. Putative nuclear signalling domain. FHA domains may bind phosphothreonine, phosphoserine and sometimes phosphotyrosine. In eukaryotes, many FHA domain-containing proteins...; Region: FHA; cd00060
31964000262	phosphopeptide binding site; other site
31964000263	HMMPfam hit to PF00498, Forkhead-associated, score 1.3e-07
31964000264	1 probable transmembrane helix predicted for CMS0022 by TMHMM2.0 at aa 7-29
31964000265	Protein of unknown function (DUF2662); Region: DUF3662; pfam12401
31964000266	Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins. Putative nuclear signalling domain. FHA domains may bind phosphothreonine, phosphoserine and sometimes phosphotyrosine. In eukaryotes, many FHA domain-containing proteins...; Region: FHA; cd00060
31964000267	FOG: FHA domain [Signal transduction mechanisms]; Region: COG1716
31964000268	phosphopeptide binding site; other site
31964000269	HMMPfam hit to PF00498, Forkhead-associated, score 5.9e-14
31964000270	10 probable transmembrane helices predicted for CMS0024 by TMHMM2.0 at aa 59-81, 86-105, 117-139, 154-172,179-198, 203-225, 232-251, 266-288, 293-315 and 335-354
31964000271	HMMPfam hit to PF04329, Protein of unknown function DUF470, score 2.9e-15
31964000272	HMMPfam hit to PF04331, Protein of unknown function DUF472, score 5.6e-12
31964000273	leucine-zipper of insertion element IS481; Region: LZ_Tnp_IS481; pfam13011
31964000274	Winged helix-turn helix; Region: HTH_29; pfam13551
31964000275	Integrase core domain; Region: rve; pfam00665
31964000276	Integrase core domain; Region: rve_3; pfam13683
31964000277	HMMPfam hit to PF00665, Integrase, catalytic region, score 3.5E-36
31964000278	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964000279	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964000280	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964000281	Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription]; Region: CitB; COG2197
31964000282	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
31964000283	active site
31964000284	phosphorylation site [posttranslational modification]
31964000285	intermolecular recognition site; other site
31964000286	dimerization interface [polypeptide binding]; other site
31964000287	C-terminal DNA-binding domain of LuxR-like proteins. This domain contains a helix-turn-helix motif and binds DNA. Proteins belonging to this group are response regulators; some act as transcriptional activators, others as transcriptional repressors. Many...; Region: LuxR_C_like; cd06170
31964000288	DNA binding residues [nucleotide binding]
31964000289	dimerization interface [polypeptide binding]; other site
31964000290	HMMPfam hit to PF00072, Response regulator receiver, score 3.9e-27
31964000291	HMMPfam hit to PF00196, Bacterial regulatory protein, LuxR, score 1.7e-06
31964000292	Signal transduction histidine kinase [Signal transduction mechanisms]; Region: COG4585
31964000293	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; Region: HATPase_c; pfam02518
31964000294	ATP binding site [chemical binding]; other site
31964000295	Mg2+ binding site [ion binding]; other site
31964000296	G-X-G motif; other site
31964000297	2 probable transmembrane helices predicted for CMS0027 by TMHMM2.0 at aa 51-73 and 80-102
31964000298	HMMPfam hit to PF07730, Histidine kinase
31964000299	HMMPfam hit to PF02518, ATP-binding region,ATPase-like, score 0.00081
31964000300	5 probable transmembrane helices predicted for CMS0028 by TMHMM2.0 at aa 12-34, 44-66, 78-97, 128-150 and 162-184
31964000301	50S ribosomal protein L36; Validated; Region: rpmJ; PRK00831
31964000302	HMMPfam hit to PF00444, Ribosomal protein L36,score 3.4e-05
31964000303	Cobalamin synthesis protein cobW C-terminal domain; Region: CobW_C; smart00833
31964000304	HMMPfam hit to PF07683, Cobalamin synthesis protein cobW C-terminal domain, score 1.2e-13
31964000305	DEAD-like helicases superfamily; Region: DEXDc; smart00487
31964000306	DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region; Region: DEXDc; cd00046
31964000307	ATP binding site [chemical binding]; other site
31964000308	putative Mg++ binding site [ion binding]; other site
31964000309	Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may...; Region: HELICc; cd00079
31964000310	nucleotide binding region [chemical binding]; other site
31964000311	ATP-binding site [chemical binding]; other site
31964000312	Protein of unknown function (DUF3553); Region: DUF3553; pfam12073
31964000313	HMMPfam hit to PF00270, DEAD/DEAH box helicase,N-terminal, score 4e-26
31964000314	PS00690 DEAH-box subfamily ATP-dependent helicases signature.
31964000315	HMMPfam hit to PF00271, Helicase, C-terminal, score 8.6e-28
31964000316	Predicted helix-turn-helix motif with score 1042.000, SD 2.74 at aa 441-462, sequence VRPAAVAERAGMSARTVGGVLG
31964000317	PS00134 Serine proteases, trypsin family, histidine active site.
31964000318	Uncharacterized protein conserved in Bacteroidetes; Region: Bacuni_01323_like; cd12871
31964000319	Rhs family protein [Cell envelope biogenesis, outer membrane]; Region: RhsA; COG3209
31964000320	RHS Repeat; Region: RHS_repeat; pfam05593
31964000321	RHS repeat-associated core domain; Region: Rhs_assc_core; TIGR03696
31964000322	3 probable transmembrane helices predicted for CMS0033 by TMHMM2.0 at aa 13-35, 1077-1099 and 1104-1126
31964000323	HMMPfam hit to PF05593, YD repeat, score 0.76
31964000324	HMMPfam hit to PF05593, YD repeat, score 0.096
31964000325	HMMPfam hit to PF05593, YD repeat, score 0.00041
31964000326	HMMPfam hit to PF05593, YD repeat, score 4.1
31964000327	HMMPfam hit to PF05593, YD repeat, score 2.2e-06
31964000328	HMMPfam hit to PF05593, YD repeat, score 0.0025
31964000329	HMMPfam hit to PF05593, YD repeat, score 9.6
31964000330	HMMPfam hit to PF05593, YD repeat, score 0.0052
31964000331	HMMPfam hit to PF05593, YD repeat, score 0.024
31964000332	possible sortase recognition site
31964000333	2 probable transmembrane helices predicted for CMS0034 by TMHMM2.0 at aa 13-35 and 40-59
31964000334	1 probable transmembrane helix predicted for CMS0035 by TMHMM2.0 at aa 13-35
31964000335	2 probable transmembrane helices predicted for CMS0036 by TMHMM2.0 at aa 107-126 and 131-148
31964000336	Homeodomain-like domain; Region: HTH_23; cl17451
31964000337	Winged helix-turn helix; Region: HTH_29; pfam13551
31964000338	Integrase core domain; Region: rve; pfam00665
31964000339	Integrase core domain; Region: rve_3; pfam13683
31964000340	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.6e-38
31964000341	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964000342	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964000343	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964000344	Large-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane]; Region: MscL; COG1970
31964000345	large-conductance mechanosensitive channel; Reviewed; Region: mscL; PRK00567
31964000346	HMMPfam hit to PF01741, Large-conductance mechanosensitive channel, score 4.7e-33
31964000347	2 probable transmembrane helices predicted for CMS0039 by TMHMM2.0 at aa 13-35 and 71-93
31964000348	PS01327 Large-conductance mechanosensitive channels mscL family signature.
31964000349	5-formyltetrahydrofolate cyclo-ligase family; Region: 5-FTHF_cyc-lig; pfam01812
31964000350	5,10-methenyltetrahydrofolate synthetase; Region: MTHFS_bact; TIGR02727
31964000351	HMMPfam hit to PF01812, 5-formyltetrahydrofolate cyclo-ligase, score 8.1e-45
31964000352	Prokaryotic UGPase catalyses the synthesis of UDP-glucose; Region: UGPase_prokaryotic; cd02541
31964000353	dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane]; Region: RfbA; COG1209
31964000354	active site
31964000355	tetramer interface; other site
31964000356	HMMPfam hit to PF00483, Nucleotidyl transferase,score 4.8e-14
31964000357	Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis]; Region: RimL; COG1670
31964000358	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cl17182
31964000359	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 2.9e-07
31964000360	3 probable transmembrane helices predicted for CMS0044 by TMHMM2.0 at aa 5-24, 116-138 and 142-159
31964000361	PS00659 Glycosyl hydrolases family 5 signature.
31964000362	HMMPfam hit to PF00553, Cellulose-binding,bacterial type, score 5.5e-06
31964000363	Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis]; Region: HemK; COG2890
31964000364	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
31964000365	S-adenosylmethionine binding site [chemical binding]; other site
31964000366	PS00092 N-6 Adenine-specific DNA methylases signature.
31964000367	Protein of unknown function (DUF3054); Region: DUF3054; pfam11255
31964000368	3 probable transmembrane helices predicted for CMS0048 by TMHMM2.0 at aa 13-35, 48-65 and 70-92
31964000369	Transcriptional regulators [Transcription]; Region: PurR; COG1609
31964000370	Helix-turn-helix (HTH) DNA binding domain of the LacI family of transcriptional regulators; Region: HTH_LacI; cd01392
31964000371	DNA binding site [nucleotide binding]
31964000372	domain linker motif; other site
31964000373	Ligand binding domain of the LacI tanscriptional regulator family belonging to the type I periplasmic-binding fold protein superfamily; Region: PBP1_LacI_sugar_binding_like; cd06267
31964000374	dimerization interface [polypeptide binding]; other site
31964000375	ligand binding site [chemical binding]; other site
31964000376	Predicted helix-turn-helix motif with score 1636.000, SD 4.76 at aa 3-24, sequence ATVKDVAARAGVSPKTVSNVIT
31964000377	PS00356 Bacterial regulatory proteins, lacI family signature.
31964000378	HMMPfam hit to PF00532, Periplasmic binding protein/LacI transcriptional regulator, score 6.4e-08
31964000379	ABC-type sugar transport system, periplasmic component [Carbohydrate transport and metabolism]; Region: UgpB; COG1653
31964000380	HMMPfam hit to PF01547, Bacterial extracellular solute-binding protein, family 1, score 6.3e-13
31964000381	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964000382	PS00017 ATP/GTP-binding site motif A (P-loop).
31964000383	ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism]; Region: PotC; COG1177
31964000384	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964000385	dimer interface [polypeptide binding]; other site
31964000386	ABC-ATPase subunit interface; other site
31964000387	putative PBP binding loops; other site
31964000388	6 probable transmembrane helices predicted for CMS0052 by TMHMM2.0 at aa 2-24, 63-85, 92-114, 143-165,190-212 and 247-269
31964000389	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 8.6e-08
31964000390	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964000391	ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism]; Region: UgpE; COG0395
31964000392	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964000393	dimer interface [polypeptide binding]; other site
31964000394	conserved gate region; other site
31964000395	putative PBP binding loops; other site
31964000396	ABC-ATPase subunit interface; other site
31964000397	6 probable transmembrane helices predicted for CMS0053 by TMHMM2.0 at aa 39-61, 105-127, 136-158,168-190, 223-245 and 267-289
31964000398	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 6e-17
31964000399	Alpha-L-arabinofuranosidase [Carbohydrate transport and metabolism]; Region: AbfA; COG3534
31964000400	Alpha-L-arabinofuranosidase C-terminus; Region: Alpha-L-AF_C; pfam06964
31964000401	HMMPfam hit to PF06964,Alpha-L-arabinofuranosidase, C-terminal, score 3e-53
31964000402	Helix-turn-helix domain; Region: HTH_38; pfam13936
31964000403	Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair]; Region: Tra8; COG2826
31964000404	Integrase core domain; Region: rve; pfam00665
31964000405	PS00017 ATP/GTP-binding site motif A (P-loop).
31964000406	Predicted helix-turn-helix motif with score 1119.000, SD 3.00 at aa 43-64, sequence MSRRVAASRVGVHERTAQDWDR
31964000407	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.8e-28
31964000408	PS01043 Transposases, IS30 family, signature.
31964000409	ATP-dependent DNA helicase RecQ; Region: recQ; TIGR01389
31964000410	DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region; Region: DEXDc; cd00046
31964000411	ATP binding site [chemical binding]; other site
31964000412	putative Mg++ binding site [ion binding]; other site
31964000413	Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may...; Region: HELICc; cd00079
31964000414	nucleotide binding region [chemical binding]; other site
31964000415	ATP-binding site [chemical binding]; other site
31964000416	This DNA-binding domain is found in the RecQ helicase among others and has a helix-turn-helix structure; Region: RQC; smart00956
31964000417	HRDC domain; Region: HRDC; pfam00570
31964000418	HMMPfam hit to PF00270, DEAD/DEAH box helicase,N-terminal, score 2e-28
31964000419	HMMPfam hit to PF00271, Helicase, C-terminal, score 3.7e-25
31964000420	HMMPfam hit to PF00570, HRDC, score 1e-23
31964000421	Putative glycosyl hydrolase of unknown function (DUF1680); Region: DUF1680; pfam07944
31964000422	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG3533
31964000423	The substrate-binding domain of an oligopeptide binding protein (OppA2) from the biosynthesis pathway of the beta-lactamase inhibitor clavulanic acid contains the type 2 periplasmic binding fold; Region: PBP2_clavulanate_OppA2; cd08506
31964000424	peptide binding site [polypeptide binding]; other site
31964000425	Bacterial extracellular solute-binding proteins, family 5 Middle; Region: SBP_bac_5; pfam00496
31964000426	HMMPfam hit to PF00496, Bacterial extracellular solute-binding protein, family 5, score 8e-74
31964000427	ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism]; Region: DppC; COG1173
31964000428	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964000429	dimer interface [polypeptide binding]; other site
31964000430	conserved gate region; other site
31964000431	putative PBP binding loops; other site
31964000432	ABC-ATPase subunit interface; other site
31964000433	6 probable transmembrane helices predicted for CMS0059 by TMHMM2.0 at aa 39-61, 81-100, 121-143, 158-175,182-199 and 287-306
31964000434	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 8.1e-42
31964000435	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964000436	ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism]; Region: DppB; COG0601
31964000437	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964000438	dimer interface [polypeptide binding]; other site
31964000439	conserved gate region; other site
31964000440	putative PBP binding loops; other site
31964000441	ABC-ATPase subunit interface; other site
31964000442	6 probable transmembrane helices predicted for CMS0060 by TMHMM2.0 at aa 9-31, 114-136, 149-171, 196-215,254-276 and 296-318
31964000443	PS00017 ATP/GTP-binding site motif A (P-loop).
31964000444	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 5.4e-44
31964000445	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964000446	ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]; Region: DppF; COG1124
31964000447	ATP-binding cassette domain of nickel/oligopeptides specific transporters; Region: ABC_NikE_OppD_transporters; cd03257
31964000448	Walker A/P-loop; other site
31964000449	ATP binding site [chemical binding]; other site
31964000450	Q-loop/lid; other site
31964000451	ABC transporter signature motif; other site
31964000452	Walker B; other site
31964000453	D-loop; other site
31964000454	H-loop/switch region; other site
31964000455	Oligopeptide/dipeptide transporter, C-terminal region; Region: oligo_HPY; cl07097
31964000456	HMMPfam hit to PF00005, ABC transporter, score 1.5e-52
31964000457	PS00017 ATP/GTP-binding site motif A (P-loop).
31964000458	PS00211 ABC transporters family signature.
31964000459	ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]; Region: DppF; COG1124
31964000460	ATP-binding cassette domain of nickel/oligopeptides specific transporters; Region: ABC_NikE_OppD_transporters; cd03257
31964000461	Walker A/P-loop; other site
31964000462	ATP binding site [chemical binding]; other site
31964000463	Q-loop/lid; other site
31964000464	ABC transporter signature motif; other site
31964000465	Walker B; other site
31964000466	D-loop; other site
31964000467	H-loop/switch region; other site
31964000468	Oligopeptide/dipeptide transporter, C-terminal region; Region: oligo_HPY; pfam08352
31964000469	HMMPfam hit to PF00005, ABC transporter, score 7.4e-58
31964000470	PS00017 ATP/GTP-binding site motif A (P-loop).
31964000471	PS00211 ABC transporters family signature.
31964000472	proline iminopeptidase, Neisseria-type subfamily; Region: pro_imino_pep_1; TIGR01249
31964000473	HMMPfam hit to PF00561, Alpha/beta hydrolase fold,score 3.3e-05
31964000474	Aminopeptidase P, N-terminal domain; Region: AMP_N; smart01011
31964000475	Xaa-Pro aminopeptidase [Amino acid transport and metabolism]; Region: PepP; COG0006
31964000476	Prolidase. E.C. 3.4.13.9. Also known as Xaa-Pro dipeptidase, X-Pro dipeptidase, proline dipeptidase., imidodipeptidase, peptidase D, gamma-peptidase. Catalyses hydrolysis of Xaa-Pro dipeptides; also acts on aminoacyl-hydroxyproline analogs. No action on...; Region: Prolidase; cd01087
31964000477	active site
31964000478	HMMPfam hit to PF05195, Peptidase M24B, X-Pro dipeptidase/aminopeptidase N-terminal, score 7.5e-10
31964000479	HMMPfam hit to PF00557, Peptidase M24, score 2.1e-58
31964000480	phosphonate utilization associated transcriptional regulator; Region: phnR_burk; TIGR03338
31964000481	Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators; Region: WHTH_GntR; cd07377
31964000482	DNA-binding site [nucleotide binding]; DNA binding site
31964000483	FCD domain; Region: FCD; pfam07729
31964000484	Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism]; Region: DadA; COG0665
31964000485	HMMPfam hit to PF00392, Bacterial regulatory protein, GntR, score 2.9e-16
31964000486	HMMPfam hit to PF07729, FCD domain, score 3e-20
31964000487	HMMPfam hit to PF01266, FAD dependent oxidoreductase, score 1.8e-86
31964000488	BFD-like [2Fe-2S] binding domain; Region: Fer2_BFD; pfam04324
31964000489	HMMPfam hit to PF00070, FAD-dependent pyridine nucleotide-disulphide oxidoreductase, score 1.2e-08
31964000490	HMMPfam hit to PF04324, BFD-like [2Fe-2S]-binding region, score 2.6e-09
31964000491	Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane]; Region: DapA; COG0329
31964000492	Dihydrodipicolinate synthase family; Region: DHDPS-like; cd00408
31964000493	inhibitor site; inhibition site
31964000494	active site
31964000495	dimer interface [polypeptide binding]; other site
31964000496	catalytic residue [active]
31964000497	HMMPfam hit to PF00701, Dihydrodipicolinate synthetase, score 2.4e-26
31964000498	hydroxyproline-2-epimerase; Provisional; Region: PRK13971
31964000499	Proline racemase; Region: Pro_racemase; pfam05544
31964000500	HMMPfam hit to PF05544, Proline racemase, score 4.3e-184
31964000501	Alpha-Ketoglutaric Semialdehyde Dehydrogenase; Region: ALDH_KGSADH; cd07129
31964000502	dimer interface [polypeptide binding]; other site
31964000503	NADP binding site [chemical binding]; other site
31964000504	catalytic residues [active]
31964000505	NAD-dependent aldehyde dehydrogenases [Energy production and conversion]; Region: PutA; COG1012
31964000506	HMMPfam hit to PF00171, Aldehyde dehydrogenase,score 1.6e-09
31964000507	PS00070 Aldehyde dehydrogenases cysteine active site.
31964000508	acyl-coenzyme A oxidase; Region: PLN02636
31964000509	Acyl-CoA dehydrogenase; Region: ACAD; cl09933
31964000510	active site
31964000511	HMMPfam hit to PF00441, Acyl-CoA dehydrogenase,C-terminal, score 5.1e-07
31964000512	HMMPfam hit to PF01756, Acyl-CoA oxidase, score 0.00022
31964000513	Membrane proteins related to metalloendopeptidases [Cell envelope biogenesis, outer membrane]; Region: NlpD; COG0739
31964000514	Peptidase family M23; Region: Peptidase_M23; pfam01551
31964000515	HMMPfam hit to PF01551, Peptidase M23B, score 2.6e-33
31964000516	Protein of unknown function (DUF1349); Region: DUF1349; pfam07081
31964000517	HMMPfam hit to PF07081, Protein of unknown function DUF1349, score 8.6e-36
31964000518	PemK-like protein; Region: PemK; pfam02452
31964000519	HMMPfam hit to PF02452, PemK-like protein, score 2.3e-17
31964000520	Ribbon-helix-helix protein, copG family; Region: RHH_1; pfam01402
31964000521	HMMPfam hit to PF01402, Helix-turn-helix protein,CopG, score 4.7e-05
31964000522	Predicted helix-turn-helix motif with score 1046.000, SD 2.75 at aa 13-34, sequence ERFDRVAKRFGMTRSEFYRVAA
31964000523	SGNH_hydrolase subfamily, FeeA, FeeB and similar esterases/lipases. FeeA and FeeB are part of a biosynthetic gene cluster and may participate in the biosynthesis of long-chain N-acyltyrosines by providing saturated and unsaturated fatty acids, which it...; Region: FeeA_FeeB_like; cd01836
31964000524	active site
31964000525	catalytic triad [active]
31964000526	oxyanion hole [active]
31964000527	PS00133 Zinc carboxypeptidases, zinc-binding region 2 signature.
31964000528	2 probable transmembrane helices predicted for CMS0075 by TMHMM2.0 at aa 21-38 and 71-93
31964000529	proline iminopeptidase, Neisseria-type subfamily; Region: pro_imino_pep_1; TIGR01249
31964000530	homoserine O-acetyltransferase; Provisional; Region: metX; cl17114
31964000531	HMMPfam hit to PF00561, Alpha/beta hydrolase fold,score 1e-27
31964000532	nucleotidyl transferase superfamily; Region: nt_trans; cl00015
31964000533	Cytidylyltransferase; Region: CTP_transf_2; pfam01467
31964000534	active site
31964000535	nucleotide binding site [chemical binding]; other site
31964000536	HIGH motif; other site
31964000537	KMSKS motif; other site
31964000538	HMMPfam hit to PF01467, Cytidylyltransferase, score 3.2e-13
31964000539	putative pectinesterase; Region: PLN02432; cl01911
31964000540	Right handed beta helix region; Region: Beta_helix; pfam13229
31964000541	Right handed beta helix region; Region: Beta_helix; pfam13229
31964000542	exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase; Region: EPS_sugtrans; TIGR03025
31964000543	Bacterial sugar transferase; Region: Bac_transf; pfam02397
31964000544	5 probable transmembrane helices predicted for CMS0080 by TMHMM2.0 at aa 57-79, 89-111, 130-147, 151-173 and 330-352
31964000545	HMMPfam hit to PF02397, Bacterial sugar transferase, score 1.7e-78
31964000546	This family is most closely related to the GT1 family of glycosyltransferases. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can...; Region: GT1_like_6; cd04955
31964000547	Glycosyltransferase [Cell envelope biogenesis, outer membrane]; Region: RfaG; COG0438
31964000548	CDP-alcohol phosphatidyltransferase; Region: CDP-OH_P_transf; pfam01066
31964000549	4 probable transmembrane helices predicted for CMS0082 by TMHMM2.0 at aa 70-92, 148-170, 191-213 and 217-239
31964000550	HMMPfam hit to PF01066, CDP-alcohol phosphatidyltransferase, score 0.0028
31964000551	PS00379 CDP-alcohol phosphatidyltransferases signature.
31964000552	This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to...; Region: GT1_YqgM_like; cd03801
31964000553	Glycosyltransferase [Cell envelope biogenesis, outer membrane]; Region: RfaG; COG0438
31964000554	HMMPfam hit to PF00534, Glycosyl transferase, group 1, score 2.6e-30
31964000555	HMMPfam hit to PF00801, PKD, score 1.4e-18
31964000556	HMMPfam hit to PF00801, PKD, score 6.9e-17
31964000557	HMMPfam hit to PF00801, PKD, score 6.7e-20
31964000558	HMMPfam hit to PF00801, PKD, score 1.9e-19
31964000559	PS00213 Lipocalin signature.
31964000560	HMMPfam hit to PF00801, PKD, score 5.1e-20
31964000561	PS00017 ATP/GTP-binding site motif A (P-loop).
31964000562	leucine-zipper of insertion element IS481; Region: LZ_Tnp_IS481; pfam13011
31964000563	Winged helix-turn helix; Region: HTH_29; pfam13551
31964000564	Integrase core domain; Region: rve; pfam00665
31964000565	Integrase core domain; Region: rve_3; pfam13683
31964000566	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964000567	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964000568	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964000569	HMMPfam hit to PF00665, Integrase, catalytic region, score 3.5E-36
31964000570	Glycosyl hydrolase family 10; Region: Glyco_hydro_10; cl01495
31964000571	HMMPfam hit to PF00331, Glycoside hydrolase, family 10, score 5.1e-12
31964000572	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
31964000573	Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]; Region: WcaG; COG0451
31964000574	NAD(P) binding site [chemical binding]; other site
31964000575	active site
31964000576	1 probable transmembrane helix predicted for CMS0088 by TMHMM2.0 at aa 13-35
31964000577	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964000578	8 probable transmembrane helices predicted for CMS0089 by TMHMM2.0 at aa 7-29, 44-66, 86-103, 108-130,150-172, 182-199, 206-223 and 227-249
31964000579	MarR family; Region: MarR; pfam01047
31964000580	HMMPfam hit to PF01047, Bacterial regulatory protein, MarR, score 5.8e-07
31964000581	Predicted helix-turn-helix motif with score 1418.000, SD 4.02 at aa 56-77, sequence LSQIQLARSAHVETQTMSRTLE
31964000582	Uncharacterized conserved protein (COG2071); Region: DUF2071; pfam09844
31964000583	Glucoamylase and related glycosyl hydrolases [Carbohydrate transport and metabolism]; Region: SGA1; COG3387
31964000584	Glycosyl hydrolases family 15; Region: Glyco_hydro_15; pfam00723
31964000585	HMMPfam hit to PF00723, Glycoside hydrolase, family 15, score 3.6e-49
31964000586	Macro domain, Appr-1"-pase_like family. The macro domain is a high-affinity ADP-ribose binding module found in a variety of proteins as a stand-alone domain or in combination with other domains like in histone macroH2A and some PARPs (poly...; Region: Macro_Appr_pase_like; cd02908
31964000587	putative ADP-ribose binding site [chemical binding]; other site
31964000588	putative active site [active]
31964000589	HMMPfam hit to PF01661, Appr-1-p processing, score 2.1e-47
31964000590	Membrane proteins related to metalloendopeptidases [Cell envelope biogenesis, outer membrane]; Region: NlpD; COG0739
31964000591	Peptidase family M23; Region: Peptidase_M23; pfam01551
31964000592	1 probable transmembrane helix predicted for CMS0094 by TMHMM2.0 at aa 29-51
31964000593	HMMPfam hit to PF01551, Peptidase M23B, score 5e-34
31964000594	Cell wall-associated hydrolases (invasion-associated proteins) [Cell envelope biogenesis, outer membrane]; Region: Spr; COG0791
31964000595	NlpC/P60 family; Region: NLPC_P60; cl17555
31964000596	1 probable transmembrane helix predicted for CMS0095 by TMHMM2.0 at aa 13-35
31964000597	HMMPfam hit to PF00877, NLP/P60, score 6.7e-11
31964000598	Inorganic pyrophosphatase. These enzymes hydrolyze inorganic pyrophosphate (PPi) to two molecules of orthophosphates (Pi). The reaction requires bivalent cations. The enzymes in general exist as homooligomers; Region: pyrophosphatase; cd00412
31964000599	dimer interface [polypeptide binding]; other site
31964000600	substrate binding site [chemical binding]; other site
31964000601	metal binding sites [ion binding]; metal-binding site
31964000602	HMMPfam hit to PF00719, Inorganic pyrophosphatase,score 2.4e-56
31964000603	PS00387 Inorganic pyrophosphatase signature.
31964000604	N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning]. This is a subfamily of Adenine nucleotide alpha hydrolases superfamily.Adeninosine nucleotide alpha hydrolases...; Region: PP-ATPase; cd01992
31964000605	tRNA(Ile)-lysidine synthase MesJ [Cell cycle control, cell division, chromosome partitioning]; Region: MesJ; COG0037
31964000606	HMMPfam hit to PF01171, PP-loop, score 3.2e-46
31964000607	Phosphoribosyl transferase (PRT)-type I domain; Region: PRTases_typeI; cd06223
31964000608	active site
31964000609	HMMPfam hit to PF00156, Phosphoribosyltransferase,score 9.7e-33
31964000610	PS00103 Purine/pyrimidine phosphoribosyl transferases signature.
31964000611	FtsH Extracellular; Region: FtsH_ext; pfam06480
31964000612	ATP-dependent metalloprotease FtsH; Region: FtsH_fam; TIGR01241
31964000613	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
31964000614	Walker A motif; other site
31964000615	ATP binding site [chemical binding]; other site
31964000616	Walker B motif; other site
31964000617	arginine finger; other site
31964000618	Peptidase family M41; Region: Peptidase_M41; pfam01434
31964000619	2 probable transmembrane helices predicted for CMS0099 by TMHMM2.0 at aa 10-32 and 111-133
31964000620	HMMPfam hit to PF06480, Peptidase M41, FtsH extracellular, score 2.1e-28
31964000621	HMMPfam hit to PF00004, AAA ATPase, central region,score 3.1e-94
31964000622	PS00017 ATP/GTP-binding site motif A (P-loop).
31964000623	PS00674 AAA-protein family signature.
31964000624	HMMPfam hit to PF01434, Peptidase M41, score 5.2e-113
31964000625	GTP cyclohydrolase I; Provisional; Region: PLN03044
31964000626	GTP cyclohydrolase I; Provisional; Region: folE; PRK09347
31964000627	active site
31964000628	HMMPfam hit to PF01227, GTP cyclohydrolase I, score 7e-29
31964000629	Pterin binding enzymes. This family includes dihydropteroate synthase (DHPS) and cobalamin-dependent methyltransferases such as methyltetrahydrofolate, corrinoid iron-sulfur protein methyltransferase (MeTr) and methionine synthase (MetH).  DHPS, a...; Region: Pterin_binding; cl00219
31964000630	dihydropteroate synthase; Region: DHPS; TIGR01496
31964000631	substrate binding pocket [chemical binding]; other site
31964000632	dimer interface [polypeptide binding]; other site
31964000633	inhibitor binding site; inhibition site
31964000634	PS00792 Dihydropteroate synthase signature 1.
31964000635	HMMPfam hit to PF00809, Dihydropteroate synthase,DHPS, score 1.1e-92
31964000636	PS00793 Dihydropteroate synthase signature 2.
31964000637	4 probable transmembrane helices predicted for CMS0102 by TMHMM2.0 at aa 21-43, 53-75, 82-104 and 119-141
31964000638	Dihydroneopterin aldolase (DHNA) and 7,8-dihydroneopterin triphosphate epimerase domain (DHNTPE); these enzymes have been designated folB and folX, respectively. Folate derivatives are essential cofactors in the biosynthesis of purines, pyrimidines, and...; Region: DHNA_DHNTPE; cd00534
31964000639	homooctamer interface [polypeptide binding]; other site
31964000640	active site
31964000641	7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK). Folate derivatives are essential cofactors in the biosynthesis of purines, pyrimidines, and amino acids as well as formyl-tRNA. Mammalian cells are able to utilize pre-formed folates after...; Region: HPPK; cd00483
31964000642	catalytic center binding site [active]
31964000643	ATP binding site [chemical binding]; other site
31964000644	HMMPfam hit to PF02152, Dihydroneopterin aldolase,score 2.1e-34
31964000645	HMMPfam hit to PF01288,7, 8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK,score 2e-42
31964000646	4 probable transmembrane helices predicted for CMS0104 by TMHMM2.0 at aa 7-29, 34-56, 80-102 and 112-134
31964000647	Bacterial PH domain; Region: DUF304; pfam03703
31964000648	2 probable transmembrane helices predicted for CMS0105 by TMHMM2.0 at aa 20-42 and 47-69
31964000649	HMMPfam hit to PF03703, Bacterial membrane-flanked domain, score 6.4e-17
31964000650	Predicted membrane protein [Function unknown]; Region: COG3428
31964000651	Bacterial PH domain; Region: DUF304; pfam03703
31964000652	Bacterial PH domain; Region: DUF304; cl01348
31964000653	Bacterial PH domain; Region: DUF304; pfam03703
31964000654	3 probable transmembrane helices predicted for CMS0106 by TMHMM2.0 at aa 103-125, 266-288 and 292-311
31964000655	HMMPfam hit to PF03703, Bacterial membrane-flanked domain, score 5.2e-09
31964000656	HMMPfam hit to PF03703, Bacterial membrane-flanked domain, score 1.6e-10
31964000657	HMMPfam hit to PF03703, Bacterial membrane-flanked domain, score 2.3e-11
31964000658	Rossmann-like domain; Region: Rossmann-like; pfam10727
31964000659	Domain of unknown function (DUF2520); Region: DUF2520; pfam10728
31964000660	Pantoate-beta-alanine ligase; Region: PanC; cd00560
31964000661	pantoate--beta-alanine ligase; Region: panC; TIGR00018
31964000662	active site
31964000663	ATP-binding site [chemical binding]; other site
31964000664	pantoate-binding site; other site
31964000665	HXXH motif; other site
31964000666	HMMPfam hit to PF02569, Pantoate-beta-alanine ligase, score 1.7e-101
31964000667	lysyl-tRNA synthetase; Reviewed; Region: lysS; PRK00484
31964000668	LysRS_N: N-terminal, anticodon recognition domain of lysyl-tRNA synthetases (LysRS). These enzymes are homodimeric class 2b aminoacyl-tRNA synthetases (aaRSs). This domain is a beta-barrel domain (OB fold) involved in binding the tRNA anticodon stem-loop; Region: LysRS_N; cd04322
31964000669	dimer interface [polypeptide binding]; other site
31964000670	putative anticodon binding site; other site
31964000671	Class II tRNA amino-acyl synthetase-like catalytic core domain. Class II amino acyl-tRNA synthetases (aaRS) share a common fold and generally attach an amino acid to the 3' OH of ribose of the appropriate tRNA.   PheRS is an exception in that it...; Region: class_II_aaRS-like_core; cl00268
31964000672	motif 1; other site
31964000673	dimer interface [polypeptide binding]; other site
31964000674	active site
31964000675	motif 2; other site
31964000676	motif 3; other site
31964000677	HMMPfam hit to PF01336, OB-fold nucleic acid binding, score 5.4e-13
31964000678	HMMPfam hit to PF00152, tRNA synthetase, class II (D, K and N), score 6.2e-118
31964000679	PS00179 Aminoacyl-transfer RNA synthetases class-II signature 1.
31964000680	1 probable transmembrane helix predicted for CMS0110 by TMHMM2.0 at aa 18-40
31964000681	1 probable transmembrane helix predicted for CMS0111 by TMHMM2.0 at aa 4-26
31964000682	ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]; Region: clpA; COG0542
31964000683	Clp amino terminal domain; Region: Clp_N; pfam02861
31964000684	Clp amino terminal domain; Region: Clp_N; pfam02861
31964000685	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
31964000686	Walker A motif; other site
31964000687	ATP binding site [chemical binding]; other site
31964000688	Walker B motif; other site
31964000689	arginine finger; other site
31964000690	UvrB/uvrC motif; Region: UVR; pfam02151
31964000691	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
31964000692	Walker A motif; other site
31964000693	ATP binding site [chemical binding]; other site
31964000694	Walker B motif; other site
31964000695	C-terminal, D2-small domain, of ClpB protein; Region: ClpB_D2-small; pfam10431
31964000696	HMMPfam hit to PF02861, Clp, N terminal, score 8.4e-22
31964000697	HMMPfam hit to PF02861, Clp, N terminal, score 3.2e-20
31964000698	HMMPfam hit to PF00004, AAA ATPase, central region,score 5e-06
31964000699	PS00017 ATP/GTP-binding site motif A (P-loop).
31964000700	HMMPfam hit to PF02151, UvrB/UvrC protein, score 6.3e-07
31964000701	HMMPfam hit to PF07724, ATPase family associated with various cellular activities (AAA), score 1.1e-100
31964000702	PS00017 ATP/GTP-binding site motif A (P-loop).
31964000703	Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]; Region: WcaG; COG0451
31964000704	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
31964000705	NAD(P) binding site [chemical binding]; other site
31964000706	active site
31964000707	Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols. AKRs are present in all phyla and are of importance to both health and industrial...; Region: Aldo_ket_red; cd06660
31964000708	Aldo/keto reductase family; Region: Aldo_ket_red; pfam00248
31964000709	active site
31964000710	catalytic tetrad [active]
31964000711	HMMPfam hit to PF00248, Aldo/keto reductase, score 2.1e-72
31964000712	Ribosomal protein L10 family, L10 subfamily; composed of bacterial 50S ribosomal protein and eukaryotic mitochondrial 39S ribosomal protein, L10. L10 occupies the L7/L12 stalk of the ribosome. The N-terminal domain (NTD) of L10 interacts with L11 protein...; Region: Ribosomal_L10; cd05797
31964000713	23S rRNA interface [nucleotide binding]; other site
31964000714	Interface with L7/L12 ribosomal proteins [polypeptide binding]; other site
31964000715	HMMPfam hit to PF00466, Ribosomal protein L10,score 1.9e-28
31964000716	PS01109 Ribosomal protein L10 signature.
31964000717	Ribosomal protein L7/L12. Ribosomal protein L7/L12 refers to the large ribosomal subunit proteins L7 and L12, which are identical except that L7 is acetylated at the N terminus. It is a component of the L7/L12 stalk, which is located at the surface of...; Region: Ribosomal_L7_L12; cd00387
31964000718	core dimer interface [polypeptide binding]; other site
31964000719	peripheral dimer interface [polypeptide binding]; other site
31964000720	L10 interface [polypeptide binding]; other site
31964000721	L11 interface [polypeptide binding]; other site
31964000722	putative EF-Tu interaction site [polypeptide binding]; other site
31964000723	putative EF-G interaction site [polypeptide binding]; other site
31964000724	HMMPfam hit to PF00542, Ribosomal protein L7/L12,score 8.9e-33
31964000725	Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription]; Region: CitB; COG2197
31964000726	C-terminal DNA-binding domain of LuxR-like proteins. This domain contains a helix-turn-helix motif and binds DNA. Proteins belonging to this group are response regulators; some act as transcriptional activators, others as transcriptional repressors. Many...; Region: LuxR_C_like; cd06170
31964000727	DNA binding residues [nucleotide binding]
31964000728	HMMPfam hit to PF00196, Bacterial regulatory protein, LuxR, score 1.3e-20
31964000729	Predicted helix-turn-helix motif with score 1502.000, SD 4.30 at aa 489-510, sequence LTVTQIAGRLFISPNTVKSHIR
31964000730	PS00678 Trp-Asp (WD) repeats signature.
31964000731	Winged helix DNA-binding domain; Region: HTH_27; pfam13463
31964000732	HMMPfam hit to PF01047, Bacterial regulatory protein, MarR, score 1.1e-15
31964000733	Predicted helix-turn-helix motif with score 1102.000, SD 2.94 at aa 50-71, sequence MRLGVLAERSRVSQPTTTKIVR
31964000734	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
31964000735	12 probable transmembrane helices predicted for CMS0119 by TMHMM2.0 at aa 21-43, 58-77, 84-103, 113-135,142-164, 168-190, 211-233, 243-265, 277-294, 298-320,333-355 and 365-384
31964000736	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 1.2e-38
31964000737	Transcriptional regulators [Transcription]; Region: PurR; COG1609
31964000738	Helix-turn-helix (HTH) DNA binding domain of the LacI family of transcriptional regulators; Region: HTH_LacI; cd01392
31964000739	DNA binding site [nucleotide binding]
31964000740	domain linker motif; other site
31964000741	Ligand binding domain of the LacI tanscriptional regulator family belonging to the type I periplasmic-binding fold protein superfamily; Region: PBP1_LacI_sugar_binding_like; cd06267
31964000742	dimerization interface [polypeptide binding]; other site
31964000743	ligand binding site [chemical binding]; other site
31964000744	HMMPfam hit to PF00532, Periplasmic binding protein/LacI transcriptional regulator, score 4.5e-07
31964000745	HMMPfam hit to PF00356, Bacterial regulatory protein, LacI, score 2.1e-08
31964000746	Predicted helix-turn-helix motif with score 1498.000, SD 4.29 at aa 7-28, sequence SAIADVARLAGVSKATASRALS
31964000747	PS00356 Bacterial regulatory proteins, lacI family signature.
31964000748	ABC-type sugar transport system, periplasmic component [Carbohydrate transport and metabolism]; Region: UgpB; COG1653
31964000749	Bacterial extracellular solute-binding protein; Region: SBP_bac_1; cl17199
31964000750	HMMPfam hit to PF01547, Bacterial extracellular solute-binding protein, family 1, score 3.1e-09
31964000751	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964000752	ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism]; Region: PotC; COG1177
31964000753	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964000754	dimer interface [polypeptide binding]; other site
31964000755	conserved gate region; other site
31964000756	putative PBP binding loops; other site
31964000757	ABC-ATPase subunit interface; other site
31964000758	7 probable transmembrane helices predicted for CMS0122 by TMHMM2.0 at aa 10-31, 44-66, 100-122, 134-153,190-212, 242-264 and 291-313
31964000759	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 1.7e-08
31964000760	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964000761	ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism]; Region: UgpE; COG0395
31964000762	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964000763	dimer interface [polypeptide binding]; other site
31964000764	conserved gate region; other site
31964000765	putative PBP binding loops; other site
31964000766	ABC-ATPase subunit interface; other site
31964000767	6 probable transmembrane helices predicted for CMS0123 by TMHMM2.0 at aa 43-65, 113-135, 142-164,191-213, 234-256 and 297-319
31964000768	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 1.6e-19
31964000769	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964000770	ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]; Region: MdlB; COG1132
31964000771	ABC transporter transmembrane region; Region: ABC_membrane; pfam00664
31964000772	ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins; Region: ABC_MTABC3_MDL1_MDL2; cd03249
31964000773	Walker A/P-loop; other site
31964000774	ATP binding site [chemical binding]; other site
31964000775	Q-loop/lid; other site
31964000776	ABC transporter signature motif; other site
31964000777	Walker B; other site
31964000778	D-loop; other site
31964000779	H-loop/switch region; other site
31964000780	HMMPfam hit to PF00664, ABC transporter,transmembrane region, score 2.6e-25
31964000781	4 probable transmembrane helices predicted for CMS0124 by TMHMM2.0 at aa 33-55, 103-125, 130-152 and 223-245
31964000782	HMMPfam hit to PF00005, ABC transporter, score 1.3e-53
31964000783	PS00017 ATP/GTP-binding site motif A (P-loop).
31964000784	PS00211 ABC transporters family signature.
31964000785	Domain of unknown function (DUF305); Region: DUF305; pfam03713
31964000786	HMMPfam hit to PF03713, Protein of unknown function DUF305, score 1.1e-11
31964000787	HMMPfam hit to PF03713, Protein of unknown function DUF305, score 3e-05
31964000788	1 probable transmembrane helix predicted for CMS0125 by TMHMM2.0 at aa 65-87
31964000789	Protein of unknown function (DUF3105); Region: DUF3105; pfam11303
31964000790	1 probable transmembrane helix predicted for CMS0126 by TMHMM2.0 at aa 40-62
31964000791	cystathionine beta-synthase; Region: cysta_beta; TIGR01137
31964000792	CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase. CBS is a unique heme-containing enzyme that catalyzes a pyridoxal 5'-phosphate (PLP)-dependent condensation of serine and homocysteine to give cystathionine; Region: CBS_like; cd01561
31964000793	dimer interface [polypeptide binding]; other site
31964000794	pyridoxal 5'-phosphate binding site [chemical binding]; other site
31964000795	catalytic residue [active]
31964000796	This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream.   The vitamin B6 complex comprises pyridoxine, pyridoxal, and pyridoxamine, as well...; Region: CBS_pair_PALP_assoc2; cd04609
31964000797	HMMPfam hit to PF00291,Pyridoxal-5'-phosphate-dependent enzyme, beta subunit,score 5e-102
31964000798	PS00901 Cysteine synthase/cystathionine beta-synthase P-phosphate attachment site.
31964000799	HMMPfam hit to PF00571, CBS, score 2.7e-08
31964000800	HMMPfam hit to PF00571, CBS, score 0.11
31964000801	cystathionine gamma-synthase; Provisional; Region: PRK07811
31964000802	CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis. This pathway is unique to microorganisms and plants, rendering the enzyme an attractive target for the development of...; Region: CGS_like; cd00614
31964000803	homodimer interface [polypeptide binding]; other site
31964000804	substrate-cofactor binding pocket; other site
31964000805	pyridoxal 5'-phosphate binding site [chemical binding]; other site
31964000806	catalytic residue [active]
31964000807	HMMPfam hit to PF01053, Cys/Met metabolism pyridoxal-phosphate-dependent enzymes, score 2.6e-200
31964000808	PS00868 Cys/Met metabolism enzymes pyridoxal-phosphate attachment site.
31964000809	RNase HI family found mainly in prokaryotes; Region: RNase_HI_prokaryote_like; cd09278
31964000810	RNA/DNA hybrid binding site [nucleotide binding]; other site
31964000811	active site
31964000812	Ribbon-helix-helix protein, copG family; Region: RHH_1; pfam01402
31964000813	HMMPfam hit to PF00075, RNase H, score 4.6e-17
31964000814	Transcriptional regulators [Transcription]; Region: PurR; COG1609
31964000815	Helix-turn-helix (HTH) DNA binding domain of the LacI family of transcriptional regulators; Region: HTH_LacI; cd01392
31964000816	DNA binding site [nucleotide binding]
31964000817	domain linker motif; other site
31964000818	Ligand-binding domain of DNA transcription repressor LacI specific for lactose, a member of the LacI-GalR family of bacterial transcription regulators; Region: PBP1_LacI; cd01574
31964000819	ligand binding site [chemical binding]; other site
31964000820	dimerization interface (open form) [polypeptide binding]; other site
31964000821	dimerization interface (closed form) [polypeptide binding]; other site
31964000822	HMMPfam hit to PF00356, Bacterial regulatory protein, LacI, score 7e-11
31964000823	Predicted helix-turn-helix motif with score 2227.000, SD 6.77 at aa 12-33, sequence PSIRDVARLAGVSHQTVSRVLN
31964000824	PS00356 Bacterial regulatory proteins, lacI family signature.
31964000825	HMMPfam hit to PF00532, Periplasmic binding protein/LacI transcriptional regulator, score 0.00039
31964000826	ribulokinase; Provisional; Region: PRK04123
31964000827	Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily; Region: NBD_sugar-kinase_HSP70_actin; cl17037
31964000828	nucleotide binding site [chemical binding]; other site
31964000829	HMMPfam hit to PF00370, Carbohydrate kinase, FGGY,score 7e-06
31964000830	HMMPfam hit to PF02782, Carbohydrate kinase, FGGY,score 1.3e-09
31964000831	L-ribulose-5-phosphate 4-epimerase; Validated; Region: PRK06557
31964000832	intersubunit interface [polypeptide binding]; other site
31964000833	active site
31964000834	Zn2+ binding site [ion binding]; other site
31964000835	HMMPfam hit to PF00596, Class II aldolase/adducin,N-terminal, score 2.6e-70
31964000836	PS00109 Tyrosine protein kinases specific active-site signature.
31964000837	L-arabinose isomerase; Provisional; Region: PRK02929
31964000838	L-fucose isomerase (FucIase) and L-arabinose isomerase (AI) family; composed of FucIase, AI and similar proteins. FucIase converts L-fucose, an aldohexose, to its ketose form, which prepares it for aldol cleavage (similar to the isomerization of glucose...; Region: L-fuc_L-ara-isomerases; cl00947
31964000839	hexamer (dimer of trimers) interface [polypeptide binding]; other site
31964000840	trimer interface [polypeptide binding]; other site
31964000841	substrate binding site [chemical binding]; other site
31964000842	Mn binding site [ion binding]; other site
31964000843	HMMPfam hit to PF02610, L-arabinose isomerase,score 7.4e-253
31964000844	ABC-type xylose transport system, periplasmic component [Carbohydrate transport and metabolism]; Region: XylF; COG4213
31964000845	Periplasmic xylose-binding component of the ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily; Region: PBP1_ABC_xylose_binding; cd01538
31964000846	putative ligand binding site [chemical binding]; other site
31964000847	HMMPfam hit to PF00532, Periplasmic binding protein/LacI transcriptional regulator, score 0.00077
31964000848	xylose transporter ATP-binding subunit; Provisional; Region: PRK13549
31964000849	First domain of the ATP-binding cassette component of monosaccharide transport system; Region: ABC_Carb_Monos_I; cd03216
31964000850	Walker A/P-loop; other site
31964000851	ATP binding site [chemical binding]; other site
31964000852	Q-loop/lid; other site
31964000853	ABC transporter signature motif; other site
31964000854	Walker B; other site
31964000855	D-loop; other site
31964000856	H-loop/switch region; other site
31964000857	Second domain of the ATP-binding cassette component of monosaccharide transport system; Region: ABC_Carb_Monos_II; cd03215
31964000858	HMMPfam hit to PF00005, ABC transporter, score 5.4e-49
31964000859	PS00017 ATP/GTP-binding site motif A (P-loop).
31964000860	HMMPfam hit to PF00005, ABC transporter, score 7.6e-17
31964000861	PS00211 ABC transporters family signature.
31964000862	Branched-chain amino acid transport system / permease component; Region: BPD_transp_2; pfam02653
31964000863	Transmembrane subunit (TM) of Escherichia coli AraH and related proteins. E. coli AraH is the TM of a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of the monosaccharide arabinose. This group...; Region: TM_PBP1_transp_AraH_like; cd06579
31964000864	Transmembrane subunit (TM) of Escherichia coli AraH and related proteins. E. coli AraH is the TM of a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of the monosaccharide arabinose. This group...; Region: TM_PBP1_transp_AraH_like; cd06579
31964000865	TM-ABC transporter signature motif; other site
31964000866	9 probable transmembrane helices predicted for CMS0136 by TMHMM2.0 at aa 15-34, 47-69, 73-95, 102-124,173-192, 213-235, 240-262, 287-306 and 326-348
31964000867	HMMPfam hit to PF02653, Bacterial inner-membrane translocator, score 1.1e-61
31964000868	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964000869	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
31964000870	sequence-specific DNA binding site [nucleotide binding]; other site
31964000871	salt bridge; other site
31964000872	2 probable transmembrane helices predicted for CMS0139 by TMHMM2.0 at aa 5-27 and 31-50
31964000873	HMMPfam hit to PF01381, Helix-turn-helix motif,score 1.5e-08
31964000874	Predicted helix-turn-helix motif with score 1241.000, SD 3.41 at aa 146-167, sequence MAAEDLARATGVSDRTVVAIEN
31964000875	Homeodomain-like domain; Region: HTH_23; cl17451
31964000876	Winged helix-turn helix; Region: HTH_29; pfam13551
31964000877	Integrase core domain; Region: rve; pfam00665
31964000878	Integrase core domain; Region: rve_3; pfam13683
31964000879	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.6e-38
31964000880	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964000881	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964000882	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964000883	xylose isomerase, Arthrobacter type; Region: xylA_Arthro; TIGR02631
31964000884	xylose isomerase; Provisional; Region: PRK12677
31964000885	HMMPfam hit to PF01261, AP endonuclease, family 2,score 5.4e-37
31964000886	PS00172 Xylose isomerase signature 1.
31964000887	Glycosyl hydrolase family 1; Region: Glyco_hydro_1; cl01046
31964000888	beta-galactosidase; Region: BGL; TIGR03356
31964000889	HMMPfam hit to PF00232, Glycoside hydrolase, family 1, score 5.9e-195
31964000890	PS00653 Glycosyl hydrolases family 1 N-terminal signature.
31964000891	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cl17182
31964000892	Acetyltransferase (GNAT) domain; Region: Acetyltransf_3; pfam13302
31964000893	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 4.3e-08
31964000894	MarR family; Region: MarR_2; cl17246
31964000895	helix_turn_helix multiple antibiotic resistance protein; Region: HTH_MARR; smart00347
31964000896	HMMPfam hit to PF01047, Bacterial regulatory protein, MarR, score 4.7e-16
31964000897	Predicted helix-turn-helix motif with score 1321.000, SD 3.69 at aa 54-75, sequence RRAGDLSDAVQLTPGTLSPLFK
31964000898	Bacterial regulatory helix-turn-helix protein, lysR family; Region: HTH_1; pfam00126
31964000899	The substrate binding domain of LysR-type transcriptional regulators (LTTRs), a member of the type 2 periplasmic binding fold protein superfamily; Region: PBP2_LTTR_substrate; cl11398
31964000900	dimerization interface [polypeptide binding]; other site
31964000901	HMMPfam hit to PF03466, LysR, substrate-binding,score 5.1e-38
31964000902	HMMPfam hit to PF00126, Bacterial regulatory protein, LysR, score 1.2e-16
31964000903	PS00044 Bacterial regulatory proteins, lysR family signature.
31964000904	Predicted helix-turn-helix motif with score 1929.000, SD 5.76 at aa 26-47, sequence GSITAAAAALGVSQPALSQTLR
31964000905	Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes. PLP combines with an alpha-amino acid to form a compound called a Schiff base or aldimine intermediate, which depending on the reaction, is the...; Region: AAT_I; cl00321
31964000906	pyridoxal 5'-phosphate binding pocket [chemical binding]; other site
31964000907	catalytic residue [active]
31964000908	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
31964000909	bicyclomycin/multidrug efflux system; Provisional; Region: PRK11102
31964000910	putative substrate translocation pore; other site
31964000911	HMMPfam hit to PF00083, General substrate transporter, score 4.8e-05
31964000912	12 probable transmembrane helices predicted for CMS0147 by TMHMM2.0 at aa 45-67, 82-104, 111-130, 136-158,171-193, 198-220, 249-271, 286-308, 315-337, 347-369,381-403 and 408-427
31964000913	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964000914	PS00216 Sugar transport proteins signature 1.
31964000915	9 probable transmembrane helices predicted for CMS0148 by TMHMM2.0 at aa 20-42, 62-79, 84-101, 108-130,150-169, 176-198, 218-240, 247-269 and 284-303
31964000916	Aminoglycoside/hydroxyurea antibiotic resistance kinase; Region: APH_6_hur; cl17810
31964000917	HMMPfam hit to PF04655, Aminoglycoside/hydroxyurea antibiotic resistance kinase, score 2.7e-44
31964000918	3 probable transmembrane helices predicted for CMS0150 by TMHMM2.0 at aa 21-43, 53-72 and 188-210
31964000919	Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription]; Region: CitB; COG2197
31964000920	C-terminal DNA-binding domain of LuxR-like proteins. This domain contains a helix-turn-helix motif and binds DNA. Proteins belonging to this group are response regulators; some act as transcriptional activators, others as transcriptional repressors. Many...; Region: LuxR_C_like; cd06170
31964000921	DNA binding residues [nucleotide binding]
31964000922	dimerization interface [polypeptide binding]; other site
31964000923	HMMPfam hit to PF00196, Bacterial regulatory protein, LuxR, score 2.6e-16
31964000924	Predicted helix-turn-helix motif with score 1028.000, SD 2.69 at aa 976-997, sequence LSNREIAGRLFLSVRTVESHLY
31964000925	atypical (a) SDRs, subgroup 5; Region: SDR_a5; cd05243
31964000926	NADH(P)-binding; Region: NAD_binding_10; pfam13460
31964000927	NAD(P) binding site [chemical binding]; other site
31964000928	putative active site [active]
31964000929	phosphate acetyltransferase; Reviewed; Region: PRK05632
31964000930	metallophosphatase superfamily, metallophosphatase domain; Region: MPP_superfamily; cl13995
31964000931	DRTGG domain; Region: DRTGG; pfam07085
31964000932	phosphotransacetylase; Reviewed; Region: eutD; PRK09653
31964000933	PS00017 ATP/GTP-binding site motif A (P-loop).
31964000934	HMMPfam hit to PF07085, DRTGG, score 2.4e-30
31964000935	HMMPfam hit to PF01515, Phosphate acetyl/butaryl transferase, score 6.3e-177
31964000936	propionate/acetate kinase; Provisional; Region: PRK12379
31964000937	acetate kinase A/propionate kinase 2; Reviewed; Region: PRK00180
31964000938	HMMPfam hit to PF00871, Acetate and butyrate kinase, score 7.6e-190
31964000939	PS01075 Acetate and butyrate kinases family signature 1.
31964000940	2 probable transmembrane helices predicted for CMS0155 by TMHMM2.0 at aa 7-29 and 1408-1427
31964000941	Peptidase S46; Region: Peptidase_S46; pfam10459
31964000942	1 probable transmembrane helix predicted for CMS0156 by TMHMM2.0 at aa 57-79
31964000943	Vitamin K-dependent gamma-carboxylase; Region: VKG_Carbox; cl02773
31964000944	7 probable transmembrane helices predicted for CMS0157 by TMHMM2.0 at aa 73-95, 131-150, 155-177,181-200, 238-260, 302-324 and 329-351
31964000945	DNA polymerase III, subunit gamma and tau; Region: dnaX_nterm; TIGR02397
31964000946	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
31964000947	Walker A motif; other site
31964000948	ATP binding site [chemical binding]; other site
31964000949	Walker B motif; other site
31964000950	arginine finger; other site
31964000951	DNA polymerase III subunits gamma and tau domain III; Region: DNA_pol3_gamma3; pfam12169
31964000952	HMMPfam hit to PF00004, AAA ATPase, central region,score 1.1e-06
31964000953	PS00017 ATP/GTP-binding site motif A (P-loop).
31964000954	recombination protein RecR; Reviewed; Region: recR; PRK00076
31964000955	endonuclease III; includes endonuclease III (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA glycosidases (Alka-family) and other DNA glycosidases; Region: ENDO3c; cl14786
31964000956	RecR protein; Region: RecR; pfam02132
31964000957	TOPRIM_recR: topoisomerase-primase (TOPRIM) nucleotidyl transferase/hydrolase domain of the type found in Escherichia coli RecR.  RecR participates in the RecFOR pathway of homologous recombinational repair in prokaryotes. This pathway provides a...; Region: TOPRIM_recR; cd01025
31964000958	putative active site [active]
31964000959	putative metal-binding site [ion binding]; other site
31964000960	tetramer interface [polypeptide binding]; other site
31964000961	HMMPfam hit to PF00633, Helix-hairpin-helix motif,score 0.0099
31964000962	HMMPfam hit to PF02132, RecR protein, score 5e-14
31964000963	PS01300 RecR protein signature.
31964000964	HMMPfam hit to PF01751, TOPRIM, score 4.2e-17
31964000965	aspartate kinase; Reviewed; Region: PRK06635
31964000966	AAK_AKii-LysC-BS: Amino Acid Kinase Superfamily (AAK), AKii; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, and the lysine plus threonine-sensitive...; Region: AAK_AKii-LysC-BS; cd04261
31964000967	putative nucleotide binding site [chemical binding]; other site
31964000968	putative catalytic residues [active]
31964000969	putative Mg ion binding site [ion binding]; other site
31964000970	putative aspartate binding site [chemical binding]; other site
31964000971	ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related proteins; Region: ACT_AKii-LysC-BS-like_1; cd04913
31964000972	putative allosteric regulatory site; other site
31964000973	ACT domains of the lysine-sensitive, aspartokinase (AK) isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related domains; Region: ACT_AKii-LysC-BS-like_2; cd04936
31964000974	putative allosteric regulatory residue; other site
31964000975	HMMPfam hit to PF00696,Aspartate/glutamate/uridylate kinase, score 1e-76
31964000976	PS00324 Aspartokinase signature.
31964000977	HMMPfam hit to PF01842, Amino acid-binding ACT,score 1.6e-09
31964000978	HMMPfam hit to PF01842, Amino acid-binding ACT,score 1.1e-08
31964000979	aspartate-semialdehyde dehydrogenase; Provisional; Region: PRK14874
31964000980	Semialdehyde dehydrogenase, NAD binding domain; Region: Semialdhyde_dh; smart00859
31964000981	HMMPfam hit to PF01118, Semialdehyde dehydrogenase,score 9.2e-56
31964000982	HMMPfam hit to PF02774, Semialdehyde dehydrogenase,score 7.1e-66
31964000983	PS01103 Aspartate-semialdehyde dehydrogenase signature.
31964000984	malate:quinone oxidoreductase; Validated; Region: PRK05257
31964000985	malate:quinone-oxidoreductase; Region: mal_quin_oxido; TIGR01320
31964000986	HMMPfam hit to PF06039,Malate:quinone-oxidoreductase, score 0
31964000987	C-terminal DNA-binding domain of LuxR-like proteins. This domain contains a helix-turn-helix motif and binds DNA. Proteins belonging to this group are response regulators; some act as transcriptional activators, others as transcriptional repressors. Many...; Region: LuxR_C_like; cl17315
31964000988	DNA binding residues [nucleotide binding]
31964000989	dimerization interface [polypeptide binding]; other site
31964000990	HMMPfam hit to PF00072, Response regulator receiver, score 0.00059
31964000991	thymidine kinase; Provisional; Region: PRK04296
31964000992	TIGR04140 family protein; Region: chp_AF_0576
31964000993	HMMPfam hit to PF00265, Thymidine kinase, score 2.9e-25
31964000994	Chain length determinant protein; Region: Wzz; cl15801
31964000995	capsular exopolysaccharide family; Region: eps_fam; TIGR01007
31964000996	The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain. Functionally, proteins in this superfamily use the energy from hydrolysis of NTP to transfer electron or ion; Region: Fer4_NifH; cl17203
31964000997	HMMPfam hit to PF02706, Lipopolysaccharide biosynthesis, score 5.4e-23
31964000998	1 probable transmembrane helix predicted for CMS0167 by TMHMM2.0 at aa 62-84
31964000999	PS00017 ATP/GTP-binding site motif A (P-loop).
31964001000	1 probable transmembrane helix predicted for CMS0168 by TMHMM2.0 at aa 13-35
31964001001	Protein of unknown function (DUF4012); Region: DUF4012; pfam13196
31964001002	1 probable transmembrane helix predicted for CMS0169 by TMHMM2.0 at aa 24-46
31964001003	1 probable transmembrane helix predicted for CMS0170 by TMHMM2.0 at aa 189-211
31964001004	1 probable transmembrane helix predicted for CMS0171 by TMHMM2.0 at aa 152-174
31964001005	VanZ like family; Region: VanZ; cl01971
31964001006	HMMPfam hit to PF04892, VanZ like protein, score 0.00076
31964001007	4 probable transmembrane helices predicted for CMS0172 by TMHMM2.0 at aa 23-40, 75-92, 97-119 and 129-148
31964001008	luciferase family oxidoreductase, group 1; Region: oxido_grp_1; TIGR03558
31964001009	probable oxidoreductase, LLM family; Region: LLM_2I7G; TIGR03858
31964001010	Flavin-utilizing monoxygenases; Region: Flavin_utilizing_monoxygenases; cd00347
31964001011	HMMPfam hit to PF00296, Bacterial luciferase, score 5.5e-14
31964001012	Transglycosylase; Region: Transgly; pfam00912
31964001013	penicillin-binding protein, 1A family; Region: PBP_1a_fam; TIGR02074
31964001014	Penicillin binding protein transpeptidase domain; Region: Transpeptidase; cl17760
31964001015	1 probable transmembrane helix predicted for CMS0174 by TMHMM2.0 at aa 5-27
31964001016	HMMPfam hit to PF00912, Glycosyl transferase,family 51, score 3.2e-60
31964001017	HMMPfam hit to PF00905, Penicillin-binding protein,transpeptidase, score 9.7e-07
31964001018	PS00017 ATP/GTP-binding site motif A (P-loop).
31964001019	Predicted acyltransferases [Lipid metabolism]; Region: COG1835
31964001020	11 probable transmembrane helices predicted for CMS0175 by TMHMM2.0 at aa 10-32, 53-75, 95-117, 126-148,158-180, 187-209, 238-260, 269-288, 292-314, 327-349 and 364-386
31964001021	HMMPfam hit to PF01757, Acyltransferase 3, score 1.2e-22
31964001022	4 probable transmembrane helices predicted for CMS0176 by TMHMM2.0 at aa 7-29, 44-66, 73-95 and 110-132
31964001023	Bacillus subtilis YkuE and related proteins, C-terminal metallophosphatase domain; Region: MPP_YkuE_C; cd07385
31964001024	Calcineurin-like phosphoesterase; Region: Metallophos; pfam00149
31964001025	putative active site [active]
31964001026	putative metal binding site [ion binding]; other site
31964001027	HMMPfam hit to PF00149, Metallophosphoesterase,score 1.5e-14
31964001028	1 probable transmembrane helix predicted for CMS0177 by TMHMM2.0 at aa 5-27
31964001029	Membrane carboxypeptidase (penicillin-binding protein) [Cell envelope biogenesis, outer membrane]; Region: MrcB; COG0744
31964001030	Transglycosylase; Region: Transgly; pfam00912
31964001031	Penicillin binding protein transpeptidase domain; Region: Transpeptidase; cl17760
31964001032	PASTA domain of bacterial serine/threonine kinase pknB-like proteins. PknB is a member of a group of related transmembrane sensor kinases present in many gram positive bacteria, which has been shown to regulate cell shape in Mycobacterium tubercolosis; Region: PASTA_pknB; cd06577
31964001033	PASTA domain of bacterial serine/threonine kinase pknB-like proteins. PknB is a member of a group of related transmembrane sensor kinases present in many gram positive bacteria, which has been shown to regulate cell shape in Mycobacterium tubercolosis; Region: PASTA_pknB; cd06577
31964001034	HMMPfam hit to PF03793, PASTA, score 1.7e-10
31964001035	HMMPfam hit to PF03793, PASTA, score 8.1e-11
31964001036	HMMPfam hit to PF00905, Penicillin-binding protein,transpeptidase, score 6.5e-07
31964001037	PS00017 ATP/GTP-binding site motif A (P-loop).
31964001038	PS00146 Beta-lactamase class-A active site.
31964001039	HMMPfam hit to PF00912, Glycosyl transferase,family 51, score 5.7e-55
31964001040	1 probable transmembrane helix predicted for CMS0178 by TMHMM2.0 at aa 104-126
31964001041	Domain of unknown function (DUF4177); Region: DUF4177; pfam13783
31964001042	This group of proteins belong to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function.  The conserved domain is similar in structure to chorismate mutase but there is no sequence...; Region: YjgF_YER057c_UK114_like_1; cd02199
31964001043	homotrimer interaction site [polypeptide binding]; other site
31964001044	putative active site [active]
31964001045	HMMPfam hit to PF01042, Endoribonuclease L-PSP,score 5.2e-21
31964001046	acetyl-CoA synthetase; Provisional; Region: PRK00174
31964001047	Acetyl-CoA synthetase (also known as acetate-CoA ligase and acetyl-activating enzyme); Region: ACS; cd05966
31964001048	active site
31964001049	CoA binding site [chemical binding]; other site
31964001050	acyl-activating enzyme (AAE) consensus motif; other site
31964001051	AMP binding site [chemical binding]; other site
31964001052	acetate binding site [chemical binding]; other site
31964001053	HMMPfam hit to PF00501, AMP-dependent synthetase and ligase, score 6e-136
31964001054	PS00455  AMP-binding domain signature.
31964001055	Type II/IV secretion system protein; Region: T2SE; pfam00437
31964001056	Type IV secretory pathway component VirB11, and related ATPases. The homohexamer, VirB11 is one of eleven Vir proteins, which are required for T-pilus biogenesis and virulence in the transfer of T-DNA from the Ti (tumor-inducing) plasmid of bacterial to...; Region: VirB11-like_ATPase; cd01130
31964001057	ATP binding site [chemical binding]; other site
31964001058	Walker A motif; other site
31964001059	hexamer interface [polypeptide binding]; other site
31964001060	Walker B motif; other site
31964001061	HMMPfam hit to PF00437, Bacterial type II secretion system protein E, score 1.2e-65
31964001062	PS00017 ATP/GTP-binding site motif A (P-loop).
31964001063	3 probable transmembrane helices predicted for CMS0183 by TMHMM2.0 at aa 149-171, 176-198 and 303-325
31964001064	Protein of unknown function (DUF4244); Region: DUF4244; pfam14029
31964001065	1 probable transmembrane helix predicted for CMS0184 by TMHMM2.0 at aa 145-167
31964001066	1 probable transmembrane helix predicted for CMS0185 by TMHMM2.0 at aa 26-48
31964001067	1 probable transmembrane helix predicted for CMS0186 by TMHMM2.0 at aa 10-32
31964001068	DNA topoisomerase I subunit omega; Validated; Region: PRK07561
31964001069	TOPRIM_TopoIA_TopoI: The topoisomerase-primase (TORPIM) domain found in members of the type IA family of DNA topoisomerases (Topo IA) similar to Escherichia coli DNA topoisomerase I.   Type IA DNA topoisomerases remove (relax) negative supercoils in the...; Region: TOPRIM_TopoIA_TopoI; cd03363
31964001070	active site
31964001071	interdomain interaction site; other site
31964001072	putative metal-binding site [ion binding]; other site
31964001073	nucleotide binding site [chemical binding]; other site
31964001074	DNA Topoisomerase, subtype IA; DNA-binding, ATP-binding and catalytic domain of bacterial DNA topoisomerases I and III, and eukaryotic DNA topoisomerase III and eubacterial and archael reverse gyrases. Topoisomerases clevage single or double stranded DNA...; Region: TOP1Ac; cd00186
31964001075	domain I; other site
31964001076	DNA binding groove [nucleotide binding]
31964001077	phosphate binding site [ion binding]; other site
31964001078	domain II; other site
31964001079	domain III; other site
31964001080	nucleotide binding site [chemical binding]; other site
31964001081	catalytic site [active]
31964001082	domain IV; other site
31964001083	Topoisomerase C-terminal repeat; Region: Toprim_C_rpt; pfam13368
31964001084	Topoisomerase C-terminal repeat; Region: Toprim_C_rpt; pfam13368
31964001085	HMMPfam hit to PF01751, TOPRIM, score 1.7e-38
31964001086	HMMPfam hit to PF01131, DNA topoisomerase I, score 3.3e-171
31964001087	PS00396 Prokaryotic DNA topoisomerase I active site.
31964001088	thymidylate kinase; Region: DTMP_kinase; TIGR00041
31964001089	Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor. TMPK represents the rate-limiting step...; Region: TMPK; cd01672
31964001090	TMP-binding site; other site
31964001091	ATP-binding site [chemical binding]; other site
31964001092	HMMPfam hit to PF02223, Thymidylate kinase, score 7.1e-61
31964001093	PS00017 ATP/GTP-binding site motif A (P-loop).
31964001094	DNA polymerase III subunit delta'; Validated; Region: PRK07940
31964001095	DNA polymerase III subunit delta'; Validated; Region: PRK08485
31964001096	alpha/beta hydrolase fold; Region: Abhydrolase_1; pfam00561
31964001097	TAP-like protein; Region: Abhydrolase_4; pfam08386
31964001098	1 probable transmembrane helix predicted for CMS0190 by TMHMM2.0 at aa 13-35
31964001099	HMMPfam hit to PF00561, Alpha/beta hydrolase fold,score 2.8e-11
31964001100	PS00120 Lipases, serine active site.
31964001101	D-Ala-D-Ala carboxypeptidase 3 (S13) family; Region: Peptidase_S13; cl17429
31964001102	D-alanyl-D-alanine carboxypeptidase, serine-type, PBP4 family; Region: PBP4; TIGR00666
31964001103	HMMPfam hit to PF02113, Peptidase S13, D-Ala-D-Ala carboxypeptidase C, score 9.7e-14
31964001104	Cysteine hydrolases; This family contains amidohydrolases, like CSHase (N-carbamoylsarcosine amidohydrolase), involved in creatine metabolism and nicotinamidase, converting nicotinamide to nicotinic acid and ammonia in the pyridine nucleotide cycle. It...; Region: cysteine_hydrolases; cl00220
31964001105	catalytic triad [active]
31964001106	conserved cis-peptide bond; other site
31964001107	HMMPfam hit to PF00857, Isochorismatase hydrolase,score 7.3e-08
31964001108	succinic semialdehyde dehydrogenase; Region: PLN02278
31964001109	Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like; Region: ALDH_F5_SSADH_GabD; cd07103
31964001110	tetramerization interface [polypeptide binding]; other site
31964001111	NAD(P) binding site [chemical binding]; other site
31964001112	catalytic residues [active]
31964001113	HMMPfam hit to PF00171, Aldehyde dehydrogenase,score 7.3e-190
31964001114	PS00687 Aldehyde dehydrogenases glutamic acid active site.
31964001115	PS00070 Aldehyde dehydrogenases cysteine active site.
31964001116	rRNA methylases [Translation, ribosomal structure and biogenesis]; Region: SpoU; COG0566
31964001117	SpoU rRNA Methylase family; Region: SpoU_methylase; pfam00588
31964001118	HMMPfam hit to PF00588, tRNA/rRNA methyltransferase (SpoU), score 2.4e-35
31964001119	3 probable transmembrane helices predicted for CMS0195 by TMHMM2.0 at aa 13-33, 48-70 and 83-105
31964001120	ABC transporter transmembrane region; Region: ABC_membrane; pfam00664
31964001121	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
31964001122	Walker A/P-loop; other site
31964001123	ATP binding site [chemical binding]; other site
31964001124	ABC transporter; Region: ABC_tran; pfam00005
31964001125	Q-loop/lid; other site
31964001126	ABC transporter signature motif; other site
31964001127	Walker B; other site
31964001128	D-loop; other site
31964001129	H-loop/switch region; other site
31964001130	HMMPfam hit to PF00005, ABC transporter, score 2.7e-52
31964001131	PS00211 ABC transporters family signature.
31964001132	PS00017 ATP/GTP-binding site motif A (P-loop).
31964001133	6 probable transmembrane helices predicted for CMS0196 by TMHMM2.0 at aa 47-69, 79-101, 159-181, 185-207,267-289 and 304-326
31964001134	HMMPfam hit to PF00664, ABC transporter,transmembrane region, score 2.1e-39
31964001135	nodulation ABC transporter NodI; Provisional; Region: PRK13537
31964001136	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
31964001137	Walker A/P-loop; other site
31964001138	ATP binding site [chemical binding]; other site
31964001139	Q-loop/lid; other site
31964001140	ABC transporter signature motif; other site
31964001141	Walker B; other site
31964001142	D-loop; other site
31964001143	H-loop/switch region; other site
31964001144	HMMPfam hit to PF00005, ABC transporter, score 6.5e-60
31964001145	PS00017 ATP/GTP-binding site motif A (P-loop).
31964001146	PS00211 ABC transporters family signature.
31964001147	ABC-2 type transporter; Region: ABC2_membrane; cl17235
31964001148	ABC-type multidrug transport system, permease component [Defense mechanisms]; Region: COG0842
31964001149	6 probable transmembrane helices predicted for CMS0198 by TMHMM2.0 at aa 29-51, 71-93, 129-151, 161-183,196-218 and 244-266
31964001150	HMMPfam hit to PF01061, ABC-2, score 1.7e-08
31964001151	ABC-2 type transporter; Region: ABC2_membrane; cl17235
31964001152	6 probable transmembrane helices predicted for CMS0199 by TMHMM2.0 at aa 51-73, 83-105, 125-147, 167-189,202-224 and 248-270
31964001153	HMMPfam hit to PF01061, ABC-2, score 5.1e-16
31964001154	H+ Antiporter protein; Region: 2A0121; TIGR00900
31964001155	11 probable transmembrane helices predicted for tmhmm2embl_unknown_000000_239779_241200 by TMHMM2.0 at aa 24-46, 59-81, 101-123, 160-182, 187-205, 256-278, 291-313,320-342, 346-368, 381-403 and 413-435
31964001156	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964001157	ribokinase/pfkB superfamily: Kinases that accept a wide variety of substrates, including carbohydrates and aromatic small molecules, all are phosphorylated at a hydroxyl group. The superfamily includes ribokinase, fructokinase, ketohexokinase; Region: ribokinase_pfkB_like; cl00192
31964001158	Sugar kinases, ribokinase family [Carbohydrate transport and metabolism]; Region: RbsK; COG0524
31964001159	substrate binding site [chemical binding]; other site
31964001160	Sugar kinases, ribokinase family [Carbohydrate transport and metabolism]; Region: RbsK; COG0524
31964001161	ATP binding site [chemical binding]; other site
31964001162	HMMPfam hit to PF00294, Carbohydrate kinase, PfkB,score 4.3e-44
31964001163	PS00583 pfkB family of carbohydrate kinases signature 1.
31964001164	PS00584 pfkB family of carbohydrate kinases signature 2.
31964001165	Predicted transcriptional regulators [Transcription]; Region: HipB; COG1396
31964001166	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
31964001167	non-specific DNA binding site [nucleotide binding]; other site
31964001168	salt bridge; other site
31964001169	sequence-specific DNA binding site [nucleotide binding]; other site
31964001170	2 probable transmembrane helices predicted for CMS0203 by TMHMM2.0 at aa 116-138 and 143-165
31964001171	HMMPfam hit to PF01381, Helix-turn-helix motif,score 4.6e-15
31964001172	Predicted helix-turn-helix motif with score 1720.000, SD 5.05 at aa 36-57, sequence WTQDRLAEASGITVRTVQRLEA
31964001173	2 probable transmembrane helices predicted for CMS0204 by TMHMM2.0 at aa 13-32 and 43-65
31964001174	2 probable transmembrane helices predicted for CMS0205 by TMHMM2.0 at aa 7-29 and 39-61
31964001175	PS00044 Bacterial regulatory proteins, lysR family signature.
31964001176	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG2258
31964001177	MOSC domain; Region: MOSC; pfam03473
31964001178	HMMPfam hit to PF03473, MOSC, score 3.7e-09
31964001179	6 probable transmembrane helices predicted for CMS0207 by TMHMM2.0 at aa 13-35, 50-72, 85-107, 122-144,157-179 and 189-211
31964001180	metabolite-proton symporter; Region: 2A0106; TIGR00883
31964001181	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
31964001182	HMMPfam hit to PF00083, General substrate transporter, score 2.1e-43
31964001183	12 probable transmembrane helices predicted for CMS0208 by TMHMM2.0 at aa 13-32, 42-64, 76-98, 108-130,143-165, 175-197, 230-252, 291-313, 320-342, 347-369,382-404 and 409-431
31964001184	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964001185	PS00217 Sugar transport proteins signature 2.
31964001186	metabolite-proton symporter; Region: 2A0106; TIGR00883
31964001187	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
31964001188	HMMPfam hit to PF00083, General substrate transporter, score 2.9e-58
31964001189	12 probable transmembrane helices predicted for CMS0209 by TMHMM2.0 at aa 71-93, 103-125, 137-159,169-191, 204-226, 236-258, 291-313, 352-374, 383-405,409-431, 444-466 and 471-493
31964001190	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964001191	1 probable transmembrane helix predicted for CMS0210 by TMHMM2.0 at aa 47-69
31964001192	Homeodomain-like domain; Region: HTH_23; cl17451
31964001193	Winged helix-turn helix; Region: HTH_29; pfam13551
31964001194	Integrase core domain; Region: rve; pfam00665
31964001195	Integrase core domain; Region: rve_3; pfam13683
31964001196	HMMPfam hit to PF00665, Integrase, catalytic region, score 5.7e-38
31964001197	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964001198	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964001199	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964001200	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cd04301
31964001201	Coenzyme A binding pocket [chemical binding]; other site
31964001202	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 1.2e-13
31964001203	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
31964001204	NAD(P) binding site [chemical binding]; other site
31964001205	active site
31964001206	Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]; Region: WcaG; COG0451
31964001207	Uncharacterized protein family (UPF0157); Region: UPF0157; cl00987
31964001208	HMMPfam hit to PF04229, Protein of unknown function UPF0157, score 1.3e-18
31964001209	Cytidine deaminase zinc-binding domain. These enzymes are Zn dependent. The zinc ion in the active site plays a central role in the proposed catalytic mechanism, activating a water molecule to form a hydroxide ion that performs a nucleophilic attack on...; Region: cytidine_deaminase; cd01283
31964001210	active site
31964001211	catalytic motif [active]
31964001212	Zn binding site [ion binding]; other site
31964001213	HMMPfam hit to PF00383, Cytidine/deoxycytidylate deaminase, zinc-binding region, score 1.8e-05
31964001214	PS00903 Cytidine and deoxycytidylate deaminases zinc-binding region signature.
31964001215	TM1410 hypothetical-related protein; Region: DUF297; cl00997
31964001216	Homeodomain-like domain; Region: HTH_23; cl17451
31964001217	Winged helix-turn helix; Region: HTH_29; pfam13551
31964001218	Integrase core domain; Region: rve; pfam00665
31964001219	Integrase core domain; Region: rve_3; pfam13683
31964001220	HMMPfam hit to PF00665, Integrase, catalytic region, score 9.5e-39
31964001221	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964001222	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964001223	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964001224	ASC-1 homology domain, subfamily similar to Enterococcus faecalis Ef3133. The ASCH domain, a small beta-barrel domain found in all three kingdoms of life, resembles the RNA-binding PUA domain and may also interact with RNA. ASCH has been proposed to...; Region: ASCH_Ef3133_like; cd06553
31964001225	HMMPfam hit to PF06171, Protein of unknown function DUF984, score 2e-42
31964001226	oxidoreductase; Provisional; Region: PRK06128
31964001227	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
31964001228	NAD(P) binding site [chemical binding]; other site
31964001229	active site
31964001230	HMMPfam hit to PF00106, Short-chain dehydrogenase/reductase SDR, score 2.5e-58
31964001231	PS00061 Short-chain dehydrogenases/reductases family signature.
31964001232	MOSC domain; Region: MOSC; pfam03473
31964001233	PAS fold; Region: PAS_4; pfam08448
31964001234	Signal transduction histidine kinase [Signal transduction mechanisms]; Region: BaeS; COG0642
31964001235	Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via...; Region: HisKA; cd00082
31964001236	dimer interface [polypeptide binding]; other site
31964001237	phosphorylation site [posttranslational modification]
31964001238	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
31964001239	ATP binding site [chemical binding]; other site
31964001240	Mg2+ binding site [ion binding]; other site
31964001241	G-X-G motif; other site
31964001242	5 probable transmembrane helices predicted for CMS0223 by TMHMM2.0 at aa 30-52, 59-78, 104-126, 131-153 and 158-180
31964001243	HMMPfam hit to PF00512, Histidine kinase A,N-terminal, score 5.4e-18
31964001244	HMMPfam hit to PF02518, ATP-binding region,ATPase-like, score 3.7e-42
31964001245	Histidine Phosphotransfer domain, involved in signalling through a two part component systems in which an autophosphorylating histidine protein kinase serves as a phosphoryl donor to a response regulator protein; the response regulator protein is...; Region: HPT; cl00086
31964001246	putative binding surface; other site
31964001247	HMMPfam hit to PF01627, Hpt, score 1.9e-05
31964001248	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
31964001249	Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription]; Region: OmpR; COG0745
31964001250	active site
31964001251	phosphorylation site [posttranslational modification]
31964001252	intermolecular recognition site; other site
31964001253	dimerization interface [polypeptide binding]; other site
31964001254	Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription]; Region: OmpR; COG0745
31964001255	Effector domain of response regulator. Bacteria and certain eukaryotes like protozoa and higher plants use two-component signal transduction systems to detect and respond to changes in the environment. The system consists of a sensor histidine kinase and...; Region: trans_reg_C; cd00383
31964001256	DNA binding site [nucleotide binding]
31964001257	HMMPfam hit to PF00486, Transcriptional regulatory protein, C-terminal, score 3.1e-15
31964001258	HMMPfam hit to PF00072, Response regulator receiver, score 6.8e-20
31964001259	3 probable transmembrane helices predicted for CMS0226 by TMHMM2.0 at aa 13-35, 55-77 and 90-112
31964001260	Escherichia coli exonuclease III (ExoIII) and Neisseria meningitides NExo-like subfamily of the ExoIII family purinic/apyrimidinic (AP) endonucleases; Region: ExoIII-like_AP-endo; cd09086
31964001261	putative catalytic site [active]
31964001262	putative phosphate binding site [ion binding]; other site
31964001263	active site
31964001264	metal binding site A [ion binding]; metal-binding site
31964001265	DNA binding site [nucleotide binding]
31964001266	putative AP binding site [nucleotide binding]; other site
31964001267	putative metal binding site B [ion binding]; other site
31964001268	HMMPfam hit to PF03372,Endonuclease/exonuclease/phosphatase, score 1.8e-45
31964001269	Asp23 family; Region: Asp23; pfam03780
31964001270	RNA polymerase sigma factor, sigma-70 family; Region: sigma70-ECF; TIGR02937
31964001271	Sigma-70 region 2; Region: Sigma70_r2; pfam04542
31964001272	Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs). A SF is a dissociable subunit of RNA polymerase, it directs bacterial or...; Region: Sigma70_r4; cd06171
31964001273	DNA binding residues [nucleotide binding]
31964001274	Predicted helix-turn-helix motif with score 1735.000, SD 5.10 at aa 149-170, sequence FSYEEIAEKLGATPSTVRGRLS
31964001275	HMMPfam hit to PF04542, Sigma-70 region 2, score 2.2e-18
31964001276	Asp23 family; Region: Asp23; pfam03780
31964001277	HMMPfam hit to PF03780, Protein of unknown function DUF322, score 7.5e-13
31964001278	3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism]; Region: MmsB; COG2084
31964001279	Phosphoribosyl transferase (PRT)-type I domain; Region: PRTases_typeI; cd06223
31964001280	active site
31964001281	HMMPfam hit to PF00156, Phosphoribosyltransferase,score 1.1e-22
31964001282	Septum formation; Region: Septum_form; pfam13845
31964001283	1 probable transmembrane helix predicted for CMS0234 by TMHMM2.0 at aa 528-547
31964001284	H+ Antiporter protein; Region: 2A0121; TIGR00900
31964001285	9 probable transmembrane helices predicted for CMS0235 by TMHMM2.0 at aa 21-43, 53-75, 87-109, 113-135,235-257, 267-289, 302-324, 369-388 and 395-417
31964001286	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964001287	H+ Antiporter protein; Region: 2A0121; TIGR00900
31964001288	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964001289	12 probable transmembrane helices predicted for CMS0236 by TMHMM2.0 at aa 21-43, 47-69, 81-103, 108-130,143-165, 169-191, 225-247, 252-274, 286-308, 312-331,343-365 and 369-391
31964001290	4 probable transmembrane helices predicted for CMS0237 by TMHMM2.0 at aa 35-52, 56-78, 85-107 and 127-149
31964001291	Protein of unknown function (DUF2599); Region: DUF2599; pfam10783
31964001292	1 probable transmembrane helix predicted for CMS0238 by TMHMM2.0 at aa 12-34
31964001293	Haloacid dehalogenase-like hydrolases. The haloacid dehalogenase-like (HAD) superfamily includes L-2-haloacid dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, and many others; Region: HAD_like; cd01427
31964001294	UMP phosphatase; Provisional; Region: PRK10444
31964001295	active site
31964001296	motif I; other site
31964001297	motif II; other site
31964001298	Haloacid dehalogenase-like hydrolases. The haloacid dehalogenase-like (HAD) superfamily includes L-2-haloacid dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, and many others; Region: HAD_like; cd01427
31964001299	HMMPfam hit to PF00702, Haloacid dehalogenase-like hydrolase, score 4.6e-09
31964001300	Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain; Region: MPP_GpdQ; cd07402
31964001301	Calcineurin-like phosphoesterase; Region: Metallophos; pfam00149
31964001302	active site
31964001303	metal binding site [ion binding]; metal-binding site
31964001304	hexamer interface [polypeptide binding]; other site
31964001305	HMMPfam hit to PF00149, Metallophosphoesterase,score 1.2e-15
31964001306	CsbD-like; Region: CsbD; pfam05532
31964001307	HMMPfam hit to PF05532, CsbD-like, score 3.5e-06
31964001308	Phospholipase_D-nuclease N-terminal; Region: PLDc_N; pfam13396
31964001309	2 probable transmembrane helices predicted for CMS0242 by TMHMM2.0 at aa 2-21 and 31-53
31964001310	Superfamily II DNA helicase [DNA replication, recombination, and repair]; Region: RecQ; COG0514
31964001311	DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region; Region: DEXDc; cd00046
31964001312	ATP binding site [chemical binding]; other site
31964001313	putative Mg++ binding site [ion binding]; other site
31964001314	Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may...; Region: HELICc; cd00079
31964001315	nucleotide binding region [chemical binding]; other site
31964001316	ATP-binding site [chemical binding]; other site
31964001317	HMMPfam hit to PF00270, DEAD/DEAH box helicase,N-terminal, score 3.5e-25
31964001318	PS00690 DEAH-box subfamily ATP-dependent helicases signature.
31964001319	HMMPfam hit to PF00271, Helicase, C-terminal, score 3.8e-20
31964001320	DNA modification methylase [DNA replication, recombination, and repair]; Region: COG0863
31964001321	DNA methylase; Region: N6_N4_Mtase; pfam01555
31964001322	HMMPfam hit to PF01555, DNA methylase N-4/N-6,score 3.2e-34
31964001323	PS00092 N-6 Adenine-specific DNA methylases signature.
31964001324	3 probable transmembrane helices predicted for CMS0245 by TMHMM2.0 at aa 158-177, 181-198 and 211-233
31964001325	3 probable transmembrane helices predicted for CMS0246 by TMHMM2.0 at aa 47-64, 66-85 and 95-117
31964001326	kynureninase; Region: kynureninase; TIGR01814
31964001327	Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes. PLP combines with an alpha-amino acid to form a compound called a Schiff base or aldimine intermediate, which depending on the reaction, is the...; Region: AAT_I; cl00321
31964001328	pyridoxal 5'-phosphate binding pocket [chemical binding]; other site
31964001329	catalytic residue [active]
31964001330	Oxidoreductase family, NAD-binding Rossmann fold; Region: GFO_IDH_MocA; pfam01408
31964001331	HMMPfam hit to PF01408, Oxidoreductase, N-terminal,score 4.3e-13
31964001332	Glycosyltransferase [Cell envelope biogenesis, outer membrane]; Region: RfaG; COG0438
31964001333	Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate...; Region: Glycosyltransferase_GTB_type; cl10013
31964001334	HMMPfam hit to PF00534, Glycosyl transferase, group 1, score 2.1e-11
31964001335	Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate...; Region: Glycosyltransferase_GTB_type; cl10013
31964001336	HMMPfam hit to PF00201,UDP-glucuronosyl/UDP-glucosyltransferase, score 1.4e-07
31964001337	PS00375 UDP-glycosyltransferases signature.
31964001338	2 probable transmembrane helices predicted for CMS0251 by TMHMM2.0 at aa 4-26 and 31-52
31964001339	Uncharacterized conserved protein [Function unknown]; Region: COG2308
31964001340	HMMPfam hit to PF04169, Protein of unknown function DUF404, score 2.5e-159
31964001341	HMMPfam hit to PF04174, Protein of unknown function DUF407, score 2.3e-80
31964001342	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG2307
31964001343	A predicted alpha-helical domain with a conserved ER motif; Region: Alpha-E; pfam04168
31964001344	HMMPfam hit to PF04168, Bacterial protein of unknown function DUF403, score 2.2e-91
31964001345	Transglutaminase-like enzymes, putative cysteine proteases [Amino acid transport and metabolism]; Region: COG1305
31964001346	Bacterial transglutaminase-like N-terminal region; Region: Bact_transglu_N; pfam08379
31964001347	Transglutaminase-like superfamily; Region: Transglut_core; pfam01841
31964001348	HMMPfam hit to PF01841, Transglutaminase-like,score 2.6e-13
31964001349	Acetyltransferase (GNAT) domain; Region: Acetyltransf_3; pfam13302
31964001350	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cd04301
31964001351	Coenzyme A binding pocket [chemical binding]; other site
31964001352	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 9e-18
31964001353	4 probable transmembrane helices predicted for CMS0257 by TMHMM2.0 at aa 25-47, 57-76, 198-220 and 224-246
31964001354	HMMPfam hit to PF00746, Surface protein from Gram-positive cocci, anchor region, score 0.0056
31964001355	1 probable transmembrane helix predicted for CMS0258 by TMHMM2.0 at aa 165-187
31964001356	PS00343 Gram-positive cocci surface proteins 'anchoring' hexapeptide.
31964001357	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964001358	Pro-kumamolisin, activation domain; Region: Pro-kuma_activ; smart00944
31964001359	Peptidase domain in the S53 family; Region: Peptidases_S53; cd04056
31964001360	active site
31964001361	catalytic triad [active]
31964001362	calcium binding site [ion binding]; other site
31964001363	HMMPfam hit to PF00082, Peptidase S8 and S53,subtilisin, kexin, sedolisin, score 3.5e-05
31964001364	1 probable transmembrane helix predicted for CMS0261 by TMHMM2.0 at aa 7-29
31964001365	Transcriptional regulator [Transcription]; Region: AcrR; COG1309
31964001366	Bacterial regulatory proteins, tetR family; Region: TetR_N; pfam00440
31964001367	HMMPfam hit to PF00440, Bacterial regulatory protein, TetR, score 2.4e-08
31964001368	Predicted helix-turn-helix motif with score 1308.000, SD 3.64 at aa 31-52, sequence TSFSRVAEAMGKPKSAIGYHLF
31964001369	phospholipase C, phosphocholine-specific, Pseudomonas-type; Region: PC_PLC; TIGR03396
31964001370	Phosphoesterase family; Region: Phosphoesterase; pfam04185
31964001371	Domain of unknown function (DUF756); Region: DUF756; pfam05506
31964001372	Domain of unknown function (DUF756); Region: DUF756; pfam05506
31964001373	HMMPfam hit to PF05506, Protein of unknown function DUF756, score 2.6e-13
31964001374	HMMPfam hit to PF04185, Phosphoesterase, score 4.4e-117
31964001375	Alkylated DNA repair protein [DNA replication, recombination, and repair]; Region: AlkB; COG3145
31964001376	6 probable transmembrane helices predicted for CMS0266 by TMHMM2.0 at aa 12-31, 51-73, 85-107, 122-140,145-167 and 199-221
31964001377	Homeodomain-like domain; Region: HTH_23; cl17451
31964001378	Winged helix-turn helix; Region: HTH_29; pfam13551
31964001379	Integrase core domain; Region: rve; pfam00665
31964001380	Integrase core domain; Region: rve_3; pfam13683
31964001381	HMMPfam hit to PF00665, Integrase, catalytic region, score 2e-41
31964001382	Predicted helix-turn-helix motif with score 1316.000, SD 3.67 at aa 25-46, sequence WPVRRAAERFQCSPATASRWAR
31964001383	Zn-dependent hydrolases, including glyoxylases [General function prediction only]; Region: GloB; COG0491
31964001384	HMMPfam hit to PF00753, Beta-lactamase-like, score 6.9e-18
31964001385	DNA-directed RNA polymerase subunit beta; Reviewed; Region: rpoB; PRK00405
31964001386	RNA polymerase beta subunit. RNA polymerases catalyse the DNA dependent polymerization of RNA. Prokaryotes contain a single RNA polymerase compared to three in eukaryotes (not including mitochondrial. and chloroplast polymerases). Each RNA polymerase...; Region: RNA_pol_B_RPB2; cl17585
31964001387	RNA polymerase beta subunit. RNA polymerases catalyse the DNA dependent polymerization of RNA. Prokaryotes contain a single RNA polymerase compared to three in eukaryotes (not including mitochondrial. and chloroplast polymerases). Each RNA polymerase...; Region: RNA_pol_B_RPB2; cd00653
31964001388	RNA polymerase beta subunit. RNA polymerases catalyse the DNA dependent polymerization of RNA. Prokaryotes contain a single RNA polymerase compared to three in eukaryotes (not including mitochondrial. and chloroplast polymerases). Each RNA polymerase...; Region: RNA_pol_B_RPB2; cd00653
31964001389	RPB10 interaction site [polypeptide binding]; other site
31964001390	RPB1 interaction site [polypeptide binding]; other site
31964001391	RPB11 interaction site [polypeptide binding]; other site
31964001392	RPB3 interaction site [polypeptide binding]; other site
31964001393	RPB12 interaction site [polypeptide binding]; other site
31964001394	HMMPfam hit to PF04563, RNA polymerase beta subunit, score 1.2e-10
31964001395	HMMPfam hit to PF04561, RNA polymerase Rpb2, domain 2, score 7.9e-26
31964001396	HMMPfam hit to PF04565, RNA polymerase Rpb2, domain 3, score 2.5e-42
31964001397	HMMPfam hit to PF00562, RNA polymerase Rpb2, domain 6, score 9.1e-218
31964001398	PS01166 RNA polymerases beta chain signature.
31964001399	HMMPfam hit to PF04560, RNA polymerase Rpb2, domain 7, score 6.7e-49
31964001400	RNA polymerase Rpb1, domain 1; Region: RNA_pol_Rpb1_1; pfam04997
31964001401	DNA-directed RNA polymerase subunit beta'; Provisional; Region: PRK00566
31964001402	RNA polymerase I subunit A N-terminus; Region: RPOLA_N; smart00663
31964001403	RNA polymerase Rpb1, domain 3; Region: RNA_pol_Rpb1_3; pfam04983
31964001404	RNA polymerase Rpb1, domain 4; Region: RNA_pol_Rpb1_4; pfam05000
31964001405	Largest subunit (beta') of Bacterial DNA-dependent RNA polymerase (RNAP), C-terminal domain; Region: RNAP_beta'_C; cd02655
31964001406	Rpb1 (beta') - Rpb6 (omega) interaction site [polypeptide binding]; other site
31964001407	Rpb1 (beta') - Rpb2 (beta) interaction site [polypeptide binding]; other site
31964001408	G-loop; other site
31964001409	DNA binding site [nucleotide binding]
31964001410	HMMPfam hit to PF04997, RNA polymerase Rpb1, domain 1, score 1.3e-119
31964001411	HMMPfam hit to PF00623, RNA polymerase, alpha subunit, score 8.9e-82
31964001412	HMMPfam hit to PF04983, RNA polymerase Rpb1, domain 3, score 1.8e-26
31964001413	HMMPfam hit to PF05000, RNA polymerase Rpb1, domain 4, score 5.1e-19
31964001414	HMMPfam hit to PF04998, RNA polymerase Rpb1, domain 5, score 5.5e-69
31964001415	Bacterial extracellular solute-binding proteins, family 3; Region: SBP_bac_3; pfam00497
31964001416	Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of  substrates, such as, amino acids, peptides, sugars, vitamins and inorganic...; Region: PBPb; cd00134
31964001417	substrate binding pocket [chemical binding]; other site
31964001418	membrane-bound complex binding site; other site
31964001419	hinge residues; other site
31964001420	HMMPfam hit to PF00497, Bacterial extracellular solute-binding protein, family 3, score 8e-90
31964001421	PS01039 Bacterial extracellular solute-binding proteins, family 3 signature.
31964001422	PS00217 Sugar transport proteins signature 2.
31964001423	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964001424	ABC-type arginine transport system, permease component [Amino acid transport and metabolism]; Region: ArtQ; COG4215
31964001425	dimer interface [polypeptide binding]; other site
31964001426	conserved gate region; other site
31964001427	putative PBP binding loops; other site
31964001428	ABC-ATPase subunit interface; other site
31964001429	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 3e-31
31964001430	3 probable transmembrane helices predicted for CMS0273 by TMHMM2.0 at aa 24-46, 67-89 and 188-207
31964001431	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964001432	nickel import ATP-binding protein NikD; Region: nickel_nikD; TIGR02770
31964001433	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
31964001434	Walker A/P-loop; other site
31964001435	ATP binding site [chemical binding]; other site
31964001436	Q-loop/lid; other site
31964001437	ABC transporter signature motif; other site
31964001438	Walker B; other site
31964001439	D-loop; other site
31964001440	H-loop/switch region; other site
31964001441	HMMPfam hit to PF00005, ABC transporter, score 8e-56
31964001442	PS00017 ATP/GTP-binding site motif A (P-loop).
31964001443	PS00211 ABC transporters family signature.
31964001444	3 probable transmembrane helices predicted for CMS0275 by TMHMM2.0 at aa 138-160, 175-197 and 204-223
31964001445	4 probable transmembrane helices predicted for CMS0276 by TMHMM2.0 at aa 5-22, 27-49, 62-84 and 104-126
31964001446	S12-like family, 30S ribosomal protein S12 subfamily; S12 is located at the interface of the large and small ribosomal subunits of prokaryotes, chloroplasts and mitochondria, where it plays an important role in both tRNA and ribosomal subunit...; Region: Ribosomal_S12; cd03368
31964001447	S17 interaction site [polypeptide binding]; other site
31964001448	S8 interaction site; other site
31964001449	16S rRNA interaction site [nucleotide binding]; other site
31964001450	streptomycin interaction site [chemical binding]; other site
31964001451	23S rRNA interaction site [nucleotide binding]; other site
31964001452	aminoacyl-tRNA interaction site (A-site) [nucleotide binding]; other site
31964001453	HMMPfam hit to PF00164, Ribosomal protein S12/S23,score 2e-74
31964001454	PS00055 Ribosomal protein S12 signature.
31964001455	30S ribosomal protein S7; Validated; Region: PRK05302
31964001456	HMMPfam hit to PF00177, Ribosomal protein S7, score 2.7e-79
31964001457	elongation factor G; Reviewed; Region: PRK00007
31964001458	Elongation factor G (EF-G) family involved in both the elongation and ribosome recycling phases of protein synthesis; Region: EF-G; cd01886
31964001459	G1 box; other site
31964001460	putative GEF interaction site [polypeptide binding]; other site
31964001461	GTP/Mg2+ binding site [chemical binding]; other site
31964001462	Switch I region; other site
31964001463	G2 box; other site
31964001464	G3 box; other site
31964001465	Switch II region; other site
31964001466	G4 box; other site
31964001467	G5 box; other site
31964001468	EFG_mtEFG_II: this subfamily represents the domain II of elongation factor G (EF-G) in bacteria and, the C-terminus of mitochondrial Elongation factor G1 (mtEFG1) and G2 (mtEFG2)_like proteins found in eukaryotes. During the process of peptide synthesis...; Region: EFG_mtEFG_II; cd04088
31964001469	EFG_mtEFG1_IV: domains similar to domain IV of the bacterial translational elongation factor (EF) EF-G. Included in this group is a domain of mitochondrial Elongation factor G1 (mtEFG1) proteins homologous to domain IV of EF-G. Eukaryotic cells harbor 2...; Region: EFG_mtEFG1_IV; cd01434
31964001470	EFG_mtEFG_C: domains similar to the C-terminal domain of the bacterial translational elongation factor (EF) EF-G.  Included in this group is the C-terminus of mitochondrial Elongation factor G1 (mtEFG1) and G2 (mtEFG2) proteins. Eukaryotic cells harbor 2...; Region: EFG_mtEFG_C; cd03713
31964001471	HMMPfam hit to PF00009, Protein synthesis factor,GTP-binding, score 6.7e-118
31964001472	PS00017 ATP/GTP-binding site motif A (P-loop).
31964001473	PS00301 GTP-binding elongation factors signature.
31964001474	HMMPfam hit to PF03144, Elongation factor Tu,domain 2, score 1.9e-17
31964001475	HMMPfam hit to PF03764, Elongation factor G, domain IV, score 2.9e-65
31964001476	HMMPfam hit to PF00679, Elongation factor G,C-terminal, score 2.7e-45
31964001477	elongation factor Tu; Reviewed; Region: PRK00049
31964001478	Elongation Factor Tu (EF-Tu) GTP-binding proteins; Region: EF_Tu; cd01884
31964001479	G1 box; other site
31964001480	GEF interaction site [polypeptide binding]; other site
31964001481	GTP/Mg2+ binding site [chemical binding]; other site
31964001482	Switch I region; other site
31964001483	G2 box; other site
31964001484	G3 box; other site
31964001485	Switch II region; other site
31964001486	G4 box; other site
31964001487	G5 box; other site
31964001488	EFTU_II: Elongation factor Tu domain II. Elongation factors Tu (EF-Tu) are three-domain GTPases with an essential function in the elongation phase of mRNA translation. The GTPase center of EF-Tu is in the N-terminal domain (domain I), also known as the...; Region: EFTU_II; cd03697
31964001489	Domain III of elongation factor (EF) Tu. Ef-Tu consists of three structural domains, designated I, II and III. Domain III adopts a beta barrel structure. Domain III is involved in binding to both charged tRNA and binding to elongation factor Ts (EF-Ts); Region: EFTU_III; cd03707
31964001490	Antibiotic Binding Site [chemical binding]; other site
31964001491	HMMPfam hit to PF00009, Protein synthesis factor,GTP-binding, score 1.9e-95
31964001492	PS00017 ATP/GTP-binding site motif A (P-loop).
31964001493	PS00301 GTP-binding elongation factors signature.
31964001494	HMMPfam hit to PF03144, Elongation factor Tu,domain 2, score 1.9e-24
31964001495	HMMPfam hit to PF03143, Elongation factor Tu,C-terminal, score 7.8e-53
31964001496	Topoisomerase IB [DNA replication, recombination, and repair]; Region: COG3569
31964001497	Eukaryotic DNA topoisomerase I, catalytic core; Region: Topoisom_I; pfam01028
31964001498	active site
31964001499	DNA binding site [nucleotide binding]
31964001500	Int/Topo IB signature motif; other site
31964001501	30S ribosomal protein S10; Reviewed; Region: rpsJ; PRK00596
31964001502	HMMPfam hit to PF00338, Ribosomal protein S10,score 3.9e-60
31964001503	PS00361 Ribosomal protein S10 signature.
31964001504	50S ribosomal protein L3; Validated; Region: rplC; PRK00001
31964001505	HMMPfam hit to PF00297, Ribosomal protein L3, score 4e-78
31964001506	PS00474 Ribosomal protein L3 signature.
31964001507	50S ribosomal protein L4; Provisional; Region: rplD; PRK05319
31964001508	HMMPfam hit to PF00573, Ribosomal protein L4/L1e,score 2.8e-65
31964001509	50S ribosomal protein L23; Reviewed; Region: rplW; PRK05738
31964001510	HMMPfam hit to PF00276, Ribosomal L23 protein,score 2.2e-30
31964001511	50S ribosomal protein L2; Validated; Region: rplB; PRK09374
31964001512	Ribosomal Proteins L2, RNA binding domain; Region: Ribosomal_L2; pfam00181
31964001513	Ribosomal Proteins L2, C-terminal domain; Region: Ribosomal_L2_C; pfam03947
31964001514	HMMPfam hit to PF00181, Ribosomal protein L2, score 1.3e-44
31964001515	HMMPfam hit to PF03947, Ribosomal protein L2, score 9.5e-84
31964001516	PS00467 Ribosomal protein L2 signature.
31964001517	30S ribosomal protein S19; Reviewed; Region: rpsS; PRK00357
31964001518	HMMPfam hit to PF00203, Ribosomal protein S19/S15,score 7.8e-50
31964001519	PS00323 Ribosomal protein S19 signature.
31964001520	Ribosomal protein L22/L17e.  L22 (L17 in eukaryotes) is a core protein of the large ribosomal subunit.  It is the only ribosomal protein that interacts with all six domains of 23S rRNA, and is one of the proteins important for directing the proper...; Region: Ribosomal_L22; cd00336
31964001521	protein-rRNA interface [nucleotide binding]; other site
31964001522	putative translocon binding site; other site
31964001523	HMMPfam hit to PF00237, Ribosomal protein L22/L17,score 9.1e-49
31964001524	PS00464 Ribosomal protein L22 signature.
31964001525	30S ribosomal protein S3; Reviewed; Region: rpsC; PRK00310
31964001526	K homology RNA-binding (KH) domain of the prokaryotic 30S small ribosomal subunit protein S3. S3  is part of the head region of the 30S ribosomal subunit and is believed to interact with mRNA as it threads its way from the latch into the channel.  The KH...; Region: 30S_S3_KH; cd02412
31964001527	G-X-X-G motif; other site
31964001528	Ribosomal protein S3, C-terminal domain; Region: Ribosomal_S3_C; pfam00189
31964001529	HMMPfam hit to PF00417, Ribosomal protein S3,N-terminal, score 7.5e-24
31964001530	HMMPfam hit to PF07650, KH, type 2, score 7.4e-22
31964001531	HMMPfam hit to PF00189, Ribosomal protein S3,C-terminal, score 1.4e-42
31964001532	PS00548 Ribosomal protein S3 signature.
31964001533	Ribosomal_L16_L10e: L16 is an essential protein in the large ribosomal subunit of bacteria, mitochondria, and chloroplasts. Large subunits that lack L16 are defective in peptidyl transferase activity, peptidyl-tRNA hydrolysis activity, association with...; Region: Ribosomal_L16_L10e; cd01433
31964001534	23S rRNA interface [nucleotide binding]; other site
31964001535	5S rRNA interface [nucleotide binding]; other site
31964001536	putative antibiotic binding site [chemical binding]; other site
31964001537	L25 interface [polypeptide binding]; other site
31964001538	L27 interface [polypeptide binding]; other site
31964001539	HMMPfam hit to PF00252, Ribosomal protein L16,score 3.2e-68
31964001540	PS00701 Ribosomal protein L16 signature 2.
31964001541	Ribosomal L29 protein/HIP.  L29 is a protein of the large ribosomal Subunit. A homolog, called heparin/heparan sulfate interacting protein (HIP), has also been identified in mammals.  L29 is located on the surface of the large ribosomal subunit, where it...; Region: Ribosomal_L29_HIP; cd00427
31964001542	L23 interface [polypeptide binding]; other site
31964001543	signal recognition particle (SRP54) interaction site; other site
31964001544	trigger factor interaction site; other site
31964001545	23S rRNA interface [nucleotide binding]; other site
31964001546	HMMPfam hit to PF00831, Ribosomal protein L29,score 9.4e-24
31964001547	30S ribosomal protein S17; Reviewed; Region: rpsQ; PRK05610
31964001548	HMMPfam hit to PF00366, Ribosomal protein S17,score 5.6e-35
31964001549	PS00056 Ribosomal protein S17 signature.
31964001550	50S ribosomal protein L14; Validated; Region: rplN; PRK05483
31964001551	HMMPfam hit to PF00238, Ribosomal protein L14b/L23e, score 3.2e-77
31964001552	PS00049 Ribosomal protein L14 signature.
31964001553	50S ribosomal protein L24; Reviewed; Region: rplX; PRK00004
31964001554	KOW motif of Ribosomal Protein L26; Region: KOW_RPL26; cd06089
31964001555	RNA binding site [nucleotide binding]; other site
31964001556	HMMPfam hit to PF00467, KOW, score 1.2e-05
31964001557	50S ribosomal protein L5; Validated; Region: rplE; PRK00010
31964001558	Ribosomal protein L5; Region: Ribosomal_L5; pfam00281
31964001559	ribosomal L5P family C-terminus; Region: Ribosomal_L5_C; pfam00673
31964001560	HMMPfam hit to PF00281, Ribosomal protein L5, score 3.9e-31
31964001561	HMMPfam hit to PF00673, Ribosomal protein L5, score 2.5e-56
31964001562	30S ribosomal protein S8; Validated; Region: rpsH; PRK00136
31964001563	HMMPfam hit to PF00410, Ribosomal protein S8, score 3.1e-59
31964001564	PS00053 Ribosomal protein S8 signature.
31964001565	50S ribosomal protein L6; Validated; Region: rplF; PRK05498
31964001566	Ribosomal protein L6; Region: Ribosomal_L6; pfam00347
31964001567	Ribosomal protein L6; Region: Ribosomal_L6; pfam00347
31964001568	HMMPfam hit to PF00347, Ribosomal protein L6, score 2.2e-22
31964001569	HMMPfam hit to PF00347, Ribosomal protein L6, score 4.2e-25
31964001570	PS00525 Ribosomal protein L6 signature 1.
31964001571	Ribosomal L18/L5e:  L18 (L5e) is a ribosomal protein found in the central protuberance (CP) of the large subunit. L18 binds 5S rRNA and induces a conformational change that stimulates the binding of L5 to 5S rRNA. Association of 5S rRNA with 23S rRNA...; Region: Ribosomal_L18_L5e; cd00432
31964001572	5S rRNA interface [nucleotide binding]; other site
31964001573	L27 interface [polypeptide binding]; other site
31964001574	23S rRNA interface [nucleotide binding]; other site
31964001575	L5 interface [polypeptide binding]; other site
31964001576	PS00017 ATP/GTP-binding site motif A (P-loop).
31964001577	HMMPfam hit to PF00861, Ribosomal protein L18P/L5E,score 2.3e-48
31964001578	30S ribosomal protein S5; Validated; Region: rpsE; PRK00550
31964001579	Ribosomal protein S5, N-terminal domain; Region: Ribosomal_S5; pfam00333
31964001580	Ribosomal protein S5, C-terminal domain; Region: Ribosomal_S5_C; pfam03719
31964001581	HMMPfam hit to PF00333, Ribosomal protein S5, score 9.4e-41
31964001582	PS00585 Ribosomal protein S5 signature.
31964001583	HMMPfam hit to PF03719, Ribosomal protein S5,C-terminal, score 1.1e-38
31964001584	Ribosomal protein L30, which is found in eukaryotes and prokaryotes but not in archaea, is one of the smallest ribosomal proteins with a molecular mass of about 7kDa. L30 binds the 23SrRNA as well as the 5S rRNA and is one of five ribosomal proteins that...; Region: Ribosomal_L30; cd01658
31964001585	23S rRNA binding site [nucleotide binding]; other site
31964001586	HMMPfam hit to PF00327, Ribosomal protein L30,score 9.1e-15
31964001587	50S ribosomal protein L15; Reviewed; Region: rplO; PRK05592
31964001588	HMMPfam hit to PF01305, Ribosomal protein L15,score 5.2e-46
31964001589	PS00017 ATP/GTP-binding site motif A (P-loop).
31964001590	HMMPfam hit to PF00256, Ribosomal protein L15,score 3.1e-10
31964001591	PS00475 Ribosomal protein L15 signature.
31964001592	preprotein translocase subunit SecY; Reviewed; Region: secY; PRK09204
31964001593	SecY translocase; Region: SecY; pfam00344
31964001594	10 probable transmembrane helices predicted for CMS0302 by TMHMM2.0 at aa 20-39, 74-96, 116-138, 158-180,187-209, 219-237, 258-280, 320-342, 379-401 and 405-423
31964001595	HMMPfam hit to PF00344, SecY protein, score 1.6e-182
31964001596	PS00755 Protein secY signature 1.
31964001597	PS00756 Protein secY signature 2.
31964001598	adenylate kinase; Reviewed; Region: adk; PRK00279
31964001599	Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP). This enzyme is required for the biosynthesis of ADP and is essential for...; Region: ADK; cd01428
31964001600	AMP-binding site [chemical binding]; other site
31964001601	ATP-AMP (Ap5A)-binding site [chemical binding]; other site
31964001602	HMMPfam hit to PF00406, Adenylate kinase, score 7.4e-65
31964001603	PS00113 Adenylate kinase signature.
31964001604	Methionine Aminopeptidase 1. E.C. 3.4.11.18. Also known as methionyl aminopeptidase and Peptidase M. Catalyzes release of N-terminal amino acids, preferentially methionine, from peptides and arylamides; Region: MetAP1; cd01086
31964001605	active site
31964001606	HMMPfam hit to PF00557, Peptidase M24, score 2.8e-46
31964001607	PS00680 Methionine aminopeptidase subfamily 1 signature.
31964001608	HTH domain; Region: HTH_11; pfam08279
31964001609	PRD domain; Region: PRD; pfam00874
31964001610	PTS_IIB: subunit IIB of enzyme II (EII) is the central energy-coupling domain of the phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS). In the multienzyme PTS complex, EII is a carbohydrate-specific permease consisting of two cytoplasmic...; Region: PTS_IIB; cl10014
31964001611	active site
31964001612	P-loop; other site
31964001613	phosphorylation site [posttranslational modification]
31964001614	PTS_IIA, PTS system, fructose/mannitol specific IIA subunit. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. This...; Region: PTS_IIA_fru; cd00211
31964001615	active site
31964001616	phosphorylation site [posttranslational modification]
31964001617	HMMPfam hit to PF00359,Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2, score 1.1e-05
31964001618	HMMPfam hit to PF00874, Transcriptional antiterminator bglG, score 1.8e-11
31964001619	Predicted helix-turn-helix motif with score 1547.000, SD 4.46 at aa 99-120, sequence LDVFALADELHVSESTVEADLR
31964001620	Predicted helix-turn-helix motif with score 1547.000, SD 4.46 at aa 99-41, sequence TAVRERSTVAIASSPDGYRIDAGSYARHLGTRSGADQQGTPRDRLHALVRRLGDAPD GL
31964001621	Predicted helix-turn-helix motif with score 1547.000, SD 4.46 at aa 20-41, sequence VEAGELADRLGVTTRSVRNYVT
31964001622	PTS_IIB: subunit IIB of enzyme II (EII) is the central energy-coupling domain of the phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS). In the multienzyme PTS complex, EII is a carbohydrate-specific permease consisting of two cytoplasmic...; Region: PTS_IIB; cl10014
31964001623	active site
31964001624	P-loop; other site
31964001625	phosphorylation site [posttranslational modification]
31964001626	HMMPfam hit to PF02302, Phosphotransferase system,lactose/cellobiose-specific IIB subunit, score 6.9e-09
31964001627	Histidine-containing phosphocarrier protein (HPr)-like proteins. HPr is a central component of the bacterial phosphoenolpyruvate sugar phosphotransferase system (PTS). The PTS catalyses the phosphorylation of sugar substrates during their translocation...; Region: PTS-HPr_like; cd00367
31964001628	dimerization domain swap beta strand [polypeptide binding]; other site
31964001629	regulatory protein interface [polypeptide binding]; other site
31964001630	active site
31964001631	regulatory phosphorylation site [posttranslational modification]; other site
31964001632	HMMPfam hit to PF00381, Phosphocarrier HPr protein,score 3e-19
31964001633	PS00369 PTS HPR component histidine phosphorylation site signature.
31964001634	Phosphoenolpyruvate-protein kinase (PTS system EI component in bacteria) [Carbohydrate transport and metabolism]; Region: PtsA; COG1080
31964001635	PEP-utilising enzyme, N-terminal; Region: PEP-utilisers_N; pfam05524
31964001636	PEP-utilising enzyme, mobile domain; Region: PEP-utilizers; pfam00391
31964001637	PEP-utilising enzyme, TIM barrel domain; Region: PEP-utilizers_C; pfam02896
31964001638	HMMPfam hit to PF05524, PEP-utilising enzyme,N-terminal, score 9.5e-08
31964001639	HMMPfam hit to PF00391, PEP-utilising enzyme,mobile region, score 1.9e-22
31964001640	PS00370 PEP-utilizing enzymes phosphorylation site signature.
31964001641	HMMPfam hit to PF02896, PEP-utilizing enzyme, score 8.5e-87
31964001642	Phosphotransferase system, mannitol-specific IIBC component [Carbohydrate transport and metabolism]; Region: MtlA; COG2213
31964001643	PTS system, mannitol-specific IIC component; Region: mtlA; TIGR00851
31964001644	PTS_IIB_mannitol: subunit IIB of enzyme II (EII) of the mannitol-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS). In this system, EII is a mannitol-specific permease with two cytoplasmic domains (IIA and IIB) and a transmembrane...; Region: PTS_IIB_mannitol; cd05567
31964001645	active site
31964001646	P-loop; other site
31964001647	phosphorylation site [posttranslational modification]
31964001648	9 probable transmembrane helices predicted for CMS0309 by TMHMM2.0 at aa 25-47, 57-79, 86-103, 113-131,152-174, 230-252, 259-281, 286-308 and 329-351
31964001649	HMMPfam hit to PF02378, Phosphotransferase system,EIIC, score 4.7e-06
31964001650	HMMPfam hit to PF02302, Phosphotransferase system,lactose/cellobiose-specific IIB subunit, score 5.8e-14
31964001651	PTS_IIA, PTS system, fructose/mannitol specific IIA subunit. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. This...; Region: PTS_IIA_fru; cd00211
31964001652	active site
31964001653	phosphorylation site [posttranslational modification]
31964001654	HMMPfam hit to PF00359,Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2, score 1.6e-41
31964001655	PS00372 PTS EIIA domains phosphorylation site signature 2.
31964001656	mannitol-1-phosphate 5-dehydrogenase; Provisional; Region: PRK02318
31964001657	Mannitol dehydrogenase Rossmann domain; Region: Mannitol_dh; pfam01232
31964001658	Mannitol dehydrogenase C-terminal domain; Region: Mannitol_dh_C; pfam08125
31964001659	HMMPfam hit to PF01232, Mannitol dehydrogenase,score 1.3e-102
31964001660	S1_IF1: Translation Initiation Factor IF1, S1-like RNA-binding domain. IF1 contains an S1-like RNA-binding domain, which is found in a wide variety of RNA-associated proteins. Translation initiation includes a number of interrelated steps preceding the...; Region: S1_IF1; cd04451
31964001661	rRNA binding site [nucleotide binding]; other site
31964001662	predicted 30S ribosome binding site; other site
31964001663	HMMPfam hit to PF00575, RNA binding S1, score 1e-10
31964001664	50S ribosomal protein L36; Reviewed; Region: rpmJ; PRK00465
31964001665	HMMPfam hit to PF00444, Ribosomal protein L36,score 1e-16
31964001666	PS00828 Ribosomal protein L36 signature.
31964001667	30S ribosomal protein S13; Validated; Region: rpsM; PRK05179
31964001668	30S ribosomal protein S13; Region: bact_S13; TIGR03631
31964001669	HMMPfam hit to PF00416, Ribosomal protein S13,score 3.1e-53
31964001670	30S ribosomal protein S11; Validated; Region: PRK05309
31964001671	HMMPfam hit to PF00411, Ribosomal protein S11,score 1.4e-65
31964001672	PS00054 Ribosomal protein S11 signature.
31964001673	DNA-directed RNA polymerase subunit alpha; Provisional; Region: PRK05182
31964001674	N-terminal domain of the Alpha subunit of Bacterial RNA polymerase; Region: RNAP_alpha_NTD; cd06928
31964001675	alphaNTD homodimer interface [polypeptide binding]; other site
31964001676	alphaNTD - beta interaction site [polypeptide binding]; other site
31964001677	alphaNTD - beta' interaction site [polypeptide binding]; other site
31964001678	Bacterial RNA polymerase, alpha chain C terminal domain; Region: RNA_pol_A_CTD; pfam03118
31964001679	HMMPfam hit to PF01193, RNA polymerase,dimerisation, score 6.9e-17
31964001680	HMMPfam hit to PF01000, RNA polymerase, insert,score 2.3e-53
31964001681	HMMPfam hit to PF03118, RNA polymerase, alpha subunit, C-terminal, score 3.5e-29
31964001682	50S ribosomal protein L17; Validated; Region: rplQ; PRK05591
31964001683	HMMPfam hit to PF01196, Ribosomal protein L17,score 4.6e-45
31964001684	PS01167 Ribosomal protein L17 signature.
31964001685	mycothiol synthase; Region: mycothiol_MshD; TIGR03448
31964001686	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 1.6e-14
31964001687	tRNA pseudouridine synthase A; Validated; Region: truA; PRK00021
31964001688	Eukaryotic and bacterial pseudouridine synthases similar to E.  coli TruA; Region: PseudoU_synth_EcTruA; cd02570
31964001689	dimerization interface 3.5A [polypeptide binding]; other site
31964001690	active site
31964001691	HMMPfam hit to PF01416, tRNA pseudouridine synthase, score 7.5e-24
31964001692	HMMPfam hit to PF01416, tRNA pseudouridine synthase, score 1.1e-20
31964001693	Ribosomal protein L13.  Protein L13, a large ribosomal subunit protein, is one of five proteins required for an early folding intermediate of 23S rRNA in the assembly of the large subunit. L13 is situated on the bottom of the large subunit, near the...; Region: Ribosomal_L13; cd00392
31964001694	23S rRNA interface [nucleotide binding]; other site
31964001695	L3 interface [polypeptide binding]; other site
31964001696	HMMPfam hit to PF00572, Ribosomal protein L13,score 1.7e-72
31964001697	PS00783 Ribosomal protein L13 signature.
31964001698	30S ribosomal protein S9; Reviewed; Region: rpsI; PRK00132
31964001699	HMMPfam hit to PF00380, Ribosomal protein S9, score 2.2e-54
31964001700	PS00360 Ribosomal protein S9 signature.
31964001701	phosphoglucosamine mutase; Provisional; Region: glmM; PRK14318
31964001702	GlmM is a bacterial phosphoglucosamine mutase (PNGM) that belongs to the alpha-D-phosphohexomutase superfamily. It is required for the interconversion of glucosamine-6-phosphate and glucosamine-1-phosphate in the biosynthetic pathway of...; Region: GlmM; cd05802
31964001703	active site
31964001704	substrate binding site [chemical binding]; other site
31964001705	metal binding site [ion binding]; metal-binding site
31964001706	HMMPfam hit to PF02878,Phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I, score 2.3e-55
31964001707	PS00710 Phosphoglucomutase and phosphomannomutase phosphoserine signature.
31964001708	HMMPfam hit to PF02879,Phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain II, score 1.6e-23
31964001709	HMMPfam hit to PF02880,Phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain III, score 2.4e-23
31964001710	HMMPfam hit to PF00408,Phosphoglucomutase/phosphomannomutase C terminal, score 4e-06
31964001711	Homeodomain-like domain; Region: HTH_23; cl17451
31964001712	Winged helix-turn helix; Region: HTH_29; pfam13551
31964001713	Integrase core domain; Region: rve; pfam00665
31964001714	Integrase core domain; Region: rve_3; pfam13683
31964001715	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.6e-42
31964001716	Predicted helix-turn-helix motif with score 1388.000, SD 3.91 at aa 25-46, sequence WSVRRAAERFQCSPATASRWAR
31964001717	Homeodomain-like domain; Region: HTH_23; cl17451
31964001718	Winged helix-turn helix; Region: HTH_29; pfam13551
31964001719	Integrase core domain; Region: rve; pfam00665
31964001720	Integrase core domain; Region: rve_3; pfam13683
31964001721	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964001722	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964001723	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964001724	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.6e-38
31964001725	Domain of unknown function (DUF1905); Region: DUF1905; pfam08922
31964001726	Bacteriocin-protection, YdeI or OmpD-Associated; Region: OmdA; pfam13376
31964001727	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
31964001728	non-specific DNA binding site [nucleotide binding]; other site
31964001729	salt bridge; other site
31964001730	sequence-specific DNA binding site [nucleotide binding]; other site
31964001731	HMMPfam hit to PF01381, Helix-turn-helix motif,score 4.8e-06
31964001732	Predicted helix-turn-helix motif with score 1623.000, SD 4.71 at aa 24-45, sequence MTLTRLSAIVGVSQVNLSVLKN
31964001733	4 probable transmembrane helices predicted for CMS0327 by TMHMM2.0 at aa 7-29, 81-103, 116-138 and 162-184
31964001734	Sensors of blue-light using FAD; Region: BLUF; pfam04940
31964001735	HMMPfam hit to PF04940, BLUF, score 5.4e-15
31964001736	2'-5' RNA ligase superfamily; Region: 2_5_RNA_ligase2; pfam13563
31964001737	HMMPfam hit to PF00532, Periplasmic binding protein/LacI transcriptional regulator, score 0.00093
31964001738	HMMPfam hit to PF00356, Bacterial regulatory protein, LacI, score 7.8e-08
31964001739	Glyco_18 domain; Region: Glyco_18; smart00636
31964001740	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods.  Chitinases have...; Region: GH18_chitinase-like; cl10447
31964001741	active site
31964001742	1 probable transmembrane helix predicted for CMS0332 by TMHMM2.0 at aa 7-29
31964001743	HMMPfam hit to PF00704, Glycoside hydrolase, family 18, score 5.4e-09
31964001744	Superfamily of metallo-dependent hydrolases (also called amidohydrolase superfamily) is a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site. The vast majority of the members have a...; Region: metallo-dependent_hydrolases; cl00281
31964001745	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely...; Region: SGNH_hydrolase; cl01053
31964001746	active site
31964001747	catalytic triad [active]
31964001748	oxyanion hole [active]
31964001749	PS00152 ATP synthase alpha and beta subunits signature.
31964001750	PS00133 Zinc carboxypeptidases, zinc-binding region 2 signature.
31964001751	ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]; Region: FepC; COG1120
31964001752	ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins; Region: ABC_Iron-Siderophores_B12_Hemin; cd03214
31964001753	Walker A/P-loop; other site
31964001754	ATP binding site [chemical binding]; other site
31964001755	Q-loop/lid; other site
31964001756	ABC transporter signature motif; other site
31964001757	Walker B; other site
31964001758	D-loop; other site
31964001759	H-loop/switch region; other site
31964001760	HMMPfam hit to PF00005, ABC transporter, score 1.1e-41
31964001761	PS00017 ATP/GTP-binding site motif A (P-loop).
31964001762	PS00211 ABC transporters family signature.
31964001763	Fe3+-siderophore binding domain FhuD.  These proteins have been shown to function as initial receptors in ABC transport of Fe3+-siderophores in many eubacterial species. They belong to the TroA-like superfamily of helical backbone metal receptor proteins...; Region: FhuD; cd01146
31964001764	Periplasmic binding protein; Region: Peripla_BP_2; pfam01497
31964001765	siderophore binding site; other site
31964001766	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964001767	HMMPfam hit to PF01497, Periplasmic binding protein, score 9.8e-24
31964001768	Transmembrane subunit (TM), of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters involved in the uptake of siderophores, heme, vitamin B12, or the divalent cations Mg2+ and Zn2+. PBP-dependent ABC transporters consist of...; Region: TM_ABC_iron-siderophores_like; cl00462
31964001769	iron-hydroxamate transporter permease subunit; Provisional; Region: PRK10577
31964001770	Transmembrane subunit (TM), of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters involved in the uptake of siderophores, heme, vitamin B12, or the divalent cations Mg2+ and Zn2+. PBP-dependent ABC transporters consist of...; Region: TM_ABC_iron-siderophores_like; cl00462
31964001771	Transmembrane subunit (TM), of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters involved in the uptake of siderophores, heme, vitamin B12, or the divalent cations Mg2+ and Zn2+. PBP-dependent ABC transporters consist of...; Region: TM_ABC_iron-siderophores_like; cd06550
31964001772	dimer interface [polypeptide binding]; other site
31964001773	putative PBP binding regions; other site
31964001774	ABC-ATPase subunit  interface; other site
31964001775	17 probable transmembrane helices predicted for CMS0337 by TMHMM2.0 at aa 42-64, 103-122, 137-159,161-183, 187-209, 230-249, 275-297, 318-340, 350-372,393-415, 447-464, 476-498, 503-525, 532-554, 625-647,660-682 and 686-708
31964001776	HMMPfam hit to PF01032, Bacterial transport system permease protein, score 2.2e-61
31964001777	HMMPfam hit to PF01032, Bacterial transport system permease protein, score 1.1e-79
31964001778	Signal transduction histidine kinase [Signal transduction mechanisms]; Region: COG4585
31964001779	Histidine kinase; Region: HisKA_3; pfam07730
31964001780	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
31964001781	ATP binding site [chemical binding]; other site
31964001782	Mg2+ binding site [ion binding]; other site
31964001783	G-X-G motif; other site
31964001784	5 probable transmembrane helices predicted for CMS0338 by TMHMM2.0 at aa 62-84, 89-111, 147-169, 174-196 and 216-238
31964001785	HMMPfam hit to PF07730, Histidine kinase, score 2e-13
31964001786	HMMPfam hit to PF02518, ATP-binding region,ATPase-like, score 8.7e-07
31964001787	DNA-binding transcriptional activator UhpA; Provisional; Region: PRK10360
31964001788	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cl17736
31964001789	active site
31964001790	phosphorylation site [posttranslational modification]
31964001791	intermolecular recognition site; other site
31964001792	dimerization interface [polypeptide binding]; other site
31964001793	C-terminal DNA-binding domain of LuxR-like proteins. This domain contains a helix-turn-helix motif and binds DNA. Proteins belonging to this group are response regulators; some act as transcriptional activators, others as transcriptional repressors. Many...; Region: LuxR_C_like; cd06170
31964001794	DNA binding residues [nucleotide binding]
31964001795	dimerization interface [polypeptide binding]; other site
31964001796	HMMPfam hit to PF00072, Response regulator receiver, score 1.3e-11
31964001797	HMMPfam hit to PF00196, Bacterial regulatory protein, LuxR, score 1.2e-12
31964001798	Protein of unknown function (DUF3592); Region: DUF3592; pfam12158
31964001799	3 probable transmembrane helices predicted for CMS0340 by TMHMM2.0 at aa 34-56, 158-180 and 374-396
31964001800	4 probable transmembrane helices predicted for CMS0341 by TMHMM2.0 at aa 44-66, 73-95, 117-139 and 160-182
31964001801	4-Oxalocrotonate Tautomerase:  Catalyzes the isomerization of unsaturated ketones. The structure is a homohexamer that is arranged as a trimer of dimers. The hexamer contains six active sites, each formed by residues from three monomers, two from one...; Region: 4Oxalocrotonate_Tautomerase; cl00235
31964001802	HMMPfam hit to PF01361, 4-oxalocrotonate tautomerase, score 2.8e-07
31964001803	HMMPfam hit to PF01361, 4-oxalocrotonate tautomerase, score 0.056
31964001804	ribosomal-protein-alanine acetyltransferase; Region: rimI; TIGR01575
31964001805	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cd04301
31964001806	Coenzyme A binding pocket [chemical binding]; other site
31964001807	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 4.2e-13
31964001808	Phosphotransferase enzyme family; Region: APH; pfam01636
31964001809	Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family. The APH/ChoK family is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs)...; Region: APH_ChoK_like; cl17270
31964001810	mRNA degradation ribonucleases J1/J2 (metallo-beta-lactamase superfamily) [Translation, ribosomal structure and biogenesis; Replication, recombination and repair]; Region: COG0595
31964001811	Metallo-beta-lactamase superfamily; Region: Lactamase_B; smart00849
31964001812	RNA-metabolising metallo-beta-lactamase; Region: RMMBL; pfam07521
31964001813	HMMPfam hit to PF07521, RNA-metabolising metallo-beta-lactamase, score 7.8e-14
31964001814	HMMPfam hit to PF00753, Beta-lactamase-like, score 4.1e-26
31964001815	Sulfate permease and related transporters (MFS superfamily) [Inorganic ion transport and metabolism]; Region: SUL1; COG0659
31964001816	Sulfate transporter N-terminal domain with GLY motif; Region: Sulfate_tra_GLY; pfam13792
31964001817	Sulfate transporter family; Region: Sulfate_transp; pfam00916
31964001818	Sulphate Transporter and Anti-Sigma factor antagonist domain of SulP-like sulfate transporters, plays a role in the function and regulation of the transport activity, proposed general NTP binding function; Region: STAS_SulP_like_sulfate_transporter; cd07042
31964001819	11 probable transmembrane helices predicted for CMS0346 by TMHMM2.0 at aa 36-58, 65-87, 107-126, 133-155,159-178, 185-207, 237-259, 279-301, 311-328, 335-357 and 372-394
31964001820	HMMPfam hit to PF00916, Sulphate transporter, score 7.8e-105
31964001821	HMMPfam hit to PF01740, Sulfate transporter/antisigma-factor antagonist STAS, score 0.022
31964001822	VbhA antitoxin and related proteins; Region: VbhA_like; cd11586
31964001823	FIC domain binding interface [polypeptide binding]; other site
31964001824	NAD-dependent aldehyde dehydrogenases [Energy production and conversion]; Region: PutA; COG1012
31964001825	Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like; Region: ALDH_SSADH1_GabD1; cd07100
31964001826	NAD(P) binding site [chemical binding]; other site
31964001827	catalytic residues [active]
31964001828	HMMPfam hit to PF00171, Aldehyde dehydrogenase,score 1.8e-107
31964001829	PS00070 Aldehyde dehydrogenases cysteine active site.
31964001830	This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the...; Region: GT1_Gtf_like; cd03784
31964001831	active site
31964001832	TDP-binding site; other site
31964001833	1 probable transmembrane helix predicted for CMS0350 by TMHMM2.0 at aa 47-69
31964001834	Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism]; Region: MalY; COG1168
31964001835	Aspartate aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). Pyridoxal phosphate combines with an alpha-amino acid to form a compound called a Schiff base or aldimine...; Region: AAT_like; cd00609
31964001836	pyridoxal 5'-phosphate binding site [chemical binding]; other site
31964001837	homodimer interface [polypeptide binding]; other site
31964001838	catalytic residue [active]
31964001839	HMMPfam hit to PF00155, Aminotransferase, class I and II, score 4.6e-07
31964001840	CIMS - Cobalamine-independent methonine synthase, or MetE, C-terminal domain_like. Many members have been characterized as 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferases, EC:2.1.1.14, mostly from bacteria and plants. This enzyme...; Region: CIMS_C_terminal_like; cd03311
31964001841	substrate binding site [chemical binding]; other site
31964001842	THF binding site; other site
31964001843	zinc-binding site [ion binding]; other site
31964001844	HMMPfam hit to PF01717, Methionine synthase,vitamin-B12 independent, score 0.0034
31964001845	O-acetylhomoserine sulfhydrylase [Amino acid transport and metabolism]; Region: MET17; COG2873
31964001846	CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis. This pathway is unique to microorganisms and plants, rendering the enzyme an attractive target for the development of...; Region: CGS_like; cd00614
31964001847	homodimer interface [polypeptide binding]; other site
31964001848	substrate-cofactor binding pocket; other site
31964001849	pyridoxal 5'-phosphate binding site [chemical binding]; other site
31964001850	catalytic residue [active]
31964001851	HMMPfam hit to PF01053, Cys/Met metabolism pyridoxal-phosphate-dependent enzymes, score 1.1e-148
31964001852	Fic family protein [Function unknown]; Region: COG3177
31964001853	Fic/DOC family; Region: Fic; pfam02661
31964001854	HMMPfam hit to PF02661, Filamentation induced by cAMP protein Fic, score 1.4e-21
31964001855	mycofactocin system transcriptional regulator; Region: mycofact_TetR; TIGR03968
31964001856	Bacterial regulatory proteins, tetR family; Region: TetR_N; pfam00440
31964001857	HMMPfam hit to PF00440, Bacterial regulatory protein, TetR, score 2.3e-13
31964001858	Predicted helix-turn-helix motif with score 1770.000, SD 5.22 at aa 94-115, sequence TTIHDIAQAAGVSDRTCFRYFP
31964001859	drug resistance transporter, EmrB/QacA subfamily; Region: efflux_EmrB; TIGR00711
31964001860	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
31964001861	putative substrate translocation pore; other site
31964001862	14 probable transmembrane helices predicted for CMS0356 by TMHMM2.0 at aa 40-62, 77-99, 106-125, 135-157,164-186, 190-212, 225-247, 257-276, 297-319, 334-356,363-383, 393-415, 436-458 and 468-490
31964001863	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964001864	Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only]; Region: MhpC; COG0596
31964001865	Putative lysophospholipase; Region: Hydrolase_4; pfam12146
31964001866	HMMPfam hit to PF00561, Alpha/beta hydrolase fold,score 4.2e-11
31964001867	Transcriptional regulator [Transcription]; Region: AcrR; COG1309
31964001868	WHG domain; Region: WHG; pfam13305
31964001869	HMMPfam hit to PF00440, Bacterial regulatory protein, TetR, score 2e-05
31964001870	Predicted helix-turn-helix motif with score 1436.000, SD 4.08 at aa 27-48, sequence LSMGAVAERLGVKTPSLYKHVA
31964001871	Transcriptional regulator [Transcription]; Region: AcrR; COG1309
31964001872	Bacterial regulatory proteins, tetR family; Region: TetR_N; pfam00440
31964001873	HMMPfam hit to PF00440, Bacterial regulatory protein, TetR, score 4.5e-14
31964001874	Predicted helix-turn-helix motif with score 2056.000, SD 6.19 at aa 23-44, sequence ATIKEIADEVGVSPAAVLRYFR
31964001875	Oxidoreductase family, NAD-binding Rossmann fold; Region: GFO_IDH_MocA; pfam01408
31964001876	Predicted dehydrogenases and related proteins [General function prediction only]; Region: MviM; COG0673
31964001877	HMMPfam hit to PF01408, Oxidoreductase, N-terminal,score 2.8e-28
31964001878	ABC-type sugar transport system, periplasmic component [Carbohydrate transport and metabolism]; Region: UgpB; COG1653
31964001879	HMMPfam hit to PF01547, Bacterial extracellular solute-binding protein, family 1, score 3e-18
31964001880	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964001881	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964001882	dimer interface [polypeptide binding]; other site
31964001883	ABC-ATPase subunit interface; other site
31964001884	putative PBP binding loops; other site
31964001885	6 probable transmembrane helices predicted for CMS0364 by TMHMM2.0 at aa 45-67, 109-131, 143-165,185-207, 251-273 and 297-319
31964001886	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 2.3e-08
31964001887	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964001888	ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism]; Region: UgpE; COG0395
31964001889	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964001890	dimer interface [polypeptide binding]; other site
31964001891	conserved gate region; other site
31964001892	putative PBP binding loops; other site
31964001893	ABC-ATPase subunit interface; other site
31964001894	7 probable transmembrane helices predicted for CMS0365 by TMHMM2.0 at aa 33-55, 84-106, 121-143, 150-172,187-204, 211-233 and 256-278
31964001895	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 1.1e-12
31964001896	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964001897	Glycosyl hydrolases family 2, sugar binding domain; Region: Glyco_hydro_2_N; pfam02837
31964001898	Glycosyl hydrolases family 2; Region: Glyco_hydro_2; pfam00703
31964001899	Glycosyl hydrolases family 2, TIM barrel domain; Region: Glyco_hydro_2_C; pfam02836
31964001900	HMMPfam hit to PF02836, Glycoside hydrolase, family 2, TIM barrel domain, score 0.00044
31964001901	HMMPfam hit to PF00703, Glycoside hydrolase family 2, immunoglobulin-like beta-sandwich domain, score 9.1e-05
31964001902	HMMPfam hit to PF02837, Glycoside hydrolase, family 2, sugar binding, score 1.5e-38
31964001903	HMMPfam hit to PF02894, Oxidoreductase, C-terminal,score 1.1e-10
31964001904	HMMPfam hit to PF01408, Oxidoreductase, N-terminal,score 5.7e-08
31964001905	Predicted drug exporters of the RND superfamily [General function prediction only]; Region: COG2409
31964001906	12 probable transmembrane helices predicted for CMS0370 by TMHMM2.0 at aa 17-39, 286-308, 313-335,339-361, 382-404, 419-441, 478-497, 632-654, 666-688,703-725, 746-768 and 773-795
31964001907	Transcriptional regulator [Transcription]; Region: AcrR; COG1309
31964001908	Bacterial regulatory proteins, tetR family; Region: TetR_N; pfam00440
31964001909	HMMPfam hit to PF00440, Bacterial regulatory protein, TetR, score 1.3e-13
31964001910	Predicted helix-turn-helix motif with score 2071.000, SD 6.24 at aa 36-57, sequence LTIEGVAKEAGVGKQTIYRWWP
31964001911	Lipase.  Lipases are esterases that can hydrolyze long-chain acyl-triglycerides into di- and monoglycerides, glycerol, and free fatty acids at a water/lipid interface. A typical feature of lipases is "interfacial activation", the process of...; Region: Lipase; cl14883
31964001912	nucleophilic elbow; other site
31964001913	catalytic triad; other site
31964001914	2 probable transmembrane helices predicted for CMS0372 by TMHMM2.0 at aa 447-469 and 476-498
31964001915	ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism]; Region: UgpE; COG0395
31964001916	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964001917	ABC-ATPase subunit interface; other site
31964001918	putative PBP binding loops; other site
31964001919	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 1.6e-09
31964001920	6 probable transmembrane helices predicted for CMS0373 by TMHMM2.0 at aa 45-67, 101-123, 136-158,168-190, 211-233 and 272-290
31964001921	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964001922	dimer interface [polypeptide binding]; other site
31964001923	conserved gate region; other site
31964001924	putative PBP binding loops; other site
31964001925	ABC-ATPase subunit interface; other site
31964001926	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 1e-07
31964001927	8 probable transmembrane helices predicted for CMS0374 by TMHMM2.0 at aa 27-49, 87-109, 121-141, 151-173,180-202, 217-239, 246-268 and 278-300
31964001928	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964001929	HMMPfam hit to PF01547, Bacterial extracellular solute-binding protein, family 1, score 1.2e-37
31964001930	FMN-dependent oxidoreductase, nitrilotriacetate monooxygenase family; Region: FMN_nitrolo; TIGR03860
31964001931	nitrilotriacetate monoxygenase oxidizes nitrilotriacetate utilizing reduced flavin mononucleotide (FMNH2) and oxygen. The FMNH2 is provided by an NADH:flavin mononucleotide (FMN) oxidorductase that uses NADH to reduce FMN to FMNH2; Region: Nitrilotriacetate_monoxgenase; cd01095
31964001932	active site
31964001933	non-prolyl cis peptide bond; other site
31964001934	sulfur acquisition oxidoreductase, SfnB family; Region: sulfur_SfnB; TIGR04022
31964001935	Acyl-CoA dehydrogenase; Region: ACAD; cl09933
31964001936	active site
31964001937	HMMPfam hit to PF00441, Acyl-CoA dehydrogenase,C-terminal, score 0.0001
31964001938	Acyl-CoA dehydrogenase; Region: ACAD; cl09933
31964001939	sulfur acquisition oxidoreductase, SfnB family; Region: sulfur_SfnB; TIGR04022
31964001940	active site
31964001941	1 probable transmembrane helix predicted for CMS0378 by Phobius
31964001942	PAP2_like_2 proteins. PAP2 is a super-family of phosphatases and haloperoxidases. This subgroup, which is specific to bacteria, lacks functional characterization and may act as a membrane-associated lipid phosphatase; Region: PAP2_like_2; cd03392
31964001943	Membrane-associated phospholipid phosphatase [Lipid metabolism]; Region: PgpB; COG0671
31964001944	active site
31964001945	6 probable transmembrane helices predicted for CMS0379 by TMHMM2.0 at aa 80-102, 139-161, 168-190,210-232, 239-258 and 268-290
31964001946	HMMPfam hit to PF01569, Phosphoesterase,PA-phosphatase related, score 3.3e-25
31964001947	hypothetical protein; Provisional; Region: PRK09256
31964001948	HMMPfam hit to PF00472, Class I peptide chain release factor, score 6.5e-09
31964001949	RES domain; Region: RES; pfam08808
31964001950	PS00017 ATP/GTP-binding site motif A (P-loop).
31964001951	Luciferase-like monooxygenase; Region: Bac_luciferase; pfam00296
31964001952	probable oxidoreductase, LLM family; Region: LLM_2I7G; TIGR03858
31964001953	HMMPfam hit to PF00296, Bacterial luciferase, score 4e-08
31964001954	Uncharacterized protein conserved in bacteria (DUF2200); Region: DUF2200; pfam09966
31964001955	mycofactocin system transcriptional regulator; Region: mycofact_TetR; TIGR03968
31964001956	Bacterial regulatory proteins, tetR family; Region: TetR_N; pfam00440
31964001957	HMMPfam hit to PF00440, Bacterial regulatory protein, TetR, score 3.2e-13
31964001958	PS01081 Bacterial regulatory proteins, tetR family signature.
31964001959	enoyl_reductase_like; Region: enoyl_reductase_like; cd08249
31964001960	NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only]; Region: Qor; COG0604
31964001961	NAD(P) binding site [chemical binding]; other site
31964001962	HMMPfam hit to PF00107, Zinc-containing alcohol dehydrogenase superfamily, score 8.8e-37
31964001963	Homeodomain-like domain; Region: HTH_23; cl17451
31964001964	Winged helix-turn helix; Region: HTH_29; pfam13551
31964001965	Integrase core domain; Region: rve; pfam00665
31964001966	Integrase core domain; Region: rve_3; pfam13683
31964001967	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964001968	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964001969	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964001970	HMMPfam hit to PF00665, Integrase, catalytic region, score 5.7e-38
31964001971	2 probable transmembrane helices predicted for CMS0393 by TMHMM2.0 at aa 36-58 and 205-227
31964001972	Nitroreductase-like family 2. A subfamily of the nitroreductase family containing uncharacterized proteins that are similar to nitroreductase. Nitroreductase catalyzes the reduction of nitroaromatic compounds such as nitrotoluenes, nitrofurans and...; Region: Nitroreductase_2; cd02138
31964001973	putative FMN binding site [chemical binding]; other site
31964001974	HMMPfam hit to PF00881, Nitroreductase, score 3.6e-06
31964001975	3 probable transmembrane helices predicted for CMS0397 by TMHMM2.0 at aa 21-43, 58-80 and 87-109
31964001976	Beta-lactamase class C and other penicillin binding proteins [Defense mechanisms]; Region: AmpC; COG1680
31964001977	Beta-lactamase; Region: Beta-lactamase; pfam00144
31964001978	HMMPfam hit to PF00144, Beta-lactamase, score 2.4e-61
31964001979	PAP2, bacterial acid phosphatase or class A non-specific acid phosphatases. These enzymes catalyze phosphomonoester hydrolysis, with optimal activity in low pH conditions. They are secreted into the periplasmic space, and their physiological role remains...; Region: PAP2_acid_phosphatase; cd03397
31964001980	active site
31964001981	Membrane-associated phospholipid phosphatase [Lipid metabolism]; Region: PgpB; COG0671
31964001982	HMMPfam hit to PF01569, Phosphoesterase,PA-phosphatase related, score 0.0033
31964001983	PS01157 Class A bacterial acid phosphatases signature.
31964001984	amidase; Provisional; Region: PRK06828
31964001985	Amidase; Region: Amidase; cl11426
31964001986	2 probable transmembrane helices predicted for CMS0400 by TMHMM2.0 at aa 12-34 and 600-619
31964001987	HMMPfam hit to PF01425, Amidase, score 3.9e-87
31964001988	PspC domain; Region: PspC; pfam04024
31964001989	HMMPfam hit to PF04024, PspC, score 1.2e-20
31964001990	Predicted helix-turn-helix motif with score 1034.000, SD 2.71 at aa 15-36, sequence GVCAALADRFGVSRFLVRLLFV
31964001991	ANTAR domain; Region: ANTAR; pfam03861
31964001992	HMMPfam hit to PF03861, ANTAR, score 7e-17
31964001993	RNA polymerase sigma-70 factor, sigma-B/F/G subfamily; Region: SigBFG; TIGR02980
31964001994	Sigma-70 region 2; Region: Sigma70_r2; pfam04542
31964001995	Sigma-70 region 3; Region: Sigma70_r3; pfam04539
31964001996	Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs). A SF is a dissociable subunit of RNA polymerase, it directs bacterial or...; Region: Sigma70_r4; cd06171
31964001997	DNA binding residues [nucleotide binding]
31964001998	HMMPfam hit to PF04545, Sigma-70 region 4, score 1.2e-13
31964001999	Predicted helix-turn-helix motif with score 2258.000, SD 6.88 at aa 276-297, sequence CSQSEIAAELGVTQMQVSRLLA
31964002000	PS00038 Myc-type, 'helix-loop-helix' dimerization domain signature.
31964002001	HMMPfam hit to PF04539, Sigma-70 region 3, score 7.2e-07
31964002002	HMMPfam hit to PF04542, Sigma-70 region 2, score 5.9e-14
31964002003	amino acid transporter; Region: 2A0306; TIGR00909
31964002004	C-terminus of AA_permease; Region: AA_permease_C; pfam13906
31964002005	12 probable transmembrane helices predicted for CMS0404 by TMHMM2.0 at aa 27-49, 64-86, 107-129, 149-171,178-200, 237-259, 280-302, 322-356, 377-399, 403-422,435-454 and 459-478
31964002006	HMMPfam hit to PF00324, Amino acid permease-associated region, score 3.2e-24
31964002007	Formamidopyrimidine-DNA glycosylase [DNA replication, recombination, and repair]; Region: Nei; COG0266
31964002008	N-terminal domain of the actinomycetal Nei2 and related DNA glycosylases; Region: AcNei2_N; cd08971
31964002009	putative DNA binding site [nucleotide binding]; other site
31964002010	catalytic residue [active]
31964002011	putative H2TH interface [polypeptide binding]; other site
31964002012	putative catalytic residues [active]
31964002013	Formamidopyrimidine-DNA glycosylase H2TH domain; Region: H2TH; pfam06831
31964002014	Zinc finger found in FPG and IleRS; Region: zf-FPG_IleRS; pfam06827
31964002015	HMMPfam hit to PF06831, Formamidopyrimidine-DNA glycolase, score 1.7e-18
31964002016	HMMPfam hit to PF01149, Formamidopyrimidine-DNA glycolase, score 5.8e-18
31964002017	DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region; Region: DEXDc; cd00046
31964002018	putative ATP-dependent helicase Lhr; Provisional; Region: PRK09751
31964002019	ATP binding site [chemical binding]; other site
31964002020	putative Mg++ binding site [ion binding]; other site
31964002021	Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may...; Region: HELICc; cd00079
31964002022	nucleotide binding region [chemical binding]; other site
31964002023	ATP-binding site [chemical binding]; other site
31964002024	DEAD/H associated; Region: DEAD_assoc; pfam08494
31964002025	PS00339 Aminoacyl-transfer RNA synthetases class-II signature 2.
31964002026	HMMPfam hit to PF00271, Helicase, C-terminal, score 6.3e-15
31964002027	HMMPfam hit to PF00270, DEAD/DEAH box helicase,N-terminal, score 1.3e-38
31964002028	PS00339 Aminoacyl-transfer RNA synthetases class-II signature 2.
31964002029	PS00017 ATP/GTP-binding site motif A (P-loop).
31964002030	Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+...; Region: Nudix_Hydrolase; cl00447
31964002031	nudix motif; other site
31964002032	Transcriptional regulator [Transcription]; Region: AcrR; COG1309
31964002033	Bacterial regulatory proteins, tetR family; Region: TetR_N; pfam00440
31964002034	HMMPfam hit to PF00440, Bacterial regulatory protein, TetR, score 3.5e-18
31964002035	helicase 45; Provisional; Region: PTZ00424
31964002036	DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region; Region: DEXDc; cl17251
31964002037	ATP binding site [chemical binding]; other site
31964002038	putative Mg++ binding site [ion binding]; other site
31964002039	Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may...; Region: HELICc; cd00079
31964002040	nucleotide binding region [chemical binding]; other site
31964002041	ATP-binding site [chemical binding]; other site
31964002042	HMMPfam hit to PF00271, Helicase, C-terminal, score 1.6e-27
31964002043	HMMPfam hit to PF00270, DEAD/DEAH box helicase,N-terminal, score 3.9e-52
31964002044	PS00017 ATP/GTP-binding site motif A (P-loop).
31964002045	Protein of unknown function (DUF1684); Region: DUF1684; pfam07920
31964002046	EVE domain; Region: EVE; cl00728
31964002047	Domain of unknown function (DUF427); Region: DUF427; pfam04248
31964002048	HMMPfam hit to PF04248, Protein of unknown function DUF427, score 1.6e-21
31964002049	Protein of unknown function (DUF1470); Region: DUF1470; pfam07336
31964002050	CGNR zinc finger; Region: zf-CGNR; pfam11706
31964002051	HMMPfam hit to PF07336, Protein of unknown function DUF1470, score 1.1e-30
31964002052	SprT-like family; Region: SprT-like; pfam10263
31964002053	SprT homologues; Region: SprT; cl01182
31964002054	PS00142 Neutral zinc metallopeptidases,zinc-binding region signature.
31964002055	HMMPfam hit to PF07719, Tetratricopeptide repeat,score 0.0096
31964002056	dehydrogenase, PQQ-dependent, s-GDH family; Region: non_repeat_PQQ; TIGR03606
31964002057	Glucose / Sorbosone dehydrogenase; Region: GSDH; pfam07995
31964002058	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964002059	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cl17173
31964002060	Homeodomain-like domain; Region: HTH_23; cl17451
31964002061	Winged helix-turn helix; Region: HTH_29; pfam13551
31964002062	Integrase core domain; Region: rve; pfam00665
31964002063	Integrase core domain; Region: rve_3; pfam13683
31964002064	HMMPfam hit to PF00665, Integrase, catalytic region, score 2e-41
31964002065	Predicted helix-turn-helix motif with score 1316.000, SD 3.67 at aa 25-46, sequence WPVRRAAERFQCSPATASRWAR
31964002066	Lipoate-protein ligase A [Coenzyme metabolism]; Region: LplA; COG0095
31964002067	HMMPfam hit to PF03099, Biotin/lipoate A/B protein ligase, score 2.3e-25
31964002068	Predicted acetyltransferase [General function prediction only]; Region: COG2388
31964002069	Putative amidase domain; Region: Amidase_6; pfam12671
31964002070	Protein of unknown function (DUF2809); Region: DUF2809; pfam10990
31964002071	4 probable transmembrane helices predicted for CMS0425 by TMHMM2.0 at aa 39-58, 62-81, 86-108 and 123-145
31964002072	phosphoglucomutase; Validated; Region: PRK07564
31964002073	This bacterial PGM-like (phosphoglucomutase-like) protein of unknown function belongs to the alpha-D-phosphohexomutase superfamily. The alpha-D-phosphohexomutases include several related enzymes that catalyze a reversible intramolecular phosphoryl...; Region: PGM_like3; cd05801
31964002074	active site
31964002075	substrate binding site [chemical binding]; other site
31964002076	metal binding site [ion binding]; metal-binding site
31964002077	HMMPfam hit to PF00408,Phosphoglucomutase/phosphomannomutase C terminal, score 6e-08
31964002078	HMMPfam hit to PF02880,Phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain III, score 1.8e-27
31964002079	HMMPfam hit to PF02879,Phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain II, score 1.2e-21
31964002080	HMMPfam hit to PF02878,Phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I, score 1.1e-36
31964002081	PS00710 Phosphoglucomutase and phosphomannomutase phosphoserine signature.
31964002082	Prephenate dehydratase; Region: PDT; pfam00800
31964002083	prephenate dehydratase; Provisional; Region: PRK11898
31964002084	C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme; Region: ACT_CM-PDT; cd04905
31964002085	putative L-Phe binding site [chemical binding]; other site
31964002086	HMMPfam hit to PF00800, Prephenate dehydratase,score 2.2e-37
31964002087	HMMPfam hit to PF01842, Amino acid-binding ACT,score 1.5e-06
31964002088	amino acid transporter; Region: 2A0306; TIGR00909
31964002089	HMMPfam hit to PF00324, Amino acid permease-associated region, score 1.1e-07
31964002090	11 probable transmembrane helices predicted for CMS0428 by TMHMM2.0 at aa 20-42, 63-85, 105-124, 136-158,173-190, 211-233, 253-275, 308-325, 330-352, 359-381 and 385-407
31964002091	seryl-tRNA synthetase; Provisional; Region: PRK05431
31964002092	Seryl-tRNA synthetase N-terminal domain; Region: Seryl_tRNA_N; pfam02403
31964002093	Seryl-tRNA synthetase (SerRS) class II core catalytic domain. SerRS is responsible for the attachment of serine to the 3' OH group of ribose of the appropriate tRNA. This domain It is primarily responsible for ATP-dependent formation of the enzyme...; Region: SerRS_core; cd00770
31964002094	dimer interface [polypeptide binding]; other site
31964002095	active site
31964002096	motif 1; other site
31964002097	motif 2; other site
31964002098	motif 3; other site
31964002099	HMMPfam hit to PF02403, Seryl-tRNA synthetase,class IIa, score 2.7e-33
31964002100	HMMPfam hit to PF00587, tRNA synthetases, class-II (G, H, P and S), score 1.3e-48
31964002101	PS00179 Aminoacyl-transfer RNA synthetases class-II signature 1.
31964002102	haloacid dehalogenase-like hydrolase; Region: Hydrolase_3; pfam08282
31964002103	Haloacid dehalogenase-like hydrolases. The haloacid dehalogenase-like (HAD) superfamily includes L-2-haloacid dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, and many others; Region: HAD_like; cl17915
31964002104	Cell envelope-related transcriptional attenuator domain; Region: LytR_cpsA_psr; pfam03816
31964002105	1 probable transmembrane helix predicted for CMS0431 by TMHMM2.0 at aa 32-54
31964002106	HMMPfam hit to PF03816, Cell envelope-related transcriptional attenuator, score 4e-54
31964002107	Homeodomain-like domain; Region: HTH_23; cl17451
31964002108	Winged helix-turn helix; Region: HTH_29; pfam13551
31964002109	Integrase core domain; Region: rve; pfam00665
31964002110	Integrase core domain; Region: rve_3; pfam13683
31964002111	Predicted helix-turn-helix motif with score 1316.000, SD 3.67 at aa 25-46, sequence WPVRRAAERFQCSPATASRWAR
31964002112	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.6e-41
31964002113	Transcriptional regulators [Transcription]; Region: PurR; COG1609
31964002114	Helix-turn-helix (HTH) DNA binding domain of the LacI family of transcriptional regulators; Region: HTH_LacI; cd01392
31964002115	DNA binding site [nucleotide binding]
31964002116	domain linker motif; other site
31964002117	Ligand-binding domain of a LacI-like transcriptional regulator, CatR which is involved in catechol degradation; Region: PBP1_CatR_like; cd06296
31964002118	putative dimerization interface [polypeptide binding]; other site
31964002119	putative ligand binding site [chemical binding]; other site
31964002120	Predicted helix-turn-helix motif with score 1648.000, SD 4.80 at aa 20-41, sequence TTLGLIAREANVSIGTVSKVLN
31964002121	HMMPfam hit to PF00532, Periplasmic binding protein/LacI transcriptional regulator, score 4.7e-11
31964002122	Type 1 glutamine amidotransferase (GATase1)-like domain; Region: GAT_1; cl00020
31964002123	Predicted dehydrogenases and related proteins [General function prediction only]; Region: MviM; COG0673
31964002124	Oxidoreductase family, NAD-binding Rossmann fold; Region: GFO_IDH_MocA; pfam01408
31964002125	HMMPfam hit to PF01408, Oxidoreductase, N-terminal,score 4.4e-25
31964002126	HMMPfam hit to PF02894, Oxidoreductase, C-terminal,score 0.061
31964002127	Alpha amylase catalytic domain found in bacterial cyclomaltodextrinases and related proteins; Region: AmyAc_bac_CMD_like; cd11354
31964002128	Glycosidases [Carbohydrate transport and metabolism]; Region: AmyA; COG0366
31964002129	active site
31964002130	catalytic site [active]
31964002131	HMMPfam hit to PF00128, Alpha amylase, catalytic region, score 1.9e-44
31964002132	HMMPfam hit to PF00196, Bacterial regulatory protein, LuxR, score 3.7e-21
31964002133	PS00622 Bacterial regulatory proteins, luxR family signature.
31964002134	2 probable transmembrane helices predicted for CMS0440 by TMHMM2.0 at aa 122-144 and 149-171
31964002135	Predicted transcriptional regulators [Transcription]; Region: COG1695
31964002136	Transcriptional regulator PadR-like family; Region: PadR; pfam03551
31964002137	HMMPfam hit to PF03551, Transcriptional regulator PadR-like, score 1e-19
31964002138	1 probable transmembrane helix predicted for CMS0442 by TMHMM2.0 at aa 52-74
31964002139	60Kd inner membrane protein; Region: 60KD_IMP; cl00489
31964002140	4 probable transmembrane helices predicted for CMS0443 by TMHMM2.0 at aa 35-57, 101-123, 151-173 and 206-228
31964002141	HMMPfam hit to PF02096, 60 kDa inner membrane protein, score 5.5e-14
31964002142	Predicted metal-dependent hydrolases related to alanyl-tRNA synthetase HxxxH domain [General function prediction only]; Region: COG2872
31964002143	leucine-zipper of insertion element IS481; Region: LZ_Tnp_IS481; pfam13011
31964002144	Winged helix-turn helix; Region: HTH_29; pfam13551
31964002145	Integrase core domain; Region: rve; pfam00665
31964002146	Integrase core domain; Region: rve_3; pfam13683
31964002147	HMMPfam hit to PF00665, Integrase, catalytic region, score 3.5E-36
31964002148	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964002149	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964002150	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964002151	Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols. AKRs are present in all phyla and are of importance to both health and industrial...; Region: Aldo_ket_red; cd06660
31964002152	Aldo/keto reductase family; Region: Aldo_ket_red; pfam00248
31964002153	active site
31964002154	catalytic tetrad [active]
31964002155	HMMPfam hit to PF00248, Aldo/keto reductase, score 9.1e-72
31964002156	1-acyl-sn-glycerol-3-phosphate acyltransferase [Lipid metabolism]; Region: PlsC; COG0204
31964002157	Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: AGPAT-like; Region: LPLAT_AGPAT-like; cd07989
31964002158	putative acyl-acceptor binding pocket; other site
31964002159	HMMPfam hit to PF01553, Phospholipid/glycerol acyltransferase, score 1.5e-31
31964002160	1 probable transmembrane helix predicted for CMS0448 by TMHMM2.0 at aa 33-55
31964002161	Aspartate alpha-decarboxylase or L-aspartate 1-decarboxylase, a pyruvoyl group-dependent  decarboxylase in beta-alanine production; Region: Asp_decarbox; cd06919
31964002162	tetramerization interface [polypeptide binding]; other site
31964002163	active site
31964002164	HMMPfam hit to PF02261, Aspartate decarboxylase,score 5.2e-65
31964002165	Virulence factor BrkB; Region: Virul_fac_BrkB; pfam03631
31964002166	HMMPfam hit to PF03631, Ribonuclease BN, score 1.9e-58
31964002167	6 probable transmembrane helices predicted for CMS0450 by TMHMM2.0 at aa 56-78, 117-139, 165-187,202-224, 237-259 and 272-294
31964002168	Deoxyribodipyrimidine photolyase [DNA replication, recombination, and repair]; Region: PhrB; COG0415
31964002169	DNA photolyase; Region: DNA_photolyase; pfam00875
31964002170	HMMPfam hit to PF03441, DNA photolyase,FAD-binding, score 1.6e-112
31964002171	PS00691 DNA photolyases class 1 signature 2.
31964002172	PS00394 DNA photolyases class 1 signature 1.
31964002173	HMMPfam hit to PF00875, DNA photolyase, N-terminal,score 4e-41
31964002174	3 probable transmembrane helices predicted for CMS0452 by TMHMM2.0 at aa 224-246, 324-346 and 359-381
31964002175	Homeodomain-like domain; Region: HTH_23; cl17451
31964002176	Winged helix-turn helix; Region: HTH_29; pfam13551
31964002177	Integrase core domain; Region: rve; pfam00665
31964002178	Integrase core domain; Region: rve_3; pfam13683
31964002179	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.6e-38
31964002180	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964002181	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964002182	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964002183	6 probable transmembrane helices predicted for CMS0454 by TMHMM2.0 at aa 2-24, 34-56, 85-107, 122-144,151-173 and 206-228
31964002184	3 probable transmembrane helices predicted for CMS0455 by TMHMM2.0 at aa 15-37, 57-79 and 83-105
31964002185	HMMPfam hit to PF06271, RDD, score 7.4e-10
31964002186	4 probable transmembrane helices predicted for CMS0456 by TMHMM2.0 at aa 24-46, 50-72, 112-129 and 139-161
31964002187	GDSL-like Lipase/Acylhydrolase family; Region: Lipase_GDSL_2; pfam13472
31964002188	active site
31964002189	catalytic triad [active]
31964002190	oxyanion hole [active]
31964002191	HMMPfam hit to PF00657, Lipolytic enzyme, G-D-S-L,score 1.5e-15
31964002192	DNA-binding transcriptional activator KdpE; Provisional; Region: PRK10529
31964002193	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
31964002194	active site
31964002195	phosphorylation site [posttranslational modification]
31964002196	intermolecular recognition site; other site
31964002197	dimerization interface [polypeptide binding]; other site
31964002198	Effector domain of response regulator. Bacteria and certain eukaryotes like protozoa and higher plants use two-component signal transduction systems to detect and respond to changes in the environment. The system consists of a sensor histidine kinase and...; Region: trans_reg_C; cd00383
31964002199	DNA binding site [nucleotide binding]
31964002200	HMMPfam hit to PF00486, Transcriptional regulatory protein, C-terminal, score 3.3e-22
31964002201	HMMPfam hit to PF00072, Response regulator receiver, score 1.5e-38
31964002202	Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms]; Region: KdpD; COG2205
31964002203	Osmosensitive K+ channel His kinase sensor domain; Region: KdpD; pfam02702
31964002204	USP domain is located between the N-terminal sensor domain and C-terminal catalytic domain of this Osmosensitive K+ channel histidine kinase family. The family of KdpD sensor kinase proteins regulates the kdpFABC operon responsible for potassium...; Region: USP_OKCHK; cd01987
31964002205	Ligand Binding Site [chemical binding]; other site
31964002206	Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via...; Region: HisKA; cd00082
31964002207	dimer interface [polypeptide binding]; other site
31964002208	phosphorylation site [posttranslational modification]
31964002209	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
31964002210	ATP binding site [chemical binding]; other site
31964002211	Mg2+ binding site [ion binding]; other site
31964002212	G-X-G motif; other site
31964002213	HMMPfam hit to PF02518, ATP-binding region,ATPase-like, score 2.3e-33
31964002214	PS00445 FGGY family of carbohydrate kinases signature 2.
31964002215	HMMPfam hit to PF00512, Histidine kinase A,N-terminal, score 9.1e-14
31964002216	3 probable transmembrane helices predicted for CMS0459 by TMHMM2.0 at aa 329-351, 364-386 and 406-425
31964002217	HMMPfam hit to PF00582, UspA, score 3.1e-15
31964002218	HMMPfam hit to PF02702, Osmosensitive K+ channel His kinase sensor, score 8.6e-81
31964002219	K+-transporting ATPase, c chain [Inorganic ion transport and metabolism]; Region: KdpC; COG2156
31964002220	HMMPfam hit to PF02669, K+ transporting ATPase,KdpC subunit, score 3.3e-66
31964002221	1 probable transmembrane helix predicted for CMS0460 by TMHMM2.0 at aa 12-34
31964002222	potassium-transporting ATPase subunit B; Provisional; Region: PRK01122
31964002223	E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122
31964002224	Soluble P-type ATPase [General function prediction only]; Region: COG4087
31964002225	7 probable transmembrane helices predicted for CMS0461 by TMHMM2.0 at aa 43-65, 80-102, 248-267, 282-304,622-639, 649-671 and 692-714
31964002226	HMMPfam hit to PF00702, Haloacid dehalogenase-like hydrolase, score 1.4e-30
31964002227	PS00154 E1-E2 ATPases phosphorylation site.
31964002228	HMMPfam hit to PF00122, E1-E2 ATPase-associated region, score 3.9e-49
31964002229	potassium-transporting ATPase subunit A; Provisional; Region: PRK05482
31964002230	HMMPfam hit to PF03814, K+ transporting ATPase, A subunit, score 3e-298
31964002231	11 probable transmembrane helices predicted for CMS0462 by TMHMM2.0 at aa 5-24, 60-79, 86-108, 128-150,171-193, 246-268, 280-299, 371-393, 414-436, 485-507 and 527-549
31964002232	1 probable transmembrane helix predicted for CMS0463 by TMHMM2.0 at aa 31-53
31964002233	HipA N-terminal domain; Region: Couple_hipA; pfam13657
31964002234	HipA-like N-terminal domain; Region: HipA_N; pfam07805
31964002235	HipA-like C-terminal domain; Region: HipA_C; pfam07804
31964002236	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
31964002237	non-specific DNA binding site [nucleotide binding]; other site
31964002238	salt bridge; other site
31964002239	sequence-specific DNA binding site [nucleotide binding]; other site
31964002240	HMMPfam hit to PF01381, Helix-turn-helix motif,score 2.7e-09
31964002241	Predicted helix-turn-helix motif with score 1325.000, SD 3.70 at aa 21-42, sequence LTQAGVAGLAGVSREYVVRLES
31964002242	hypothetical protein; Provisional; Region: PRK10621
31964002243	Sulfite exporter TauE/SafE; Region: TauE; pfam01925
31964002244	6 probable transmembrane helices predicted for CMS0467 by TMHMM2.0 at aa 10-32, 83-105, 109-126, 147-178,198-220 and 240-262
31964002245	HMMPfam hit to PF01925, Protein of unknown function DUF81, score 2.8e-32
31964002246	NADP oxidoreductase coenzyme F420-dependent; Region: F420_oxidored; pfam03807
31964002247	NADP oxidoreductase coenzyme F420-dependent; Region: F420_oxidored; cl17232
31964002248	GAF domain; Region: GAF; pfam01590
31964002249	ANTAR (AmiR and NasR transcription antitermination regulators) is an RNA-binding domain found in bacterial transcription antitermination regulatory proteins; Region: ANTAR; smart01012
31964002250	HMMPfam hit to PF03861, ANTAR, score 0.00032
31964002251	ANTAR domain; Region: ANTAR; pfam03861
31964002252	HMMPfam hit to PF01590, GAF, score 4.3e-10
31964002253	HMMPfam hit to PF03861, ANTAR, score 8.5e-11
31964002254	Haloacid dehalogenase-like hydrolase; Region: HAD_2; pfam13419
31964002255	Haloacid dehalogenase-like hydrolases. The haloacid dehalogenase-like (HAD) superfamily includes L-2-haloacid dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, and many others; Region: HAD_like; cd01427
31964002256	motif II; other site
31964002257	HMMPfam hit to PF00702, Haloacid dehalogenase-like hydrolase, score 8.3e-06
31964002258	Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription]; Region: CitB; COG2197
31964002259	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
31964002260	active site
31964002261	phosphorylation site [posttranslational modification]
31964002262	intermolecular recognition site; other site
31964002263	dimerization interface [polypeptide binding]; other site
31964002264	C-terminal DNA-binding domain of LuxR-like proteins. This domain contains a helix-turn-helix motif and binds DNA. Proteins belonging to this group are response regulators; some act as transcriptional activators, others as transcriptional repressors. Many...; Region: LuxR_C_like; cd06170
31964002265	DNA binding residues [nucleotide binding]
31964002266	dimerization interface [polypeptide binding]; other site
31964002267	HMMPfam hit to PF00196, Bacterial regulatory protein, LuxR, score 3.5e-19
31964002268	PS00622 Bacterial regulatory proteins, luxR family signature.
31964002269	Predicted helix-turn-helix motif with score 1038.000, SD 2.72 at aa 160-181, sequence ASNTDVAARLHITDATVKSHLV
31964002270	HMMPfam hit to PF00072, Response regulator receiver, score 1.9e-29
31964002271	Signal transduction histidine kinase [Signal transduction mechanisms]; Region: COG4585
31964002272	Histidine kinase; Region: HisKA_3; pfam07730
31964002273	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; Region: HATPase_c; pfam02518
31964002274	HMMPfam hit to PF02518, ATP-binding region,ATPase-like, score 2e-16
31964002275	HMMPfam hit to PF07730, Histidine kinase, score 3.6e-18
31964002276	5 probable transmembrane helices predicted for CMS0474 by TMHMM2.0 at aa 13-35, 40-62, 69-91, 111-133 and 138-160
31964002277	MacB-like periplasmic core domain; Region: MacB_PCD; pfam12704
31964002278	ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms]; Region: SalY; COG0577
31964002279	FtsX-like permease family; Region: FtsX; pfam02687
31964002280	4 probable transmembrane helices predicted for CMS0475 by TMHMM2.0 at aa 49-71, 286-308, 337-359 and 369-391
31964002281	HMMPfam hit to PF02687, Protein of unknown function DUF214, score 2.3e-17
31964002282	ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]; Region: SalX; COG1136
31964002283	ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein; Region: ABC_MJ0796_LolCDE_FtsE; cd03255
31964002284	Walker A/P-loop; other site
31964002285	ATP binding site [chemical binding]; other site
31964002286	Q-loop/lid; other site
31964002287	ABC transporter signature motif; other site
31964002288	Walker B; other site
31964002289	D-loop; other site
31964002290	H-loop/switch region; other site
31964002291	HMMPfam hit to PF00005, ABC transporter, score 2.7e-49
31964002292	PS00017 ATP/GTP-binding site motif A (P-loop).
31964002293	PS00211 ABC transporters family signature.
31964002294	low GC
31964002295	Domain of unknown function (DUF3883); Region: DUF3883; pfam13020
31964002296	Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may...; Region: HELICc; cd00079
31964002297	Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair]; Region: HepA; COG0553
31964002298	nucleotide binding region [chemical binding]; other site
31964002299	ATP-binding site [chemical binding]; other site
31964002300	HMMPfam hit to PF00271, Helicase, C-terminal, score 0.0078
31964002301	1 probable transmembrane helix predicted for CMS0480 by TMHMM2.0 at aa 142-164
31964002302	Homeodomain-like domain; Region: HTH_23; cl17451
31964002303	Winged helix-turn helix; Region: HTH_29; pfam13551
31964002304	Integrase core domain; Region: rve; pfam00665
31964002305	Integrase core domain; Region: rve_3; pfam13683
31964002306	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.6e-38
31964002307	HMMPfam hit to PF00550, Phosphopantetheine-binding,score 1.1e-07
31964002308	HMMPfam hit to PF00501, AMP-dependent synthetase and ligase, score 6.5e-110
31964002309	PS00455  AMP-binding domain signature.
31964002310	Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators; Region: WHTH_GntR; cd07377
31964002311	DNA-binding site [nucleotide binding]; DNA binding site
31964002312	HMMPfam hit to PF00392, Bacterial regulatory protein, GntR, score 1.7e-13
31964002313	Predicted helix-turn-helix motif with score 1164.000, SD 3.15 at aa 41-62, sequence PTVRALAEQAGVAVNTVARAYK
31964002314	3 probable transmembrane helices predicted for CMS0484 by TMHMM2.0 at aa 21-38, 48-70 and 100-122
31964002315	2 probable transmembrane helices predicted for CMS0485 by TMHMM2.0 at aa 226-248 and 269-291
31964002316	Transcriptional regulators [Transcription]; Region: Lrp; COG1522
31964002317	AsnC-type helix-turn-helix domain; Region: HTH_AsnC-type; pfam13404
31964002318	AsnC family; Region: AsnC_trans_reg; pfam01037
31964002319	HMMPfam hit to PF01037, Bacterial regulatory proteins, AsnC/Lrp, score 1.9e-05
31964002320	N-Dimethylarginine dimethylaminohydrolase [Amino acid transport and metabolism]; Region: COG1834
31964002321	Amidinotransferase; Region: Amidinotransf; pfam02274
31964002322	HMMPfam hit to PF02274, Amidinotransferase, score 1.5e-61
31964002323	ornithine--oxo-acid transaminase; Provisional; Region: rocD; PRK04073
31964002324	Acetyl ornithine aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD correspond to ornithine aminotransferase, acetylornithine aminotransferase; Region: OAT_like; cd00610
31964002325	inhibitor-cofactor binding pocket; inhibition site
31964002326	pyridoxal 5'-phosphate binding site [chemical binding]; other site
31964002327	catalytic residue [active]
31964002328	HMMPfam hit to PF00202, Aminotransferase class-III,score 1.6e-141
31964002329	PS00600 Aminotransferases class-III pyridoxal-phosphate attachment site.
31964002330	Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]; Region: WcaG; COG0451
31964002331	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
31964002332	NAD(P) binding site [chemical binding]; other site
31964002333	active site
31964002334	probable non-F420 flavinoid oxidoreductase; Region: flavin_revert; TIGR03885
31964002335	benzoate transporter; Region: benE; TIGR00843
31964002336	4 probable transmembrane helices predicted for CMS0493 by TMHMM2.0 at aa 17-39, 44-66, 79-101 and 111-133
31964002337	Membrane proteins related to metalloendopeptidases [Cell envelope biogenesis, outer membrane]; Region: NlpD; COG0739
31964002338	Peptidase family M23; Region: Peptidase_M23; pfam01551
31964002339	HMMPfam hit to PF01551, Peptidase M23B, score 1.7e-36
31964002340	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely...; Region: SGNH_hydrolase; cl01053
31964002341	active site
31964002342	catalytic triad [active]
31964002343	oxyanion hole [active]
31964002344	Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins; Region: SRPBCC_8; cd07817
31964002345	putative hydrophobic ligand binding site [chemical binding]; other site
31964002346	HMMPfam hit to PF03364, Streptomyces cyclase/dehydrase, score 3.8e-25
31964002347	1 probable transmembrane helix predicted for CMS0499 by TMHMM2.0 at aa 55-77
31964002348	NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion]; Region: NemA; COG1902
31964002349	Old yellow enzyme (OYE)-like FMN binding domain. OYE was the first flavin-dependent enzyme identified, however its true physiological role remains elusive to this day. Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a...; Region: OYE_like_FMN; cd02933
31964002350	FMN binding site [chemical binding]; other site
31964002351	active site
31964002352	substrate binding site [chemical binding]; other site
31964002353	catalytic residue [active]
31964002354	HMMPfam hit to PF00724, NADH:flavin oxidoreductase/NADH oxidase, score 8.4e-86
31964002355	Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription]; Region: CitB; COG2197
31964002356	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
31964002357	active site
31964002358	phosphorylation site [posttranslational modification]
31964002359	intermolecular recognition site; other site
31964002360	dimerization interface [polypeptide binding]; other site
31964002361	C-terminal DNA-binding domain of LuxR-like proteins. This domain contains a helix-turn-helix motif and binds DNA. Proteins belonging to this group are response regulators; some act as transcriptional activators, others as transcriptional repressors. Many...; Region: LuxR_C_like; cd06170
31964002362	DNA binding residues [nucleotide binding]
31964002363	dimerization interface [polypeptide binding]; other site
31964002364	HMMPfam hit to PF00196, Bacterial regulatory protein, LuxR, score 2.7e-17
31964002365	PS00622 Bacterial regulatory proteins, luxR family signature.
31964002366	HMMPfam hit to PF00072, Response regulator receiver, score 1.1e-31
31964002367	Histidine kinase; Region: HisKA_3; pfam07730
31964002368	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; Region: HATPase_c; pfam02518
31964002369	HMMPfam hit to PF02518, ATP-binding region,ATPase-like, score 1.7e-09
31964002370	HMMPfam hit to PF07730, Histidine kinase
31964002371	5 probable transmembrane helices predicted for CMS0502 by TMHMM2.0 at aa 4-23, 30-47, 57-79, 91-110 and 120-142
31964002372	Putative transmembrane protein (PGPGW); Region: PGPGW; cl09870
31964002373	2 probable transmembrane helices predicted for CMS0503 by TMHMM2.0 at aa 39-61 and 66-88
31964002374	pyrimidine utilization regulatory protein R; Region: RutR; TIGR03613
31964002375	Bacterial regulatory proteins, tetR family; Region: TetR_N; pfam00440
31964002376	HMMPfam hit to PF00440, Bacterial regulatory protein, TetR, score 1.1e-09
31964002377	drug resistance transporter, EmrB/QacA subfamily; Region: efflux_EmrB; TIGR00711
31964002378	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
31964002379	putative substrate translocation pore; other site
31964002380	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964002381	13 probable transmembrane helices predicted for CMS0505 by TMHMM2.0 at aa 28-45, 57-76, 86-105, 117-139,144-166, 179-198, 208-225, 245-267, 271-293, 306-328,338-360, 381-403 and 418-440
31964002382	PS00216 Sugar transport proteins signature 1.
31964002383	Luciferase-like monooxygenase; Region: Bac_luciferase; pfam00296
31964002384	probable oxidoreductase, LLM family; Region: LLM_2I7G; TIGR03858
31964002385	HMMPfam hit to PF00296, Bacterial luciferase, score 5.1e-08
31964002386	quinone oxidoreductase, NADPH-dependent; Provisional; Region: PRK10754
31964002387	Quinone oxidoreductase (QOR); Region: QOR2; cd05286
31964002388	NADP binding site [chemical binding]; other site
31964002389	dimer interface [polypeptide binding]; other site
31964002390	HMMPfam hit to PF00107, Zinc-containing alcohol dehydrogenase superfamily, score 2.8e-75
31964002391	3 probable transmembrane helices predicted for CMS0510 by TMHMM2.0 at aa 27-49, 62-84 and 104-126
31964002392	Cysteine synthase [Amino acid transport and metabolism]; Region: CysK; COG0031
31964002393	CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase. CBS is a unique heme-containing enzyme that catalyzes a pyridoxal 5'-phosphate (PLP)-dependent condensation of serine and homocysteine to give cystathionine; Region: CBS_like; cd01561
31964002394	dimer interface [polypeptide binding]; other site
31964002395	pyridoxal 5'-phosphate binding site [chemical binding]; other site
31964002396	catalytic residue [active]
31964002397	HMMPfam hit to PF00291,Pyridoxal-5'-phosphate-dependent enzyme, beta subunit,score 2.3e-122
31964002398	PS00901 Cysteine synthase/cystathionine beta-synthase P-phosphate attachment site.
31964002399	serine O-acetyltransferase; Region: cysE; TIGR01172
31964002400	Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of...; Region: LbH_SAT; cd03354
31964002401	trimer interface [polypeptide binding]; other site
31964002402	active site
31964002403	substrate binding site [chemical binding]; other site
31964002404	CoA binding site [chemical binding]; other site
31964002405	HMMPfam hit to PF00132, Bacterial transferase hexapeptide repeat, score 18
31964002406	HMMPfam hit to PF00132, Bacterial transferase hexapeptide repeat, score 16
31964002407	PS00017 ATP/GTP-binding site motif A (P-loop).
31964002408	HMMPfam hit to PF00132, Bacterial transferase hexapeptide repeat, score 0.47
31964002409	HMMPfam hit to PF00132, Bacterial transferase hexapeptide repeat, score 22
31964002410	SpoU rRNA Methylase family; Region: SpoU_methylase; pfam00588
31964002411	HMMPfam hit to PF00588, tRNA/rRNA methyltransferase (SpoU), score 3.5e-17
31964002412	Homeodomain-like domain; Region: HTH_23; cl17451
31964002413	Winged helix-turn helix; Region: HTH_29; pfam13551
31964002414	Integrase core domain; Region: rve; pfam00665
31964002415	Integrase core domain; Region: rve_3; pfam13683
31964002416	HMMPfam hit to PF00665, Integrase, catalytic region, score 3.7e-42
31964002417	Predicted helix-turn-helix motif with score 1316.000, SD 3.67 at aa 25-46, sequence WPVRRAAERFQCSPATASRWAR
31964002418	pantothenate kinase; Provisional; Region: PRK05439
31964002419	Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway. The reaction carried out by this enzyme is a key regulatory point...; Region: PanK; cd02025
31964002420	ATP-binding site [chemical binding]; other site
31964002421	CoA-binding site [chemical binding]; other site
31964002422	Mg2+-binding site [ion binding]; other site
31964002423	HMMPfam hit to PF00485, Phosphoribulokinase/uridine kinase, score 8.1e-06
31964002424	PS00017 ATP/GTP-binding site motif A (P-loop).
31964002425	glucosamine--fructose-6-phosphate aminotransferase; Reviewed; Region: PRK00331
31964002426	Glutamine amidotransferases class-II (Gn-AT)_GFAT-type. This domain is found at the N-terminus of glucosamine-6P synthase (GlmS, or GFAT in humans).  The glutaminase domain catalyzes amide nitrogen transfer from glutamine to the appropriate substrate. In...; Region: GFAT; cd00714
31964002427	glutaminase active site [active]
31964002428	SIS (Sugar ISomerase) domain repeat 1 found in Glucosamine 6-phosphate synthase (GlmS) and Glucosamine-6-phosphate deaminase (GlmD). The SIS domain is found in many phosphosugar isomerases and phosphosugar binding proteins. GlmS contains a N-terminal...; Region: SIS_GlmS_GlmD_1; cd05008
31964002429	dimer interface [polypeptide binding]; other site
31964002430	active site
31964002431	SIS (Sugar ISomerase) domain repeat 2 found in Glucosamine 6-phosphate synthase (GlmS) and Glucosamine-6-phosphate deaminase (GlmD). The SIS domain is found in many phosphosugar isomerases and phosphosugar binding proteins. GlmS contains a N-terminal...; Region: SIS_GlmS_GlmD_2; cd05009
31964002432	dimer interface [polypeptide binding]; other site
31964002433	active site
31964002434	PS00443 Glutamine amidotransferases class-II active site.
31964002435	HMMPfam hit to PF00310, Glutamine amidotransferase,class-II, score 1.7e-52
31964002436	HMMPfam hit to PF01380, Sugar isomerase (SIS),score 1.4e-32
31964002437	HMMPfam hit to PF01380, Sugar isomerase (SIS),score 1.3e-26
31964002438	4'-phosphopantetheinyl transferase; Provisional; Region: acpS; PRK00070
31964002439	HMMPfam hit to PF01648, 4'-phosphopantetheinyl transferase, score 1.1e-09
31964002440	alanine racemase; Reviewed; Region: alr; PRK00053
31964002441	Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Alanine Racemase; Region: PLPDE_III_AR; cd00430
31964002442	active site
31964002443	pyridoxal 5'-phosphate (PLP) binding site [chemical binding]; other site
31964002444	dimer interface [polypeptide binding]; other site
31964002445	substrate binding site [chemical binding]; other site
31964002446	catalytic residues [active]
31964002447	HMMPfam hit to PF01168, Alanine racemase,N-terminal, score 1e-67
31964002448	PS00395 Alanine racemase pyridoxal-phosphate attachment site.
31964002449	HMMPfam hit to PF00842, Alanine racemase,C-terminal, score 7.8e-42
31964002450	alanine racemase; Reviewed; Region: alr; PRK00053
31964002451	Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Alanine Racemase; Region: PLPDE_III_AR; cd00430
31964002452	active site
31964002453	pyridoxal 5'-phosphate (PLP) binding site [chemical binding]; other site
31964002454	dimer interface [polypeptide binding]; other site
31964002455	substrate binding site [chemical binding]; other site
31964002456	catalytic residues [active]
31964002457	Predicted ATPase or kinase [General function prediction only]; Region: COG0802
31964002458	HMMPfam hit to PF01168, Alanine racemase,N-terminal, score 2.7e-53
31964002459	PS00012 Phosphopantetheine attachment site.
31964002460	HMMPfam hit to PF00842, Alanine racemase,C-terminal, score 7.5e-50
31964002461	HMMPfam hit to PF02367, Protein of unknown function UPF0079, score 6e-42
31964002462	PS00017 ATP/GTP-binding site motif A (P-loop).
31964002463	tRNA threonylcarbamoyl adenosine modification protein YeaZ; Region: T6A_YeaZ; TIGR03725
31964002464	Glycoprotease family; Region: Peptidase_M22; pfam00814
31964002465	HMMPfam hit to PF00814, Peptidase M22,glycoprotease, score 1.9e-11
31964002466	ribosomal-protein-alanine acetyltransferase; Region: rimI; TIGR01575
31964002467	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cd04301
31964002468	Coenzyme A binding pocket [chemical binding]; other site
31964002469	UGMP family protein; Validated; Region: PRK09604
31964002470	Inactive homolog of metal-dependent proteases, putative molecular chaperone [Posttranslational modification, protein turnover, chaperones]; Region: COG1214; cl17884
31964002471	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 3.5e-20
31964002472	HMMPfam hit to PF00814, Peptidase M22,glycoprotease, score 2.8e-22
31964002473	Domain of unknown function (DUF4190); Region: DUF4190; pfam13828
31964002474	2 probable transmembrane helices predicted for CMS0524 by TMHMM2.0 at aa 57-86 and 101-123
31964002475	Chaperonin 10 Kd subunit (cpn10 or GroES); Cpn10 cooperates with chaperonin 60 (cpn60 or GroEL), an ATPase, to assist the folding and assembly of proteins and is found in eubacterial cytosol, as well as in the matrix of mitochondria and chloroplasts. It...; Region: cpn10; cd00320
31964002476	oligomerisation interface [polypeptide binding]; other site
31964002477	mobile loop; other site
31964002478	roof hairpin; other site
31964002479	HMMPfam hit to PF00166, Chaperonin Cpn10, score 9.8e-61
31964002480	PS00681 Chaperonins cpn10 signature.
31964002481	Predicted permeases [General function prediction only]; Region: RarD; COG2962
31964002482	9 probable transmembrane helices predicted for CMS0527 by TMHMM2.0 at aa 13-35, 42-64, 76-98, 103-125,132-154, 190-212, 219-241, 245-267 and 279-296
31964002483	HMMPfam hit to PF00892, Protein of unknown function DUF6, score 4.5e-10
31964002484	ABC-type branched-chain amino acid transport systems, periplasmic component [Amino acid transport and metabolism]; Region: LivK; COG0683
31964002485	Type 1 periplasmic binding fold superfamily; Region: Periplasmic_Binding_Protein_Type_1; cl10011
31964002486	1 probable transmembrane helix predicted for CMS0528 by TMHMM2.0 at aa 17-39
31964002487	HMMPfam hit to PF01094, Extracellular ligand-binding receptor, score 1.3e-21
31964002488	ATP-binding cassette domain of branched-chain amino acid transporter; Region: ABC_TM1139_LivF_branched; cd03224
31964002489	ABC-type thiamine transport system, ATPase component [Coenzyme metabolism]; Region: ThiQ; COG3840
31964002490	Walker A/P-loop; other site
31964002491	ATP binding site [chemical binding]; other site
31964002492	Q-loop/lid; other site
31964002493	ABC transporter signature motif; other site
31964002494	Walker B; other site
31964002495	D-loop; other site
31964002496	H-loop/switch region; other site
31964002497	HMMPfam hit to PF00005, ABC transporter, score 1.6e-54
31964002498	PS00211 ABC transporters family signature.
31964002499	PS00017 ATP/GTP-binding site motif A (P-loop).
31964002500	ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]; Region: LivG; COG0411
31964002501	ATP-binding cassette component of branched chain amino acids transport system; Region: ABC_Mj1267_LivG_branched; cd03219
31964002502	Walker A/P-loop; other site
31964002503	ATP binding site [chemical binding]; other site
31964002504	Q-loop/lid; other site
31964002505	ABC transporter signature motif; other site
31964002506	Walker B; other site
31964002507	D-loop; other site
31964002508	H-loop/switch region; other site
31964002509	HMMPfam hit to PF00005, ABC transporter, score 7.3e-55
31964002510	PS00211 ABC transporters family signature.
31964002511	PS00017 ATP/GTP-binding site motif A (P-loop).
31964002512	ABC-type branched-chain amino acid transport system, permease component [Amino acid transport and metabolism]; Region: LivM; COG4177
31964002513	Transmembrane subunit (TM) of Escherichia coli LivM and related proteins. LivM is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of...; Region: TM_PBP1_LivM_like; cd06581
31964002514	TM-ABC transporter signature motif; other site
31964002515	6 probable transmembrane helices predicted for CMS0531 by TMHMM2.0 at aa 7-29, 34-56, 126-148, 177-196,216-238 and 263-280
31964002516	HMMPfam hit to PF02653, Bacterial inner-membrane translocator, score 4.9e-28
31964002517	Transmembrane subunit (TM) of Escherichia coli LivH and related proteins. LivH is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of...; Region: TM_PBP1_LivH_like; cd06582
31964002518	Branched-chain amino acid transport system / permease component; Region: BPD_transp_2; pfam02653
31964002519	TM-ABC transporter signature motif; other site
31964002520	7 probable transmembrane helices predicted for CMS0532 by TMHMM2.0 at aa 183-205, 231-253, 266-288,315-337, 363-385, 405-427 and 440-458
31964002521	HMMPfam hit to PF02653, Bacterial inner-membrane translocator, score 9.9e-35
31964002522	inosine 5'-monophosphate dehydrogenase; Reviewed; Region: PRK05567
31964002523	TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure. Specific for this family is the conserved phosphate binding site at the edges of strands 7 and 8. The phosphate...; Region: TIM_phosphate_binding; cl17186
31964002524	This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein.  IMPDH is an essential enzyme that catalyzes the first step unique to GTP synthesis, playing a...; Region: CBS_pair_IMPDH; cd04601
31964002525	IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase. IMPDH catalyzes the NAD-dependent oxidation of inosine 5'-monophosphate (IMP) to xanthosine 5' monophosphate (XMP). It is a rate-limiting step in the de novo synthesis of...; Region: IMPDH; cd00381
31964002526	active site
31964002527	HMMPfam hit to PF00478, IMP dehydrogenase/GMP reductase, score 3.8e-194
31964002528	HMMPfam hit to PF00571, CBS, score 1.3e-11
31964002529	HMMPfam hit to PF00571, CBS, score 3.6e-08
31964002530	PS00487 IMP dehydrogenase / GMP reductase signature.
31964002531	inosine 5-monophosphate dehydrogenase; Validated; Region: PRK08649
31964002532	IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase. IMPDH catalyzes the NAD-dependent oxidation of inosine 5'-monophosphate (IMP) to xanthosine 5' monophosphate (XMP). It is a rate-limiting step in the de novo synthesis of...; Region: IMPDH; cd00381
31964002533	active site
31964002534	HMMPfam hit to PF00478, IMP dehydrogenase/GMP reductase, score 1.2e-29
31964002535	Putative regulatory, ligand-binding protein related to C-terminal domains of K+ channels [Inorganic ion transport and metabolism]; Region: COG0490
31964002536	TrkA-C domain; Region: TrkA_C; pfam02080
31964002537	HMMPfam hit to PF02080, TrkA-C, score 4.3e-07
31964002538	Sodium/hydrogen exchanger family; Region: Na_H_Exchanger; pfam00999
31964002539	Kef-type K+ transport systems, membrane components [Inorganic ion transport and metabolism]; Region: KefB; COG0475
31964002540	11 probable transmembrane helices predicted for CMS0537 by TMHMM2.0 at aa 7-24, 29-51, 58-75, 90-112,119-141, 151-173, 180-199, 219-252, 265-284, 294-316 and 358-380
31964002541	SURF1 superfamily. Surf1/Shy1 has been implicated in the posttranslational steps of the biogenesis of the mitochondrially-encoded Cox1 subunit of cytochrome c oxidase (complex IV). Cytochrome c oxidase (complex IV), the terminal electron-transferring...; Region: SURF1; cl01321
31964002542	2 probable transmembrane helices predicted for CMS0538 by TMHMM2.0 at aa 44-66 and 258-280
31964002543	Domain of unknown function (DUF3817); Region: DUF3817; pfam12823
31964002544	3 probable transmembrane helices predicted for CMS0539 by TMHMM2.0 at aa 17-39, 86-108 and 115-134
31964002545	GMP synthase; Reviewed; Region: guaA; PRK00074
31964002546	Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase; Region: GATase1_GMP_Synthase; cd01742
31964002547	AMP/PPi binding site [chemical binding]; other site
31964002548	candidate oxyanion hole; other site
31964002549	catalytic triad [active]
31964002550	potential glutamine specificity residues [chemical binding]; other site
31964002551	The C-terminal domain of GMP synthetase. It contains two subdomains; the ATP pyrophosphatase domain which closes to the N-termial and the dimerization domain at C-terminal end. The ATP-PPase is a twisted, five-stranded parallel beta-sheet sandwiched...; Region: GMP_synthase_C; cd01997
31964002552	ATP Binding subdomain [chemical binding]; other site
31964002553	Ligand Binding sites [chemical binding]; other site
31964002554	Dimerization subdomain; other site
31964002555	HMMPfam hit to PF00117, Glutamine amidotransferase class-I, score 1.2e-55
31964002556	PS00442 Glutamine amidotransferases class-I active site.
31964002557	HMMPfam hit to PF00958, GMP synthase, C-terminal,score 3.8e-69
31964002558	HMMPfam hit to PF06539, Protein of unknown function DUF1112, score 2.1e-64
31964002559	glycerophosphodiester phosphodiesterase; Provisional; Region: glpQ; PRK11143
31964002560	Catalytic domain of phosphoinositide-specific phospholipase C-like phosphodiesterases superfamily; Region: PI-PLCc_GDPD_SF; cl14615
31964002561	active site
31964002562	catalytic site [active]
31964002563	HMMPfam hit to PF03009, Glycerophosphoryl diester phosphodiesterase, score 5.5e-29
31964002564	Homeodomain-like domain; Region: HTH_23; cl17451
31964002565	Winged helix-turn helix; Region: HTH_29; pfam13551
31964002566	Integrase core domain; Region: rve; pfam00665
31964002567	Integrase core domain; Region: rve_3; pfam13683
31964002568	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.6e-38
31964002569	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964002570	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964002571	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964002572	bacteriocin biosynthesis cyclodehydratase domain; Region: cyclo_dehyd_2; TIGR03882
31964002573	YcaO-like family; Region: YcaO; pfam02624
31964002574	thiazole/oxazole-forming peptide maturase, SagD family component; Region: TOMM_cyclo_SagD; TIGR03604
31964002575	This family is the oxydase domain of NRPS (non-ribosomal peptide synthetase) and other proteins that modify polypeptides by cyclizing a thioester to form a ring. These include epoB, part of the epothilone biosynthesis pathway; tubD, part of the tubulysin...; Region: mcbC-like_oxidoreductase; cd02142
31964002576	putative FMN binding site [chemical binding]; other site
31964002577	NADPH bind site [chemical binding]; other site
31964002578	ABC-type multidrug transport system, ATPase component [Defense mechanisms]; Region: CcmA; COG1131
31964002579	ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A; Region: ABC_DR_subfamily_A; cd03230
31964002580	Walker A/P-loop; other site
31964002581	ATP binding site [chemical binding]; other site
31964002582	Q-loop/lid; other site
31964002583	ABC transporter signature motif; other site
31964002584	Walker B; other site
31964002585	D-loop; other site
31964002586	H-loop/switch region; other site
31964002587	HMMPfam hit to PF00005, ABC transporter, score 3.1e-44
31964002588	PS00017 ATP/GTP-binding site motif A (P-loop).
31964002589	PS00211 ABC transporters family signature.
31964002590	Sugar phosphate isomerases/epimerases [Carbohydrate transport and metabolism]; Region: IolE; COG1082
31964002591	AP endonuclease family 2; These endonucleases play a role in DNA repair. Cleave phosphodiester bonds at apurinic or apyrimidinic sites; the alignment also contains hexulose-6-phosphate isomerases, enzymes that catalyze the epimerization of...; Region: AP2Ec; cl12060
31964002592	Metal-binding active site; metal-binding site
31964002593	AP endonuclease family 2 C terminus; Region: AP_endonuc_2_N; pfam07582
31964002594	HMMPfam hit to PF01261, AP endonuclease, family 2,score 2.6e-38
31964002595	HMMPfam hit to PF07582, AP endonuclease 2,C-terminal, score 1.6e-18
31964002596	HMMPfam hit to PF07676, WD40-like Beta Propeller Repeat
31964002597	HMMPfam hit to PF07676, WD40-like Beta Propeller Repeat
31964002598	HMMPfam hit to PF07676, WD40-like Beta Propeller Repeat
31964002599	HMMPfam hit to PF07676, WD40-like Beta Propeller Repeat
31964002600	integral membrane protein, TerC family; Region: R_switched_Alx; TIGR03718
31964002601	9 probable transmembrane helices predicted for CMS0552 by TMHMM2.0 at aa 34-56, 76-98, 113-131, 138-160,164-181, 224-242, 257-279, 286-308 and 328-350
31964002602	HMMPfam hit to PF03741, Integral membrane protein TerC, score 1.7e-70
31964002603	Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription]; Region: OmpR; COG0745
31964002604	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
31964002605	active site
31964002606	phosphorylation site [posttranslational modification]
31964002607	intermolecular recognition site; other site
31964002608	dimerization interface [polypeptide binding]; other site
31964002609	Effector domain of response regulator. Bacteria and certain eukaryotes like protozoa and higher plants use two-component signal transduction systems to detect and respond to changes in the environment. The system consists of a sensor histidine kinase and...; Region: trans_reg_C; cd00383
31964002610	DNA binding site [nucleotide binding]
31964002611	HMMPfam hit to PF00072, Response regulator receiver, score 1.6e-39
31964002612	HMMPfam hit to PF00486, Transcriptional regulatory protein, C-terminal, score 1.3e-22
31964002613	Signal transduction histidine kinase [Signal transduction mechanisms]; Region: BaeS; COG0642
31964002614	Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via...; Region: HisKA; cd00082
31964002615	dimer interface [polypeptide binding]; other site
31964002616	phosphorylation site [posttranslational modification]
31964002617	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
31964002618	ATP binding site [chemical binding]; other site
31964002619	Mg2+ binding site [ion binding]; other site
31964002620	G-X-G motif; other site
31964002621	3 probable transmembrane helices predicted for CMS0554 by TMHMM2.0 at aa 7-29, 72-94 and 170-192
31964002622	HMMPfam hit to PF00672, Histidine kinase, HAMP region, score 7.1e-07
31964002623	HMMPfam hit to PF00512, Histidine kinase A,N-terminal, score 2.3e-22
31964002624	HMMPfam hit to PF02518, ATP-binding region,ATPase-like, score 1e-40
31964002625	2 probable transmembrane helices predicted for CMS0555 by TMHMM2.0 at aa 9-31 and 35-57
31964002626	N-acetylglutamate synthase; Validated; Region: PRK07922
31964002627	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 3.1e-14
31964002628	1 probable transmembrane helix predicted for CMS0557 by TMHMM2.0 at aa 21-43
31964002629	Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to...; Region: HTH_ARSR; cd00090
31964002630	dimerization interface [polypeptide binding]; other site
31964002631	putative DNA binding site [nucleotide binding]; other site
31964002632	putative Zn2+ binding site [ion binding]; other site
31964002633	HMMPfam hit to PF01022, Bacterial regulatory protein, ArsR, score 2.8e-24
31964002634	Predicted helix-turn-helix motif with score 1380.000, SD 3.89 at aa 35-56, sequence LSVSELVEESGLSQPLVSQHLR
31964002635	DNA repair protein RadA; Provisional; Region: PRK11823
31964002636	RecA-like NTPases. This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and...; Region: RecA-like_NTPases; cl17233
31964002637	Walker A motif; other site
31964002638	ATP binding site [chemical binding]; other site
31964002639	Walker B motif; other site
31964002640	Subunit ChlI of Mg-chelatase; Region: ChlI; pfam13541
31964002641	PS00017 ATP/GTP-binding site motif A (P-loop).
31964002642	leucine-zipper of insertion element IS481; Region: LZ_Tnp_IS481; pfam13011
31964002643	Winged helix-turn helix; Region: HTH_29; pfam13551
31964002644	Integrase core domain; Region: rve; pfam00665
31964002645	Integrase core domain; Region: rve_3; pfam13683
31964002646	HMMPfam hit to PF00665, Integrase, catalytic region, score 3.5E-36
31964002647	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964002648	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964002649	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964002650	The DNA repair protein O6-alkylguanine-DNA alkyltransferase (ATase; also known as AGT, AGAT and MGMT) reverses O6-alkylation DNA damage by transferring O6-alkyl adducts to an active site cysteine irreversibly, without inducing DNA strand breaks. ATases...; Region: ATase; cd06445
31964002651	DNA binding site [nucleotide binding]
31964002652	active site
31964002653	HMMPfam hit to PF01035,Methylated-DNA-[protein]-cysteine S-methyltransferase,score 1.3e-06
31964002654	1 probable transmembrane helix predicted for CMS0563 by TMHMM2.0 at aa 33-55
31964002655	Predicted helix-turn-helix motif with score 1638.000, SD 4.77 at aa 45-66, sequence RPVSHVARELGVSRQCAHRWVA
31964002656	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.6e-38
31964002657	phosphate transporter ATP-binding protein; Provisional; Region: PRK14241
31964002658	ATP-binding cassette domain of the phosphate transport system; Region: ABC_PstB_phosphate_transporter; cd03260
31964002659	Walker A/P-loop; other site
31964002660	ATP binding site [chemical binding]; other site
31964002661	Q-loop/lid; other site
31964002662	ABC transporter signature motif; other site
31964002663	Walker B; other site
31964002664	D-loop; other site
31964002665	H-loop/switch region; other site
31964002666	HMMPfam hit to PF00005, ABC transporter, score 6.2e-57
31964002667	PS00017 ATP/GTP-binding site motif A (P-loop).
31964002668	PS00211 ABC transporters family signature.
31964002669	Anti-sigma-K factor rskA; Region: RskA; pfam10099
31964002670	1 probable transmembrane helix predicted for CMS0566 by TMHMM2.0 at aa 131-153
31964002671	RNA polymerase sigma factor SigK; Reviewed; Region: PRK09646
31964002672	Sigma-70 region 2; Region: Sigma70_r2; pfam04542
31964002673	Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs). A SF is a dissociable subunit of RNA polymerase, it directs bacterial or...; Region: Sigma70_r4; cd06171
31964002674	DNA binding residues [nucleotide binding]
31964002675	HMMPfam hit to PF04545, Sigma-70 region 4, score 9.7e-15
31964002676	HMMPfam hit to PF04542, Sigma-70 region 2, score 6.4e-20
31964002677	HMMPfam hit to PF01757, Acyltransferase 3, score 2e-05
31964002678	8 probable transmembrane helices predicted for CMS0569 by TMHMM2.0 at aa 30-52, 59-81, 101-123, 130-152,186-208, 213-235, 250-272 and 279-301
31964002679	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely...; Region: SGNH_hydrolase; cd00229
31964002680	active site
31964002681	catalytic triad [active]
31964002682	oxyanion hole [active]
31964002683	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964002684	1 probable transmembrane helix predicted for CMS0570 by TMHMM2.0 at aa 21-43
31964002685	Membrane proteins related to metalloendopeptidases [Cell envelope biogenesis, outer membrane]; Region: NlpD; COG0739
31964002686	Peptidase family M23; Region: Peptidase_M23; pfam01551
31964002687	HMMPfam hit to PF01551, Peptidase M23B, score 2.2e-37
31964002688	2 probable transmembrane helices predicted for CMS0574 by TMHMM2.0 at aa 7-24 and 28-45
31964002689	3 probable transmembrane helices predicted for CMS0575 by TMHMM2.0 at aa 13-35, 216-235 and 242-264
31964002690	Excalibur calcium-binding domain; Region: Excalibur; pfam05901
31964002691	HMMPfam hit to PF05901, Excalibur, score 4.8e-10
31964002692	1 probable transmembrane helix predicted for CMS0577 by TMHMM2.0 at aa 13-35
31964002693	leucine-zipper of insertion element IS481; Region: LZ_Tnp_IS481; pfam13011
31964002694	Winged helix-turn helix; Region: HTH_29; pfam13551
31964002695	Integrase core domain; Region: rve; pfam00665
31964002696	Integrase core domain; Region: rve_3; pfam13683
31964002697	HMMPfam hit to PF00665, Integrase, catalytic region, score 8e-39
31964002698	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964002699	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964002700	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964002701	Aldose 1-epimerase, similar to Escherichia coli YihR; Region: Aldose_epim_Ec_YihR; cd09022
31964002702	active site
31964002703	catalytic residues [active]
31964002704	HMMPfam hit to PF01263, Aldose 1-epimerase, score 8.5e-37
31964002705	DNA-binding transcriptional regulator AgaR; Provisional; Region: PRK09802
31964002706	DeoR-like helix-turn-helix domain; Region: HTH_DeoR; cl17531
31964002707	DeoR C terminal sensor domain; Region: DeoRC; pfam00455
31964002708	HMMPfam hit to PF00455, Bacterial regulatory protein, DeoR, score 5.4e-64
31964002709	PS00894 Bacterial regulatory proteins, deoR family signature.
31964002710	HIT family: HIT (Histidine triad) proteins, named for a motif related to the sequence HxHxH/Qxx (x, a hydrophobic amino acid), are a superfamily of nucleotide hydrolases and transferases, which act on the alpha-phosphate of ribonucleotides. On the basis...; Region: HIT_like; cl00228
31964002711	Galactose-1-phosphate uridylyltransferase [Energy production and conversion]; Region: GalT; COG1085
31964002712	nucleotide binding site/active site [active]
31964002713	HIT family signature motif; other site
31964002714	catalytic residue [active]
31964002715	HMMPfam hit to PF01087, Galactose-1-phosphate uridyl transferase, N-terminal, score 4.7e-11
31964002716	PS00117 Galactose-1-phosphate uridyl transferase family 1 active site signature.
31964002717	HMMPfam hit to PF02744, Galactose-1-phosphate uridyl transferase, C-terminal, score 1.2e-08
31964002718	Galactokinase [Carbohydrate transport and metabolism]; Region: GalK; COG0153
31964002719	Galactokinase galactose-binding signature; Region: GalKase_gal_bdg; pfam10509
31964002720	GHMP kinases C terminal; Region: GHMP_kinases_C; pfam08544
31964002721	PS00106 Galactokinase signature.
31964002722	HMMPfam hit to PF00288, GHMP kinase, score 2.2e-41
31964002723	PS00627 GHMP kinases  ATP-binding domain.
31964002724	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cd04301
31964002725	Coenzyme A binding pocket [chemical binding]; other site
31964002726	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 9.2e-05
31964002727	Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only]; Region: PaaY; COG0663
31964002728	Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E. coli paaY protein, and similar proteins. CAs are zinc-containing enzymes that catalyze the reversible hydration of carbon...; Region: LbH_gamma_CA_like; cd04645
31964002729	trimer interface [polypeptide binding]; other site
31964002730	putative metal binding site [ion binding]; other site
31964002731	HMMPfam hit to PF00132, Bacterial transferase hexapeptide repeat, score 33
31964002732	HMMPfam hit to PF00132, Bacterial transferase hexapeptide repeat, score 11
31964002733	HMMPfam hit to PF00132, Bacterial transferase hexapeptide repeat, score 0.69
31964002734	bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional; Region: PRK14193
31964002735	Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain; Region: THF_DHG_CYH; pfam00763
31964002736	NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase; Region: NAD_bind_m-THF_DH_Cyclohyd; cd01080
31964002737	homodimer interface [polypeptide binding]; other site
31964002738	NADP binding site [chemical binding]; other site
31964002739	substrate binding site [chemical binding]; other site
31964002740	HMMPfam hit to PF02882, Tetrahydrofolate dehydrogenase/cyclohydrolase, score 2.2e-84
31964002741	HMMPfam hit to PF00763, Tetrahydrofolate dehydrogenase/cyclohydrolase, score 3.3e-49
31964002742	serine hydroxymethyltransferase; Reviewed; Region: glyA; PRK00011
31964002743	Serine-glycine hydroxymethyltransferase (SHMT). This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). SHMT carries out interconversion of serine and glycine; it catalyzes the transfer of hydroxymethyl...; Region: SHMT; cd00378
31964002744	dimer interface [polypeptide binding]; other site
31964002745	active site
31964002746	glycine-pyridoxal phosphate binding site [chemical binding]; other site
31964002747	folate binding site [chemical binding]; other site
31964002748	HMMPfam hit to PF00464, Glycine hydroxymethyltransferase, score 1.9e-225
31964002749	Alpha amylase catalytic domain family; Region: AmyAc_family; cl07893
31964002750	Alpha amylase catalytic domain family; Region: AmyAc_family; cl07893
31964002751	2 probable transmembrane helices predicted for CMS0588 by TMHMM2.0 at aa 19-41 and 46-65
31964002752	Bacterial regulatory helix-turn-helix protein, lysR family; Region: HTH_1; pfam00126
31964002753	aminoethylphosphonate catabolism associated LysR family transcriptional regulator; Region: phn_lysR; TIGR03339
31964002754	The substrate binding domain of LysR-type transcriptional regulators (LTTRs), a member of the type 2 periplasmic binding fold protein superfamily; Region: PBP2_LTTR_substrate; cl11398
31964002755	dimerization interface [polypeptide binding]; other site
31964002756	HMMPfam hit to PF03466, LysR, substrate-binding,score 1.4e-31
31964002757	HMMPfam hit to PF00126, Bacterial regulatory protein, LysR, score 7e-20
31964002758	PS00044 Bacterial regulatory proteins, lysR family signature.
31964002759	Predicted helix-turn-helix motif with score 2278.000, SD 6.95 at aa 17-38, sequence RSFTQAAARLGISQPTVSQQVR
31964002760	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
31964002761	H+ Antiporter protein; Region: 2A0121; TIGR00900
31964002762	putative substrate translocation pore; other site
31964002763	HMMPfam hit to PF05977, Bacterial protein of unknown function DUF894, score 2.4e-09
31964002764	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964002765	9 probable transmembrane helices predicted for tmhmm2embl_unknown_000001_618168_619634 by TMHMM2.0 at aa 69-91, 112-134, 183-205, 243-265, 275-297, 304-326,330-352, 365-387 and 392-414
31964002766	Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols. AKRs are present in all phyla and are of importance to both health and industrial...; Region: Aldo_ket_red; cd06660
31964002767	Aldo/keto reductase family; Region: Aldo_ket_red; pfam00248
31964002768	active site
31964002769	catalytic tetrad [active]
31964002770	HMMPfam hit to PF00248, Aldo/keto reductase, score 1.1e-58
31964002771	Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to...; Region: HTH_ARSR; cd00090
31964002772	putative DNA binding site [nucleotide binding]; other site
31964002773	putative Zn2+ binding site [ion binding]; other site
31964002774	Helix-turn-helix diphteria tox regulatory element; Region: HTH_DTXR; smart00529
31964002775	Iron dependent repressor, metal binding and dimerisation domain; Region: Fe_dep_repr_C; pfam02742
31964002776	FeoA domain; Region: FeoA; cl00838
31964002777	HMMPfam hit to PF01325, Iron dependent repressor,score 2.3e-19
31964002778	Predicted helix-turn-helix motif with score 1168.000, SD 3.17 at aa 28-49, sequence MTVSRLAERLGIRPATASDGIR
31964002779	HMMPfam hit to PF02742, Iron dependent repressor,score 6.1e-35
31964002780	Mn2+ and Fe2+ transporters of the NRAMP family [Inorganic ion transport and metabolism]; Region: MntH; cl15845
31964002781	Natural resistance-associated macrophage protein; Region: Nramp; pfam01566
31964002782	11 probable transmembrane helices predicted for CMS0593 by TMHMM2.0 at aa 20-42, 46-68, 99-121, 125-147,156-178, 198-217, 246-268, 283-305, 329-346, 351-373 and 393-415
31964002783	HMMPfam hit to PF01566, Natural resistance-associated macrophage protein, score 8.6e-136
31964002784	Arabinose efflux permease [Carbohydrate transport and metabolism]; Region: AraJ; COG2814
31964002785	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
31964002786	HMMPfam hit to PF00083, General substrate transporter, score 0.00019
31964002787	12 probable transmembrane helices predicted for CMS0595 by TMHMM2.0 at aa 34-56, 76-98, 105-127, 131-153,160-182, 192-214, 247-269, 284-306, 313-330, 334-356,373-395 and 400-422
31964002788	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964002789	formyltetrahydrofolate deformylase; Reviewed; Region: purU; PRK06027
31964002790	ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme; Region: ACT; cl09141
31964002791	Formyltetrahydrofolate deformylase (Formyl-FH4 hydrolase), C-terminal hydrolase domain; Region: FMT_core_Formyl-FH4-Hydrolase_C; cd08648
31964002792	putative active site [active]
31964002793	putative substrate binding site [chemical binding]; other site
31964002794	putative cosubstrate binding site; other site
31964002795	catalytic site [active]
31964002796	HMMPfam hit to PF00551, Formyl transferase,N-terminal, score 8.6e-35
31964002797	Peptidase inhibitor I9; Region: Inhibitor_I9; pfam05922
31964002798	Peptidase S8 family domain, uncharacterized subfamily 3; Region: Peptidases_S8_3; cd04852
31964002799	active site
31964002800	catalytic triad [active]
31964002801	PA_subtilisin_like: Protease-associated domain containing subtilisin-like proteases. This group contains various PA domain-containing subtilisin-like proteases including melon cucumisin, Arabidopsis thaliana Ara12, a nodule specific serine protease from...; Region: PA_subtilisin_like; cd02120
31964002802	PA/protease or protease-like domain interface [polypeptide binding]; other site
31964002803	Peptidase S8 family domain in Vpr-like proteins; Region: Peptidases_S8_subtilisin_Vpr-like; cd07474
31964002804	HMMPfam hit to PF00082, Peptidase S8 and S53,subtilisin, kexin, sedolisin, score 2.1e-11
31964002805	HMMPfam hit to PF02225, Protease-associated PA,score 5e-21
31964002806	PS00136 Serine proteases, subtilase family,aspartic acid active site.
31964002807	HMMPfam hit to PF05922, Proteinase inhibitor I9,subtilisin propeptide, score 3.6e-07
31964002808	Peptidase inhibitor I9; Region: Inhibitor_I9; pfam05922
31964002809	Peptidase domain in the S8 and S53 families; Region: Peptidases_S8_S53; cl10459
31964002810	active site
31964002811	catalytic residues [active]
31964002812	PA_subtilisin_like: Protease-associated domain containing subtilisin-like proteases. This group contains various PA domain-containing subtilisin-like proteases including melon cucumisin, Arabidopsis thaliana Ara12, a nodule specific serine protease from...; Region: PA_subtilisin_like; cd02120
31964002813	PA/protease or protease-like domain interface [polypeptide binding]; other site
31964002814	Peptidase domain in the S8 and S53 families; Region: Peptidases_S8_S53; cl10459
31964002815	catalytic residues [active]
31964002816	HMMPfam hit to PF00082, Peptidase S8 and S53,subtilisin, kexin, sedolisin, score 4.4e-14
31964002817	PS00138 Serine proteases, subtilase family, serine active site.
31964002818	HMMPfam hit to PF02225, Protease-associated PA,score 2.4e-18
31964002819	PS00136 Serine proteases, subtilase family,aspartic acid active site.
31964002820	HMMPfam hit to PF05922, Proteinase inhibitor I9,subtilisin propeptide, score 4e-09
31964002821	isocitrate dehydrogenase; Validated; Region: PRK08299
31964002822	HMMPfam hit to PF00180, Isocitrate/isopropylmalate dehydrogenase, score 7.1e-102
31964002823	PS00470 Isocitrate and isopropylmalate dehydrogenases signature.
31964002824	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cd04301
31964002825	Coenzyme A binding pocket [chemical binding]; other site
31964002826	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 1.2e-15
31964002827	Homeodomain-like domain; Region: HTH_23; cl17451
31964002828	Winged helix-turn helix; Region: HTH_29; pfam13551
31964002829	Integrase core domain; Region: rve; pfam00665
31964002830	Integrase core domain; Region: rve_3; pfam13683
31964002831	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.6e-38
31964002832	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964002833	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964002834	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964002835	PTS_IIA, PTS system, fructose/mannitol specific IIA subunit. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. This...; Region: PTS_IIA_fru; cd00211
31964002836	active site
31964002837	phosphorylation site [posttranslational modification]
31964002838	HMMPfam hit to PF00359,Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2, score 4.6e-31
31964002839	PTS_IIB_ascorbate: subunit IIB of enzyme II (EII) of the L-ascorbate-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS). In this system, EII is an L-ascorbate-specific permease with two cytoplasmic subunits (IIA and IIB) and a...; Region: PTS_IIB_ascorbate; cd05563
31964002840	active site
31964002841	P-loop; other site
31964002842	phosphorylation site [posttranslational modification]
31964002843	HMMPfam hit to PF02302, Phosphotransferase system,lactose/cellobiose-specific IIB subunit, score 2.1e-10
31964002844	8 probable transmembrane helices predicted for CMS0604 by TMHMM2.0 at aa 12-34, 49-64, 77-99, 114-136,148-170, 214-233, 246-268 and 278-300
31964002845	Helix-Turn-Helix DNA binding domain of transcription regulators from the MerR superfamily; Region: HTH_MerR-SF; cl02600
31964002846	MerR HTH family regulatory protein; Region: MerR_1; pfam13411
31964002847	DNA binding residues [nucleotide binding]
31964002848	HMMPfam hit to PF00376, Bacterial regulatory protein, MerR, score 5.3e-08
31964002849	Predicted helix-turn-helix motif with score 1974.000, SD 5.91 at aa 7-28, sequence IRITELAEATGVAPATVKYYVR
31964002850	phosphoglucomutase-2-like protein; Provisional; Region: PTZ00150
31964002851	This CD includes PGM2 (phosphoglucomutase 2) and PGM2L1 (phosphoglucomutase 2-like 1). The mammalian PGM2 is thought to be a phosphopentomutase that catalyzes the conversion of the nucleoside breakdown products, ribose-1-phosphate and...; Region: PGM2; cd05799
31964002852	active site
31964002853	substrate binding site [chemical binding]; other site
31964002854	metal binding site [ion binding]; metal-binding site
31964002855	HMMPfam hit to PF00408,Phosphoglucomutase/phosphomannomutase C terminal, score 0.00038
31964002856	HMMPfam hit to PF02880,Phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain III, score 0.21
31964002857	HMMPfam hit to PF02879,Phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain II, score 4.5e-05
31964002858	HMMPfam hit to PF02878,Phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I, score 1.7e-52
31964002859	PS00710 Phosphoglucomutase and phosphomannomutase phosphoserine signature.
31964002860	purine nucleoside phosphorylase; Provisional; Region: PRK08202
31964002861	HMMPfam hit to PF00896, Purine phosphorylase,family 2, score 2e-52
31964002862	flavoprotein disulfide reductase; Reviewed; Region: PRK07845
31964002863	NAD(P)-binding Rossmann-like domain; Region: NAD_binding_8; cl17500
31964002864	Pyridine nucleotide-disulphide oxidoreductase; Region: Pyr_redox; pfam00070
31964002865	Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain; Region: Pyr_redox_dim; pfam02852
31964002866	HMMPfam hit to PF00070, FAD-dependent pyridine nucleotide-disulphide oxidoreductase, score 1.2e-63
31964002867	HMMPfam hit to PF02852, Pyridine nucleotide-disulphide oxidoreductase dimerisation region,score 9e-22
31964002868	acetyl-CoA carboxylase biotin carboxylase subunit; Validated; Region: PRK08591
31964002869	Carbamoyl-phosphate synthase L chain, N-terminal domain; Region: CPSase_L_chain; pfam00289
31964002870	Carbamoyl-phosphate synthase L chain, ATP binding domain; Region: CPSase_L_D2; pfam02786
31964002871	Biotin carboxylase C-terminal domain; Region: Biotin_carb_C; smart00878
31964002872	The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase; Region: biotinyl_domain; cd06850
31964002873	carboxyltransferase (CT) interaction site; other site
31964002874	biotinylation site [posttranslational modification]; other site
31964002875	HMMPfam hit to PF00364, Biotin/lipoyl attachment,score 1.2e-17
31964002876	PS00188 Biotin-requiring enzymes attachment site.
31964002877	HMMPfam hit to PF02785, Biotin carboxylase,C-terminal, score 3.3e-55
31964002878	HMMPfam hit to PF02786, Carbamoyl-phosphate synthase L chain, ATP-binding, score 2e-91
31964002879	PS00867 Carbamoyl-phosphate synthase subdomain signature 2.
31964002880	HMMPfam hit to PF00289, Carbamoyl-phosphate synthetase large chain, N-terminal, score 4.3e-46
31964002881	Maf-like protein; Region: Maf; pfam02545
31964002882	Nucleotide binding protein Maf. Maf has been implicated in inhibition of septum formation in eukaryotes, bacteria and archaea, but homologs in B.subtilis and S.cerevisiae are nonessential for cell division. Maf has been predicted to be a nucleotide- or...; Region: Maf; cd00555
31964002883	active site
31964002884	dimer interface [polypeptide binding]; other site
31964002885	HMMPfam hit to PF02545, Maf-like protein, score 5.4e-48
31964002886	TRAM domain; Region: TRAM; pfam01938
31964002887	SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis]; Region: TrmA; COG2265
31964002888	HMMPfam hit to PF01938, Deoxyribonuclease/rho motif-related TRAM, score 8.6e-11
31964002889	transcriptional regulator NarP; Provisional; Region: PRK10403
31964002890	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
31964002891	active site
31964002892	phosphorylation site [posttranslational modification]
31964002893	intermolecular recognition site; other site
31964002894	C-terminal DNA-binding domain of LuxR-like proteins. This domain contains a helix-turn-helix motif and binds DNA. Proteins belonging to this group are response regulators; some act as transcriptional activators, others as transcriptional repressors. Many...; Region: LuxR_C_like; cl17315
31964002895	DNA binding residues [nucleotide binding]
31964002896	HMMPfam hit to PF00072, Response regulator receiver, score 1.3e-09
31964002897	Predicted helix-turn-helix motif with score 1048.000, SD 2.76 at aa 191-212, sequence LPLKLVAQQLGIANSTAREYLD
31964002898	leucine-zipper of insertion element IS481; Region: LZ_Tnp_IS481; pfam13011
31964002899	Winged helix-turn helix; Region: HTH_29; pfam13551
31964002900	Integrase core domain; Region: rve; pfam00665
31964002901	Integrase core domain; Region: rve_3; pfam13683
31964002902	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.8e-38
31964002903	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 10-31, sequence AGPARLAPVTGVPSRTISRILR
31964002904	4 probable transmembrane helices predicted for CMS0615 by TMHMM2.0 at aa 142-164, 169-191, 220-242 and 255-277
31964002905	HMMPfam hit to PF02518, ATP-binding region,ATPase-like, score 6.5e-10
31964002906	6 probable transmembrane helices predicted for CMS0616 by TMHMM2.0 at aa 7-29, 34-52, 59-81, 91-108,113-130 and 135-157
31964002907	Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta) [Lipid metabolism]; Region: COG4799
31964002908	malonate decarboxylase subunit beta; Reviewed; Region: PRK07189; cl17682
31964002909	Acetyl-CoA carboxylase alpha subunit [Lipid metabolism]; Region: AccA; cl17345
31964002910	HMMPfam hit to PF01039, Carboxyl transferase, score 2.1e-273
31964002911	Biotin-(acetyl-CoA carboxylase) ligase [Coenzyme metabolism]; Region: BirA; COG0340
31964002912	Biotin/lipoate A/B protein ligase family; Region: BPL_LplA_LipB; pfam03099
31964002913	Biotin protein ligase C terminal domain; Region: BPL_C; pfam02237
31964002914	HMMPfam hit to PF03099, Biotin/lipoate A/B protein ligase, score 8.1e-21
31964002915	HMMPfam hit to PF02237, Biotin protein ligase,C-terminal, score 2.1e-06
31964002916	Bacterial PH domain; Region: DUF304; pfam03703
31964002917	2 probable transmembrane helices predicted for CMS0620 by TMHMM2.0 at aa 89-111 and 118-140
31964002918	Predicted membrane protein [Function unknown]; Region: COG2246
31964002919	GtrA-like protein; Region: GtrA; pfam04138
31964002920	HMMPfam hit to PF04138, GtrA-like protein, score 6.7e-26
31964002921	4 probable transmembrane helices predicted for CMS0621 by TMHMM2.0 at aa 7-29, 34-56, 77-99 and 109-127
31964002922	phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed; Region: PRK06019
31964002923	ATP-grasp domain; Region: ATP-grasp; pfam02222
31964002924	HMMPfam hit to PF02222, ATP-dependent carboxylate-amine ligase-like, ATP-grasp, score 6.7e-24
31964002925	AIR carboxylase; Region: AIRC; pfam00731
31964002926	HMMPfam hit to PF00731, 1-(5-Phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR) carboxylase, score 4.1e-83
31964002927	Transcriptional regulator [Transcription]; Region: LytR; COG1316
31964002928	3 probable transmembrane helices predicted for CMS0624 by TMHMM2.0 at aa 21-43, 58-77 and 98-120
31964002929	HMMPfam hit to PF03816, Cell envelope-related transcriptional attenuator, score 6.8e-27
31964002930	This family is most closely related to the GT1 family of glycosyltransferases. mtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the...; Region: GT1_mtfB_like; cd03809
31964002931	Glycosyltransferase [Cell envelope biogenesis, outer membrane]; Region: RfaG; COG0438
31964002932	HMMPfam hit to PF00534, Glycosyl transferase, group 1, score 7.6e-17
31964002933	Predicted helix-turn-helix motif with score 1186.000, SD 3.23 at aa 244-265, sequence VELAQVADEAGVDPSRVRSLGS
31964002934	ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane]; Region: TagH; COG1134
31964002935	ATP-binding cassette component of polysaccharide transport system; Region: ABC_KpsT_Wzt; cd03220
31964002936	Walker A/P-loop; other site
31964002937	ATP binding site [chemical binding]; other site
31964002938	Q-loop/lid; other site
31964002939	ABC transporter signature motif; other site
31964002940	Walker B; other site
31964002941	D-loop; other site
31964002942	H-loop/switch region; other site
31964002943	HMMPfam hit to PF00005, ABC transporter, score 6.6e-33
31964002944	PS00017 ATP/GTP-binding site motif A (P-loop).
31964002945	ABC-2 type transporter; Region: ABC2_membrane; pfam01061
31964002946	7 probable transmembrane helices predicted for CMS0627 by TMHMM2.0 at aa 50-72, 79-96, 129-151, 158-180,195-214, 221-243 and 256-278
31964002947	HMMPfam hit to PF01061, ABC-2, score 2.6e-17
31964002948	dTDP-6-deoxy-L-lyxo-4-hexulose reductase and related proteins, extended (e) SDRs; Region: dTDP_HR_like_SDR_e; cd05254
31964002949	RmlD substrate binding domain; Region: RmlD_sub_bind; pfam04321
31964002950	NADP binding site [chemical binding]; other site
31964002951	active site
31964002952	putative substrate binding site [chemical binding]; other site
31964002953	HMMPfam hit to PF04321, dTDP-4-dehydrorhamnose reductase, score 5.8e-67
31964002954	dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane]; Region: RfbB; COG1088
31964002955	dTDP-D-glucose 4,6-dehydratase, extended (e) SDRs; Region: dTDP_GD_SDR_e; cd05246
31964002956	NAD binding site [chemical binding]; other site
31964002957	substrate binding site [chemical binding]; other site
31964002958	homodimer interface [polypeptide binding]; other site
31964002959	active site
31964002960	HMMPfam hit to PF01370, NAD-dependent epimerase/dehydratase, score 9.9e-158
31964002961	PS00061 Short-chain dehydrogenases/reductases family signature.
31964002962	GtrA-like protein; Region: GtrA; pfam04138
31964002963	HMMPfam hit to PF04138, GtrA-like protein, score 1.7e-10
31964002964	4 probable transmembrane helices predicted for CMS0630 by TMHMM2.0 at aa 17-39, 49-71, 91-113 and 117-139
31964002965	dTDP-4-dehydrorhamnose 3,5-epimerase; Region: dTDP_sugar_isom; cl17405
31964002966	HMMPfam hit to PF00908, dTDP-4-dehydrorhamnose 3,5-epimerase related, score 1.3e-73
31964002967	G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase; Region: G1P_TT_short; cd02538
31964002968	glucose-1-phosphate thymidylyltransferase, short form; Region: rmlA; TIGR01207
31964002969	substrate binding site; other site
31964002970	tetramer interface; other site
31964002971	HMMPfam hit to PF00483, Nucleotidyl transferase,score 1.9e-99
31964002972	Glycosyltransferases involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane]; Region: WcaA; COG0463
31964002973	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold; Region: Glyco_tranf_GTA_type; cd00761
31964002974	active site
31964002975	HMMPfam hit to PF00535, Glycosyl transferase,family 2, score 1e-28
31964002976	Bacterial membrane protein YfhO; Region: YfhO; pfam09586
31964002977	13 probable transmembrane helices predicted for CMS0634 by TMHMM2.0 at aa 13-32, 98-120, 127-149, 154-173,186-208, 228-250, 263-285, 295-317, 324-346, 351-373,380-394, 404-423 and 443-465
31964002978	Predicted glycosyltransferases [General function prediction only]; Region: COG1216
31964002979	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold; Region: Glyco_tranf_GTA_type; cl11394
31964002980	active site
31964002981	HMMPfam hit to PF00535, Glycosyl transferase,family 2, score 1.4e-17
31964002982	undecaprenyl phosphate 4-deoxy-4-formamido-L-arabinose transferase; Provisional; Region: PRK10714
31964002983	Bacterial DPM1_like enzymes are related to eukaryotic DPM1; Region: DPM1_like_bac; cd04187
31964002984	Ligand binding site; other site
31964002985	Putative Catalytic site; other site
31964002986	DXD motif; other site
31964002987	2 probable transmembrane helices predicted for CMS0636 by TMHMM2.0 at aa 236-258 and 273-295
31964002988	HMMPfam hit to PF00535, Glycosyl transferase,family 2, score 3.4e-25
31964002989	12 probable transmembrane helices predicted for CMS0637 by TMHMM2.0 at aa 78-100, 107-129, 144-166,179-196, 200-217, 224-246, 251-268, 275-297, 317-339,344-361, 376-395 and 424-446
31964002990	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold; Region: Glyco_tranf_GTA_type; cl11394
31964002991	active site
31964002992	HMMPfam hit to PF00535, Glycosyl transferase,family 2, score 3.5e-20
31964002993	UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane]; Region: Glf; COG0562
31964002994	NAD(P)-binding Rossmann-like domain; Region: NAD_binding_8; pfam13450
31964002995	UDP-galactopyranose mutase; Region: GLF; pfam03275
31964002996	HMMPfam hit to PF03275, UDP-galactopyranose mutase,score 3e-118
31964002997	Glycosyltransferase like family 2; Region: Glyco_tranf_2_3; pfam13641
31964002998	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold; Region: Glyco_tranf_GTA_type; cl11394
31964002999	active site
31964003000	1 probable transmembrane helix predicted for CMS0641 by TMHMM2.0 at aa 32-54
31964003001	Predicted membrane protein [Function unknown]; Region: COG2246
31964003002	GtrA-like protein; Region: GtrA; pfam04138
31964003003	2 probable transmembrane helices predicted for CMS0642 by TMHMM2.0 at aa 7-29 and 84-106
31964003004	Lipid A core - O-antigen ligase and related enzymes [Cell envelope biogenesis, outer membrane]; Region: RfaL; COG3307
31964003005	O-Antigen ligase; Region: Wzy_C; pfam04932
31964003006	acyl-coenzyme A oxidase; Region: PLN02526
31964003007	Acyl-CoA dehydrogenase; Region: ACAD; cl09933
31964003008	active site
31964003009	Alpha-Mannosidase Binding Domain of Atg19/34; Region: ABD; cl15429
31964003010	mannose-6-phosphate isomerase; Provisional; Region: PRK15131
31964003011	Alpha-Mannosidase Binding Domain of Atg19/34; Region: ABD; cl15429
31964003012	HMMPfam hit to PF01238, Mannose-6-phosphate isomerase, type I, score 3.4e-53
31964003013	UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane]; Region: GalE; COG1087
31964003014	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
31964003015	NAD(P) binding site [chemical binding]; other site
31964003016	active site
31964003017	HMMPfam hit to PF01370, NAD-dependent epimerase/dehydratase, score 1.4e-87
31964003018	Homeodomain-like domain; Region: HTH_23; cl17451
31964003019	Winged helix-turn helix; Region: HTH_29; pfam13551
31964003020	Integrase core domain; Region: rve; pfam00665
31964003021	Integrase core domain; Region: rve_3; pfam13683
31964003022	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.6e-38
31964003023	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964003024	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964003025	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964003026	Transcription factor WhiB; Region: Whib; pfam02467
31964003027	HMMPfam hit to PF02467, Transcription factor WhiB,score 3.5e-37
31964003028	Predicted glycosyltransferases [General function prediction only]; Region: COG1216
31964003029	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold; Region: Glyco_tranf_GTA_type; cl11394
31964003030	active site
31964003031	HMMPfam hit to PF00535, Glycosyl transferase,family 2, score 3.5e-10
31964003032	11 probable transmembrane helices predicted for CMS0647 by TMHMM2.0 at aa 355-377, 384-406, 438-460,465-487, 522-544, 556-578, 627-649, 656-678, 688-710,717-739 and 904-926
31964003033	1 probable transmembrane helix predicted for CMS0648 by TMHMM2.0 at aa 13-35
31964003034	Minimal MMP-like domain found in a group of hypothetical proteins from alphaproteobacteria and actinobacteria; Region: MMP_TTHA0227_like_1; cd12954
31964003035	Protein of unknown function (DUF3499); Region: DUF3499; pfam12005
31964003036	phosphomannomutase/phosphoglucomutase; Reviewed; Region: manB; PRK09542
31964003037	The phosphomannomutase/phosphoglucomutase (PMM/PGM) bifunctional enzyme catalyzes the reversible conversion of 1-phospho to 6-phospho-sugars (e.g. between mannose-1-phosphate and mannose-6-phosphate or glucose-1-phosphate and glucose-6-phosphate) via a...; Region: PMM_PGM; cd03089
31964003038	active site
31964003039	substrate binding site [chemical binding]; other site
31964003040	metal binding site [ion binding]; metal-binding site
31964003041	HMMPfam hit to PF02878,Phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I, score 2.2e-36
31964003042	HMMPfam hit to PF02879,Phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain II, score 1.9e-36
31964003043	HMMPfam hit to PF02880,Phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain III, score 1.1e-15
31964003044	HMMPfam hit to PF00408,Phosphoglucomutase/phosphomannomutase C terminal, score 7.7e-07
31964003045	Transcriptional regulators CsoR (copper-sensitive operon repressor), RcnR, and FrmR, and related domains; this domain superfamily was previously known as DUF156; Region: CsoR-like_DUF156; cd10148
31964003046	putative homodimer interface [polypeptide binding]; other site
31964003047	putative homotetramer interface [polypeptide binding]; other site
31964003048	putative allosteric switch controlling residues; other site
31964003049	putative metal binding site [ion binding]; other site
31964003050	putative homodimer-homodimer interface [polypeptide binding]; other site
31964003051	HMMPfam hit to PF02583, Protein of unknown function DUF156, score 6.8e-22
31964003052	Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones. HMA domain...; Region: HMA; cl00207
31964003053	metal-binding site [ion binding]
31964003054	HMMPfam hit to PF00403, Heavy metal transport/detoxification protein, score 1.8e-10
31964003055	PS01047 Heavy-metal-associated domain.
31964003056	Cation transport ATPase [Inorganic ion transport and metabolism]; Region: ZntA; COG2217
31964003057	Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones. HMA domain...; Region: HMA; cd00371
31964003058	metal-binding site [ion binding]
31964003059	copper-(or silver)-translocating P-type ATPase; Region: ATPase-IB1_Cu; TIGR01511
31964003060	E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122
31964003061	Soluble P-type ATPase [General function prediction only]; Region: COG4087
31964003062	HMMPfam hit to PF00403, Heavy metal transport/detoxification protein, score 1.8e-11
31964003063	PS01047 Heavy-metal-associated domain.
31964003064	8 probable transmembrane helices predicted for CMS0654 by TMHMM2.0 at aa 178-197, 202-219, 239-258,278-300, 434-456, 466-488, 776-795 and 799-818
31964003065	HMMPfam hit to PF00122, E1-E2 ATPase-associated region, score 2e-85
31964003066	PS00154 E1-E2 ATPases phosphorylation site.
31964003067	PS01229 Hypothetical cof family signature 2.
31964003068	S-adenosyl-L-homocysteine hydrolase; Provisional; Region: PRK05476
31964003069	S-Adenosylhomocysteine Hydrolase, NAD-binding and catalytic domains; Region: SAHH; cd00401
31964003070	homotetramer interface [polypeptide binding]; other site
31964003071	ligand binding site [chemical binding]; other site
31964003072	catalytic site [active]
31964003073	NAD binding site [chemical binding]; other site
31964003074	HMMPfam hit to PF05221, S-adenosyl-L-homocysteine hydrolase, score 6.7e-154
31964003075	PS00738 S-adenosyl-L-homocysteine hydrolase signature 1.
31964003076	HMMPfam hit to PF00670, S-adenosyl-L-homocysteine hydrolase, score 8.4e-100
31964003077	PS00739 S-adenosyl-L-homocysteine hydrolase signature 2.
31964003078	RDD family; Region: RDD; pfam06271
31964003079	HMMPfam hit to PF06271, RDD, score 2.8e-19
31964003080	3 probable transmembrane helices predicted for CMS0656 by TMHMM2.0 at aa 37-59, 69-91 and 126-148
31964003081	4 probable transmembrane helices predicted for CMS0658 by TMHMM2.0 at aa 57-79, 106-128, 149-171 and 181-203
31964003082	Glycosyl hydrolase family 3 N terminal domain; Region: Glyco_hydro_3; pfam00933
31964003083	Beta-glucosidase-related glycosidases [Carbohydrate transport and metabolism]; Region: BglX; COG1472
31964003084	PA14 domain; Region: PA14; cl08459
31964003085	Glycosyl hydrolase family 3 C-terminal domain; Region: Glyco_hydro_3_C; pfam01915
31964003086	Fibronectin type III-like domain; Region: Fn3-like; pfam14310
31964003087	HMMPfam hit to PF01915, Glycoside hydrolase, family 3, C-terminal, score 3.4e-82
31964003088	HMMPfam hit to PF00933, Glycoside hydrolase, family 3, N-terminal, score 3e-80
31964003089	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
31964003090	Major Facilitator Superfamily; Region: MFS_1; pfam07690
31964003091	11 probable transmembrane helices predicted for CMS0660 by TMHMM2.0 at aa 52-74, 86-108, 123-140, 145-167,182-204, 211-230, 265-287, 300-322, 332-354, 361-383 and 416-438
31964003092	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964003093	PS00216 Sugar transport proteins signature 1.
31964003094	Transcriptional regulator [Transcription]; Region: AcrR; COG1309
31964003095	Bacterial regulatory proteins, tetR family; Region: TetR_N; pfam00440
31964003096	HMMPfam hit to PF00440, Bacterial regulatory protein, TetR, score 2.7e-17
31964003097	Predicted helix-turn-helix motif with score 1494.000, SD 4.28 at aa 36-57, sequence SSLQEIADAVGISKAGVLHYFE
31964003098	Uncharacterized conserved protein (some members contain a von Willebrand factor type A (vWA) domain) [General function prediction only]; Region: COG1721
31964003099	Protein of unknown function DUF58; Region: DUF58; pfam01882
31964003100	HMMPfam hit to PF01882, Protein of unknown function DUF58, score 2.2e-29
31964003101	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.6e-38
31964003102	Predicted helix-turn-helix motif with score 1638.000, SD 4.77 at aa 39-60, sequence RPVSHVARELGVSRQCAHRWVA
31964003103	MoxR-like ATPases [General function prediction only]; Region: COG0714
31964003104	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
31964003105	Walker A motif; other site
31964003106	ATP binding site [chemical binding]; other site
31964003107	Walker B motif; other site
31964003108	HMMPfam hit to PF07728, ATPase family associated with various cellular activities (AAA)
31964003109	HMMPfam hit to PF07726, ATPase family associated with various cellular activities (AAA)
31964003110	Domain of unknown function (DUF4350); Region: DUF4350; pfam14258
31964003111	1 probable transmembrane helix predicted for CMS0665 by TMHMM2.0 at aa 26-48
31964003112	Domain of unknown function (DUF4129); Region: DUF4129; pfam13559
31964003113	1 probable transmembrane helix predicted for CMS0666 by TMHMM2.0 at aa 71-93
31964003114	Membrane domain of glycerophosphoryl diester phosphodiesterase; Region: GPDPase_memb; cl01974
31964003115	6 probable transmembrane helices predicted for CMS0667 by TMHMM2.0 at aa 108-130, 145-167, 204-226,236-258, 291-313 and 354-376
31964003116	Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription]; Region: OmpR; COG0745
31964003117	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
31964003118	active site
31964003119	phosphorylation site [posttranslational modification]
31964003120	intermolecular recognition site; other site
31964003121	dimerization interface [polypeptide binding]; other site
31964003122	Effector domain of response regulator. Bacteria and certain eukaryotes like protozoa and higher plants use two-component signal transduction systems to detect and respond to changes in the environment. The system consists of a sensor histidine kinase and...; Region: trans_reg_C; cd00383
31964003123	DNA binding site [nucleotide binding]
31964003124	HMMPfam hit to PF00072, Response regulator receiver, score 7.8e-39
31964003125	HMMPfam hit to PF00486, Transcriptional regulatory protein, C-terminal, score 1e-23
31964003126	heavy metal sensor kinase; Region: cztS_silS_copS; TIGR01386
31964003127	Histidine kinase, Adenylyl cyclase, Methyl-accepting protein, and Phosphatase (HAMP) domain. HAMP is a signaling domain which occurs in a wide variety of signaling proteins, many of which are bacterial. The HAMP domain consists of two alpha helices...; Region: HAMP; cd06225
31964003128	dimerization interface [polypeptide binding]; other site
31964003129	Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via...; Region: HisKA; cd00082
31964003130	dimer interface [polypeptide binding]; other site
31964003131	phosphorylation site [posttranslational modification]
31964003132	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
31964003133	ATP binding site [chemical binding]; other site
31964003134	Mg2+ binding site [ion binding]; other site
31964003135	G-X-G motif; other site
31964003136	2 probable transmembrane helices predicted for CMS0669 by TMHMM2.0 at aa 20-42 and 199-221
31964003137	HMMPfam hit to PF00672, Histidine kinase, HAMP region, score 1.9e-17
31964003138	HMMPfam hit to PF00512, Histidine kinase A,N-terminal, score 7.9e-17
31964003139	HMMPfam hit to PF02518, ATP-binding region,ATPase-like, score 1.9e-37
31964003140	lipoprotein LpqB; Provisional; Region: PRK13615
31964003141	Sporulation and spore germination; Region: Germane; pfam10646
31964003142	Predicted amidophosphoribosyltransferases [General function prediction only]; Region: ComFC; COG1040
31964003143	Phosphoribosyl transferase (PRT)-type I domain; Region: PRTases_typeI; cd06223
31964003144	active site
31964003145	HMMPfam hit to PF00156, Phosphoribosyltransferase,score 0.00017
31964003146	PS00103 Purine/pyrimidine phosphoribosyl transferases signature.
31964003147	RaiA ("ribosome-associated inhibitor A", also known as Protein Y (PY), YfiA, and SpotY,  is a stress-response protein that binds the ribosomal subunit interface and arrests translation by interfering with aminoacyl-tRNA binding to the ribosomal...; Region: RaiA; cd00552
31964003148	30S subunit binding site; other site
31964003149	HMMPfam hit to PF02482, Sigma 54 modulation protein/ribosomal protein S30EA, score 1.2e-14
31964003150	preprotein translocase subunit SecA; Reviewed; Region: PRK12904
31964003151	DEAD/DEAH box helicase; Region: DEAD; pfam00270
31964003152	SecA preprotein cross-linking domain; Region: SecA_PP_bind; smart00958
31964003153	HMMPfam hit to PF07517, SecA DEAD-like, score 1.3e-149
31964003154	HMMPfam hit to PF01043, SecA preprotein cross-linking region, score 4.1e-60
31964003155	PS01312 Protein secA signatures.
31964003156	HMMPfam hit to PF07516, SecA Wing and Scaffold,score 2.3e-90
31964003157	1 probable transmembrane helix predicted for CMS0676 by TMHMM2.0 at aa 21-39
31964003158	Antiactivator of flagellar biosynthesis FleN, an ATPase [Cell motility]; Region: flhG; COG0455
31964003159	Signal transduction histidine kinase; Region: H_kinase_N; pfam12282
31964003160	PAS fold; Region: PAS_4; pfam08448
31964003161	Signal transduction histidine kinase [Signal transduction mechanisms]; Region: COG3920
31964003162	Histidine kinase; Region: HisKA_2; pfam07568
31964003163	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
31964003164	ATP binding site [chemical binding]; other site
31964003165	Mg2+ binding site [ion binding]; other site
31964003166	G-X-G motif; other site
31964003167	HMMPfam hit to PF07568, Histidine kinase,dimerisation/phosphoacceptor, score 1.8e-28
31964003168	HMMPfam hit to PF02518, ATP-binding region,ATPase-like, score 2.1e-20
31964003169	Transcription factor WhiB; Region: Whib; pfam02467
31964003170	HMMPfam hit to PF02467, Transcription factor WhiB,score 4.1e-34
31964003171	4 probable transmembrane helices predicted for CMS0681 by TMHMM2.0 at aa 2-24, 37-59, 64-83 and 93-115
31964003172	Peroxiredoxin [Posttranslational modification, protein turnover, chaperones]; Region: AhpC; COG0450
31964003173	Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing...; Region: PRX_BCP; cd03017
31964003174	catalytic triad [active]
31964003175	HMMPfam hit to PF00578, Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen, score 1.7e-28
31964003176	Transcriptional regulators, similar to M. xanthus CarD [Transcription]; Region: COG1329
31964003177	HMMPfam hit to PF02559, Transcription factor CarD,score 4e-25
31964003178	1 probable transmembrane helix predicted for CMS0685 by TMHMM2.0 at aa 28-50
31964003179	Protein of unknown function (DUF1524); Region: DUF1524; pfam07510
31964003180	1 probable transmembrane helix predicted for CMS0686 by TMHMM2.0 at aa 13-35
31964003181	L-asparagine permease; Provisional; Region: PRK15049
31964003182	HMMPfam hit to PF00324, Amino acid permease-associated region, score 4.8e-128
31964003183	12 probable transmembrane helices predicted for CMS0688 by TMHMM2.0 at aa 21-38, 42-64, 100-122, 127-149,158-180, 208-230, 251-273, 293-315, 345-367, 371-393,413-435 and 439-461
31964003184	PS00218 Amino acid permeases signature.
31964003185	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964003186	H+ Antiporter protein; Region: 2A0121; TIGR00900
31964003187	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
31964003188	putative substrate translocation pore; other site
31964003189	HMMPfam hit to PF05977, Bacterial protein of unknown function DUF894, score 6.4e-10
31964003190	10 probable transmembrane helices predicted for CMS0690 by TMHMM2.0 at aa 49-71, 81-100, 107-126, 156-189,224-246, 256-278, 285-304, 308-330, 343-365 and 375-397
31964003191	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964003192	helix_turn_helix multiple antibiotic resistance protein; Region: HTH_MARR; smart00347
31964003193	MarR family; Region: MarR_2; pfam12802
31964003194	HMMPfam hit to PF01047, Bacterial regulatory protein, MarR, score 5.7e-23
31964003195	Homeodomain-like domain; Region: HTH_23; pfam13384
31964003196	Integrase core domain; Region: rve; pfam00665
31964003197	Integrase core domain; Region: rve_3; pfam13683
31964003198	Predicted helix-turn-helix motif with score 1316.000, SD 3.67 at aa 25-46, sequence WPVRRAAERFQCSPATASRWAR
31964003199	HMMPfam hit to PF00665, Integrase, catalytic region, score 3.7e-42
31964003200	Methyltransferase domain; Region: Methyltransf_31; pfam13847
31964003201	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
31964003202	S-adenosylmethionine binding site [chemical binding]; other site
31964003203	Cytochrome b subunit of the bc complex [Energy production and conversion]; Region: QcrB; COG1290
31964003204	heme bH binding site [chemical binding]; other site
31964003205	intrachain domain interface; other site
31964003206	heme bL binding site [chemical binding]; other site
31964003207	interchain domain interface [polypeptide binding]; other site
31964003208	Cytochrome b(N-terminal)/b6/petB; Region: Cytochrom_B_N_2; pfam13631
31964003209	Qo binding site; other site
31964003210	8 probable transmembrane helices predicted for CMS0695 by TMHMM2.0 at aa 55-77, 122-144, 153-175,221-243, 276-298, 343-365, 385-407 and 422-441
31964003211	HMMPfam hit to PF00033, Cytochrome b/b6,N-terminal, score 1.6e-25
31964003212	Rieske Fe-S protein [Energy production and conversion]; Region: QcrA; COG0723
31964003213	Rieske domain; a [2Fe-2S] cluster binding domain commonly found in Rieske non-heme iron oxygenase (RO) systems such as naphthalene and biphenyl dioxygenases, as well as in plant/cyanobacterial chloroplast b6f and mitochondrial cytochrome bc(1) complexes; Region: Rieske; cd03467
31964003214	iron-sulfur cluster [ion binding]; other site
31964003215	[2Fe-2S] cluster binding site [ion binding]; other site
31964003216	HMMPfam hit to PF00355, Rieske [2Fe-2S] region,score 6.2e-09
31964003217	PS00200 Rieske iron-sulfur protein signature 2.
31964003218	3 probable transmembrane helices predicted for CMS0696 by TMHMM2.0 at aa 72-94, 104-126 and 170-189
31964003219	Cytochrome c, mono- and diheme variants [Energy production and conversion]; Region: CccA; COG2010
31964003220	Cytochrome c; Region: Cytochrom_C; pfam00034
31964003221	Cytochrome c, mono- and diheme variants [Energy production and conversion]; Region: CccA; COG2010
31964003222	Cytochrome C oxidase, cbb3-type, subunit III; Region: Cytochrome_CBB3; pfam13442
31964003223	2 probable transmembrane helices predicted for CMS0697 by TMHMM2.0 at aa 20-42 and 244-263
31964003224	HMMPfam hit to PF00034, Cytochrome c, class I,score 0.0041
31964003225	PS00190 Cytochrome c family heme-binding site signature.
31964003226	HMMPfam hit to PF00034, Cytochrome c, class I,score 7.7e-08
31964003227	PS00639 Eukaryotic thiol (cysteine) proteases histidine active site.
31964003228	PS00190 Cytochrome c family heme-binding site signature.
31964003229	Heme-copper oxidase subunit III.  Heme-copper oxidases are transmembrane protein complexes in the respiratory chains of prokaryotes and mitochondria which couple the reduction of molecular oxygen to water to, proton pumping across the membrane. The...; Region: Heme_Cu_Oxidase_III_like; cd00386
31964003230	Subunit I/III interface [polypeptide binding]; other site
31964003231	HMMPfam hit to PF00510, Cytochrome c oxidase,subunit III, score 9e-09
31964003232	5 probable transmembrane helices predicted for CMS0698 by TMHMM2.0 at aa 26-48, 68-90, 110-132, 154-176 and 189-211
31964003233	anthranilate phosphoribosyltransferase; Provisional; Region: trpD; PRK00188
31964003234	Glycosyl transferase family, helical bundle domain; Region: Glycos_trans_3N; pfam02885
31964003235	Glycosyl transferase family, a/b domain; Region: Glycos_transf_3; pfam00591
31964003236	HMMPfam hit to PF02885, Glycosyl transferase,family 3, score 1.4e-21
31964003237	HMMPfam hit to PF00591, Glycosyl transferase,family 3, score 1.6e-83
31964003238	Uncharacterized ACR, COG2135; Region: DUF159; pfam02586
31964003239	HMMPfam hit to PF02586, Protein of unknown function DUF159, score 7.4e-74
31964003240	HMMPfam hit to PF02782, Carbohydrate kinase, FGGY,score 1.8e-72
31964003241	PS00445 FGGY family of carbohydrate kinases signature 2.
31964003242	HMMPfam hit to PF00370, Carbohydrate kinase, FGGY,score 6.2e-44
31964003243	PS00933 FGGY family of carbohydrate kinases signature 1.
31964003244	Glycerol uptake facilitator and related permeases (Major Intrinsic Protein Family) [Carbohydrate transport and metabolism]; Region: GlpF; COG0580
31964003245	amphipathic channel; other site
31964003246	Asn-Pro-Ala signature motifs; other site
31964003247	6 probable transmembrane helices predicted for CMS0702 by TMHMM2.0 at aa 30-49, 61-83, 103-125, 150-172,187-209 and 242-264
31964003248	HMMPfam hit to PF00230, Major intrinsic protein,score 1.8e-40
31964003249	PS00221 MIP family signature.
31964003250	dihydroxyacetone kinase subunit DhaK; Provisional; Region: PRK14481
31964003251	Dihydroxyacetone kinase [Carbohydrate transport and metabolism]; Region: DAK1; COG2376
31964003252	HMMPfam hit to PF02733, Dak kinase, score 1.6e-138
31964003253	DAK2 domain; Region: Dak2; cl03685
31964003254	HMMPfam hit to PF02734, Dak phosphatase, score 2.1e-63
31964003255	PTS_IIA, PTS system, mannose/sorbose specific IIA subunit. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. This family...; Region: PTS_IIA_man; cl00025
31964003256	Histidine-containing phosphocarrier protein (HPr)-like proteins. HPr is a central component of the bacterial phosphoenolpyruvate sugar phosphotransferase system (PTS). The PTS catalyses the phosphorylation of sugar substrates during their translocation...; Region: PTS-HPr_like; cd00367
31964003257	dimerization domain swap beta strand [polypeptide binding]; other site
31964003258	regulatory protein interface [polypeptide binding]; other site
31964003259	active site
31964003260	regulatory phosphorylation site [posttranslational modification]; other site
31964003261	HMMPfam hit to PF03610, PTS system fructose subfamily IIA component, score 9.3e-23
31964003262	HMMPfam hit to PF00381, Phosphocarrier HPr protein,score 3.6e-24
31964003263	PS00369 PTS HPR component histidine phosphorylation site signature.
31964003264	hypothetical protein; Provisional; Region: PRK04233
31964003265	Protein of unknown function (DUF664); Region: DUF664; pfam04978
31964003266	DinB superfamily; Region: DinB_2; pfam12867
31964003267	Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate. GSH peroxidase contains one selenocysteine residue per...; Region: GSH_Peroxidase; cd00340
31964003268	catalytic residues [active]
31964003269	dimer interface [polypeptide binding]; other site
31964003270	HMMPfam hit to PF00255, Glutathione peroxidase,score 1.4e-23
31964003271	PS00763 Glutathione peroxidases signature 2.
31964003272	Glycerol-3-phosphate dehydrogenase [Energy production and conversion]; Region: GlpA; COG0578
31964003273	HMMPfam hit to PF01266, FAD dependent oxidoreductase, score 5.3e-37
31964003274	Transcriptional regulator, contains sigma factor-related N-terminal domain [Transcription]; Region: DeoR; COG2390
31964003275	Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs). A SF is a dissociable subunit of RNA polymerase, it directs bacterial or...; Region: Sigma70_r4; cd06171
31964003276	DNA binding residues [nucleotide binding]
31964003277	Putative sugar-binding domain; Region: Sugar-bind; pfam04198
31964003278	Predicted helix-turn-helix motif with score 2140.000, SD 6.48 at aa 31-52, sequence LTMEAIARELGTSRSSVSRLLS
31964003279	HMMPfam hit to PF04198,  sugar-binding region, score 3.1e-69
31964003280	threonyl-tRNA synthetase; Reviewed; Region: thrS; PRK12305
31964003281	Threonyl and Alanyl tRNA synthetase second additional domain; Region: tRNA_SAD; smart00863
31964003282	Threonyl-tRNA synthetase (ThrRS) class II core catalytic domain. ThrRS is a homodimer. It is responsible for the attachment of threonine to the 3' OH group of ribose of the appropriate tRNA. This domain is primarily responsible for ATP-dependent...; Region: ThrRS_core; cd00771
31964003283	active site
31964003284	dimer interface [polypeptide binding]; other site
31964003285	motif 1; other site
31964003286	motif 2; other site
31964003287	motif 3; other site
31964003288	ThrRS Threonyl-anticodon binding domain. ThrRS belongs to class II aminoacyl-tRNA synthetases (aaRS). This alignment contains the anticodon binding domain, which is responsible for specificity in tRNA-binding, so that the activated amino acid is...; Region: ThrRS_anticodon; cd00860
31964003289	anticodon binding site; other site
31964003290	HMMPfam hit to PF00587, tRNA synthetases, class-II (G, H, P and S), score 2e-46
31964003291	PS00339 Aminoacyl-transfer RNA synthetases class-II signature 2.
31964003292	HMMPfam hit to PF03129, Anticodon-binding, score 1.1e-20
31964003293	FHIT (fragile histidine family): FHIT proteins, related to the HIT family carry a motif HxHxH/Qxx (x, is a hydrophobic amino acid), On the basis of sequence, substrate specificity, structure, evolution and mechanism, HIT proteins are classified into...; Region: FHIT; cd01275
31964003294	nucleotide binding site/active site [active]
31964003295	HIT family signature motif; other site
31964003296	catalytic residue [active]
31964003297	HMMPfam hit to PF01230, Histidine triad (HIT) protein, score 2.2e-10
31964003298	PS00133 Zinc carboxypeptidases, zinc-binding region 2 signature.
31964003299	pyridoxal 5'-phosphate synthase, synthase subunit Pdx1; Region: TIGR00343
31964003300	PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP,  present in some eubacteria, in archaea, fungi, plants, plasmodia, and some...; Region: pdxS; cd04727
31964003301	active site
31964003302	multimer interface [polypeptide binding]; other site
31964003303	HMMPfam hit to PF01680, Vitamin B6 biosynthesis protein, score 5.8e-125
31964003304	PS01235 Uncharacterized protein family UPF0019 signature.
31964003305	Glutamine Amidotransferase (GATase_I) involved in pyridoxine biosynthesis; Region: GATase1_PB; cd01749
31964003306	Glutamine amidotransferase [Amino acid transport and metabolism]; Region: HisH; COG0118
31964003307	predicted active site [active]
31964003308	catalytic triad [active]
31964003309	HMMPfam hit to PF01174, SNO glutamine amidotransferase, score 4.4e-71
31964003310	HMMPfam hit to PF07685, CobB/CobQ-like glutamine amidotransferase domain
31964003311	hypothetical protein; Validated; Region: PRK00110
31964003312	HMMPfam hit to PF01709, Protein of unknown function DUF28, score 1.3e-120
31964003313	Holliday junction resolvases (HJRs) are endonucleases that specifically resolve Holliday junction DNA intermediates during homologous recombination. HJR's occur in archaea, bacteria, and in the mitochondria of certain fungi, however this CD...; Region: RuvC_resolvase; cd00529
31964003314	active site
31964003315	putative DNA-binding cleft [nucleotide binding]; other site
31964003316	dimer interface [polypeptide binding]; other site
31964003317	HMMPfam hit to PF02075, Crossover junction endodeoxyribonuclease RuvC, score 8.2e-66
31964003318	PS01321 Crossover junction endodeoxyribonuclease ruvC signature.
31964003319	Holliday junction DNA helicase RuvA; Reviewed; Region: ruvA; PRK00116
31964003320	RuvA N terminal domain; Region: RuvA_N; pfam01330
31964003321	HMMPfam hit to PF01330, Bacterial DNA recombination protein, RuvA, score 2.2e-22
31964003322	HMMPfam hit to PF00633, Helix-hairpin-helix motif,score 0.11
31964003323	HMMPfam hit to PF00633, Helix-hairpin-helix motif,score 2.7
31964003324	Holliday junction DNA helicase RuvB; Reviewed; Region: ruvB; PRK00080
31964003325	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
31964003326	Walker A motif; other site
31964003327	ATP binding site [chemical binding]; other site
31964003328	Walker B motif; other site
31964003329	arginine finger; other site
31964003330	Holliday junction DNA helicase ruvB C-terminus; Region: RuvB_C; pfam05491
31964003331	HMMPfam hit to PF05496, Holliday junction DNA helicase RuvB, N-terminal, score 4.1e-08
31964003332	HMMPfam hit to PF00004, AAA ATPase, central region,score 3.2e-26
31964003333	PS00017 ATP/GTP-binding site motif A (P-loop).
31964003334	HMMPfam hit to PF05491, Holliday junction DNA helicase RuvB, C-terminal, score 2.9e-45
31964003335	Preprotein translocase subunit; Region: YajC; pfam02699
31964003336	HMMPfam hit to PF02699, YajC, score 3.9e-07
31964003337	1 probable transmembrane helix predicted for CMS0719 by TMHMM2.0 at aa 15-33
31964003338	Preprotein translocase subunit SecD [Intracellular trafficking and secretion]; Region: SecD; COG0342
31964003339	Protein export membrane protein; Region: SecD_SecF; cl14618
31964003340	6 probable transmembrane helices predicted for CMS0720 by TMHMM2.0 at aa 13-35, 358-380, 387-409,419-441, 469-491 and 495-517
31964003341	preprotein translocase subunit SecF; Reviewed; Region: secF; PRK13022
31964003342	Protein export membrane protein; Region: SecD_SecF; pfam02355
31964003343	6 probable transmembrane helices predicted for CMS0721 by TMHMM2.0 at aa 26-48, 138-160, 167-189,193-215, 253-275 and 280-302
31964003344	HMMPfam hit to PF02355, SecD/SecF/SecDF export membrane protein, score 2.4e-67
31964003345	Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein. The cysteine containing enzymatically active version of the domain is also found in the Cdc25 class of protein phosphatases and a variety of proteins...; Region: RHOD; cd00158
31964003346	active site residue [active]
31964003347	Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription]; Region: SpoT; COG0317
31964003348	Metal dependent phosphohydrolases with conserved 'HD' motif; Region: HDc; cd00077
31964003349	Zn2+ binding site [ion binding]; other site
31964003350	Mg2+ binding site [ion binding]; other site
31964003351	Nucleotidyltransferase (NT) domain of RelA- and SpoT-like ppGpp synthetases and hydrolases; Region: NT_Rel-Spo_like; cd05399
31964003352	synthetase active site [active]
31964003353	NTP binding site [chemical binding]; other site
31964003354	metal binding site [ion binding]; metal-binding site
31964003355	TGS_RelA_SpoT: The RelA (SpoT) protein, also referred to as ppGpp hydrolase/synthetase, is a ribosome-associated protein that is activated during amino acid starvation and thought to mediate the stringent response. RelA contains a TGS domain, named after...; Region: TGS_RelA_SpoT; cd01668
31964003356	ACT  domain found C-terminal of the RelA/SpoT domains; Region: ACT_RelA-SpoT; cd04876
31964003357	HMMPfam hit to PF01966, Metal-dependent phosphohydrolase, HD subdomain, score 9.4e-15
31964003358	HMMPfam hit to PF04607, RelA/SpoT, score 6.3e-56
31964003359	HMMPfam hit to PF02824, TGS, score 4.3e-26
31964003360	HMMPfam hit to PF01842, Amino acid-binding ACT,score 1e-14
31964003361	PS00038 Myc-type, 'helix-loop-helix' dimerization domain signature.
31964003362	Domain of Unknown Function (DUF349); Region: DUF349; pfam03993
31964003363	Domain of Unknown Function (DUF349); Region: DUF349; pfam03993
31964003364	HMMPfam hit to PF03993, Protein of unknown function DUF349, score 4.7e-11
31964003365	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
31964003366	Walker A motif; other site
31964003367	ATP binding site [chemical binding]; other site
31964003368	Walker B motif; other site
31964003369	recombination factor protein RarA; Reviewed; Region: PRK13342
31964003370	MgsA AAA+ ATPase C terminal; Region: MgsA_C; pfam12002
31964003371	HMMPfam hit to PF00004, AAA ATPase, central region,score 5.9e-12
31964003372	PS00017 ATP/GTP-binding site motif A (P-loop).
31964003373	30S ribosomal protein S4; Validated; Region: rpsD; PRK05327
31964003374	Ribosomal protein S4/S9 N-terminal domain; Region: Ribosomal_S4; pfam00163
31964003375	S4/Hsp/ tRNA synthetase RNA-binding domain; The domain surface is populated by conserved, charged residues that define a likely RNA-binding site;  Found in stress proteins, ribosomal proteins and tRNA synthetases; This may imply a hitherto unrecognized...; Region: S4; cd00165
31964003376	RNA binding surface [nucleotide binding]; other site
31964003377	HMMPfam hit to PF00163, Ribosomal protein S4, score 4.1e-14
31964003378	PS00632 Ribosomal protein S4 signature.
31964003379	HMMPfam hit to PF01479, RNA-binding S4, score 7.2e-19
31964003380	1 probable transmembrane helix predicted for CMS0728 by TMHMM2.0 at aa 4-21
31964003381	alanyl-tRNA synthetase; Reviewed; Region: alaS; PRK00252
31964003382	Alanyl-tRNA synthetase (AlaRS) class II core catalytic domain. AlaRS is a homodimer. It is responsible for the attachment of alanine to the 3' OH group of ribose of the appropriate tRNA. This domain is primarily responsible for ATP-dependent...; Region: AlaRS_core; cd00673
31964003383	motif 1; other site
31964003384	active site
31964003385	motif 2; other site
31964003386	motif 3; other site
31964003387	Threonyl and Alanyl tRNA synthetase second additional domain; Region: tRNA_SAD; pfam07973
31964003388	HMMPfam hit to PF01411, Alanyl-tRNA synthetase,class IIc, score 0
31964003389	HMMPfam hit to PF02272, Phosphoesterase, DHHA1,score 4.4e-13
31964003390	Uncharacterized protein family (UPF0081); Region: UPF0081; pfam03652
31964003391	HMMPfam hit to PF03652, Conserved hypothetical protein 250, score 2.3e-41
31964003392	YceG-like family; Region: YceG; pfam02618
31964003393	proteins similar to Escherichia coli yceG; Region: yceG_like; cd08010
31964003394	dimerization interface [polypeptide binding]; other site
31964003395	HMMPfam hit to PF02618, Protein of unknown function DUF175, score 1.8e-99
31964003396	shikimate 5-dehydrogenase; Reviewed; Region: aroE; PRK00258
31964003397	Shikimate dehydrogenase substrate binding domain; Region: Shikimate_dh_N; pfam08501
31964003398	NAD(P) binding domain of Shikimate dehydrogenase; Region: NAD_bind_Shikimate_DH; cd01065
31964003399	shikimate binding site; other site
31964003400	NAD(P) binding site [chemical binding]; other site
31964003401	HMMPfam hit to PF01488, Shikimate/quinate 5-dehydrogenase, score 4.8e-45
31964003402	Chorismate synthase [Amino acid transport and metabolism]; Region: AroC; COG0082
31964003403	Chorismase synthase, the enzyme catalyzing the final step of the shikimate pathway; Region: Chorismate_synthase; cd07304
31964003404	Tetramer interface [polypeptide binding]; other site
31964003405	active site
31964003406	FMN-binding site [chemical binding]; other site
31964003407	HMMPfam hit to PF01264, Chorismate synthase, score 6.3e-154
31964003408	PS00788 Chorismate synthase signature 2.
31964003409	PS00789 Chorismate synthase signature 3.
31964003410	shikimate kinase; Reviewed; Region: aroK; PRK00131
31964003411	Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants. Chorismic acid is a important intermediate in the synthesis...; Region: SK; cd00464
31964003412	ADP binding site [chemical binding]; other site
31964003413	magnesium binding site [ion binding]; other site
31964003414	putative shikimate binding site; other site
31964003415	PS00017 ATP/GTP-binding site motif A (P-loop).
31964003416	HMMPfam hit to PF01202, Shikimate kinase, score 3.7e-48
31964003417	PS01128 Shikimate kinase signature.
31964003418	Dehydroquinate synthase (DHQS) catalyzes the conversion of DAHP to DHQ in shikimate pathway for aromatic compounds synthesis; Region: DHQS; cd08195
31964003419	active site
31964003420	dimer interface [polypeptide binding]; other site
31964003421	metal binding site [ion binding]; metal-binding site
31964003422	HMMPfam hit to PF01761, 3-dehydroquinate synthase,score 6e-117
31964003423	3-ketoacyl-(acyl-carrier-protein) reductase; Provisional; Region: PRK12748
31964003424	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
31964003425	active site
31964003426	1 probable transmembrane helix predicted for CMS0736 by TMHMM2.0 at aa 15-37
31964003427	HMMPfam hit to PF00106, Short-chain dehydrogenase/reductase SDR, score 1.6e-26
31964003428	leucine-zipper of insertion element IS481; Region: LZ_Tnp_IS481; pfam13011
31964003429	Winged helix-turn helix; Region: HTH_29; pfam13551
31964003430	Integrase core domain; Region: rve; pfam00665
31964003431	Integrase core domain; Region: rve_3; pfam13683
31964003432	Predicted helix-turn-helix motif with score 1638.000, SD 4.77 at aa 25-46, sequence RPVSHVARELGVSRQCAHRWVA
31964003433	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.6e-38
31964003434	N6-adenine-specific methylase [DNA replication, recombination, and repair]; Region: COG0742
31964003435	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cl17173
31964003436	HMMPfam hit to PF03602, Conserved hypothetical protein 95, score 3.5e-50
31964003437	PS00092 N-6 Adenine-specific DNA methylases signature.
31964003438	MoxR-like ATPases [General function prediction only]; Region: COG0714
31964003439	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
31964003440	Walker A motif; other site
31964003441	ATP binding site [chemical binding]; other site
31964003442	Walker B motif; other site
31964003443	arginine finger; other site
31964003444	HMMPfam hit to PF07728, ATPase family associated with various cellular activities (AAA)
31964003445	HMMPfam hit to PF07726, ATPase family associated with various cellular activities (AAA)
31964003446	Uncharacterized conserved protein (some members contain a von Willebrand factor type A (vWA) domain) [General function prediction only]; Region: COG1721
31964003447	Protein of unknown function DUF58; Region: DUF58; pfam01882
31964003448	2 probable transmembrane helices predicted for CMS0740 by TMHMM2.0 at aa 21-40 and 44-66
31964003449	HMMPfam hit to PF01882, Protein of unknown function DUF58, score 8.4e-27
31964003450	Transglutaminase-like enzymes, putative cysteine proteases [Amino acid transport and metabolism]; Region: COG1305
31964003451	Transglutaminase-like superfamily; Region: Transglut_core; pfam01841
31964003452	7 probable transmembrane helices predicted for CMS0741 by TMHMM2.0 at aa 15-37, 42-64, 103-125, 132-149,153-170, 215-237 and 607-629
31964003453	HMMPfam hit to PF01841, Transglutaminase-like,score 7.1e-17
31964003454	ATP-dependent DNA helicase RecG; Provisional; Region: PRK10917
31964003455	RecG_wedge_OBF: A subfamily of OB folds corresponding to the OB fold found in the N-terminal (wedge) domain of Escherichia coli RecG. RecG is a branched-DNA-specific helicase, which catalyzes the interconversion of a DNA replication fork to a...; Region: RecG_wedge_OBF; cd04488
31964003456	ssDNA binding site; other site
31964003457	generic binding surface II; other site
31964003458	DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region; Region: DEXDc; cd00046
31964003459	ATP binding site [chemical binding]; other site
31964003460	putative Mg++ binding site [ion binding]; other site
31964003461	Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may...; Region: HELICc; cd00079
31964003462	nucleotide binding region [chemical binding]; other site
31964003463	ATP-binding site [chemical binding]; other site
31964003464	HMMPfam hit to PF01336, OB-fold nucleic acid binding, score 1.8e-07
31964003465	HMMPfam hit to PF00270, DEAD/DEAH box helicase,N-terminal, score 2.9e-31
31964003466	PS00017 ATP/GTP-binding site motif A (P-loop).
31964003467	HMMPfam hit to PF00271, Helicase, C-terminal, score 3.8e-22
31964003468	phosphopantetheine adenylyltransferase; Provisional; Region: coaD; PRK13964
31964003469	Phosphopantetheine adenylyltransferase; Region: PPAT; cd02163
31964003470	active site
31964003471	(T/H)XGH motif; other site
31964003472	HMMPfam hit to PF01467, Cytidylyltransferase, score 1.5e-15
31964003473	Uncharacterized ACR, COG1399; Region: DUF177; pfam02620
31964003474	HMMPfam hit to PF02620, Protein of unknown function DUF177, score 6.9e-15
31964003475	50S ribosomal protein L32; Validated; Region: rpmF; PRK01110
31964003476	HMMPfam hit to PF01783, Ribosomal L32p protein,score 9.7e-08
31964003477	ribonuclease III; Reviewed; Region: rnc; PRK00102
31964003478	RIBOc. Ribonuclease III C terminal domain. This group consists of eukaryotic, bacterial and archeal ribonuclease III (RNAse III) proteins. RNAse III is a double stranded RNA-specific endonuclease. Prokaryotic RNAse III is important in...; Region: RIBOc; cd00593
31964003479	dimerization interface [polypeptide binding]; other site
31964003480	active site
31964003481	metal binding site [ion binding]; metal-binding site
31964003482	Double-stranded RNA binding motif. Binding is not sequence specific but is highly specific for double stranded RNA. Found in a variety of proteins including dsRNA dependent protein kinase PKR, RNA helicases, Drosophila staufen protein, E. coli RNase III; Region: DSRM; cd00048
31964003483	dsRNA binding site [nucleotide binding]; other site
31964003484	HMMPfam hit to PF00636, Ribonuclease III, score 5.2e-41
31964003485	PS00517 Ribonuclease III family signature.
31964003486	HMMPfam hit to PF00035, Double-stranded RNA binding, score 5.3e-19
31964003487	formamidopyrimidine/5-formyluracil/ 5-hydroxymethyluracil DNA glycosylase; Validated; Region: PRK01103
31964003488	N-terminal domain of Escherichia coli Fpg1/MutM and related bacterial DNA glycosylases; Region: EcFpg-like_N; cd08966
31964003489	DNA binding site [nucleotide binding]
31964003490	catalytic residue [active]
31964003491	H2TH interface [polypeptide binding]; other site
31964003492	putative catalytic residues [active]
31964003493	turnover-facilitating residue; other site
31964003494	intercalation triad [nucleotide binding]; other site
31964003495	8OG recognition residue [nucleotide binding]; other site
31964003496	putative reading head residues; other site
31964003497	Formamidopyrimidine-DNA glycosylase H2TH domain; Region: H2TH; pfam06831
31964003498	Zinc finger found in FPG and IleRS; Region: zf-FPG_IleRS; pfam06827
31964003499	HMMPfam hit to PF01149, Formamidopyrimidine-DNA glycolase, score 3.9e-27
31964003500	HMMPfam hit to PF06831, Formamidopyrimidine-DNA glycolase, score 9.2e-40
31964003501	HMMPfam hit to PF06827, FPG and IleRS zinc finger,score 4.1e-10
31964003502	PS01242 Formamidopyrimidine-DNA glycosylase signature.
31964003503	Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane]; Region: COG1247
31964003504	PS00485 Adenosine and AMP deaminase signature.
31964003505	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 3e-06
31964003506	ATP-binding cassette domain of barmotin, a member of the SMC protein family; Region: ABC_SMC_barmotin; cd03278
31964003507	Walker A/P-loop; other site
31964003508	ATP binding site [chemical binding]; other site
31964003509	ATP-binding cassette domain of barmotin, a member of the SMC protein family; Region: ABC_SMC_barmotin; cd03278
31964003510	ABC transporter signature motif; other site
31964003511	Walker B; other site
31964003512	D-loop; other site
31964003513	H-loop/switch region; other site
31964003514	HMMPfam hit to PF02463, SMC protein, N-terminal,score 1.9e-70
31964003515	PS00017 ATP/GTP-binding site motif A (P-loop).
31964003516	HMMPfam hit to PF06470, SMCs flexible hinge, score 2.6e-19
31964003517	HMMPfam hit to PF02483, Structural maintenance of chromosome protein SMC, C-terminal, score 4.8e-98
31964003518	signal recognition particle-docking protein FtsY; Provisional; Region: PRK10416
31964003519	SRP54-type protein, helical bundle domain; Region: SRP54_N; pfam02881
31964003520	The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain. Functionally, proteins in this superfamily use the energy from hydrolysis of NTP to transfer electron or ion; Region: Fer4_NifH; cl17203
31964003521	HMMPfam hit to PF02881, GTP-binding signal recognition particle SRP54, G-domain, score 3.6e-05
31964003522	HMMPfam hit to PF00448, GTP-binding signal recognition particle SRP54, G-domain, score 2.1e-92
31964003523	PS00017 ATP/GTP-binding site motif A (P-loop).
31964003524	PS00300 SRP54-type proteins GTP-binding domain signature.
31964003525	signal recognition particle protein; Provisional; Region: PRK10867
31964003526	SRP54-type protein, helical bundle domain; Region: SRP54_N; smart00963
31964003527	The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes. SRP recognizes N-terminal sighnal sequences of newly synthesized polypeptides at the ribosome. The...; Region: SRP; cd03115
31964003528	P loop; other site
31964003529	GTP binding site [chemical binding]; other site
31964003530	Signal peptide binding domain; Region: SRP_SPB; pfam02978
31964003531	HMMPfam hit to PF02881, GTP-binding signal recognition particle SRP54, G-domain, score 1.2e-27
31964003532	HMMPfam hit to PF00448, GTP-binding signal recognition particle SRP54, G-domain, score 7.5e-108
31964003533	PS00017 ATP/GTP-binding site motif A (P-loop).
31964003534	PS00300 SRP54-type proteins GTP-binding domain signature.
31964003535	HMMPfam hit to PF02978, Signal peptide binding (SRP54) M-domain, score 2.3e-45
31964003536	This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins; Region: Glo_EDI_BRP_like; cd06587
31964003537	active site
31964003538	HMMPfam hit to PF00903, Glyoxalase/bleomycin resistance protein/dioxygenase, score 0.00018
31964003539	Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones]; Region: DegQ; COG0265
31964003540	Trypsin-like peptidase domain; Region: Trypsin_2; pfam13365
31964003541	HMMPfam hit to PF00089, Peptidase S1, chymotrypsin,score 3.2e-06
31964003542	PS00135 Serine proteases, trypsin family, serine active site.
31964003543	3 probable transmembrane helices predicted for CMS0753 by TMHMM2.0 at aa 21-43, 58-80 and 100-122
31964003544	carboxylate-amine ligase; Provisional; Region: PRK13517
31964003545	carboxylate-amine ligase, YbdK family; Region: gshA_cyan_rel; TIGR02050
31964003546	HMMPfam hit to PF04107, Glutamate--cysteine ligase,GCS2, score 1.9e-65
31964003547	30S ribosomal protein S16; Provisional; Region: rpsP; PRK14520
31964003548	PS00732 Ribosomal protein S16 signature.
31964003549	HMMPfam hit to PF00886, Ribosomal protein S16,score 2.4e-28
31964003550	Predicted RNA-binding protein (contains KH domain) [General function prediction only]; Region: COG1837
31964003551	jag_K homology RNA-binding domain. The KH domain is found in proteins homologous to the Bacillus subtilis protein Jag, which is associated with SpoIIIJ and is necessary for the third stage of sporulation.  The KH motif is a beta-alpha-alpha-beta-beta...; Region: jag_KH; cd02414
31964003552	G-X-X-G motif; other site
31964003553	16S rRNA-processing protein RimM; Provisional; Region: rimM; PRK00122
31964003554	RimM N-terminal domain; Region: RimM; pfam01782
31964003555	HMMPfam hit to PF01782, RimM protein, score 1.2e-09
31964003556	HMMPfam hit to PF05239, PRC-barrel, score 3.8e-07
31964003557	tRNA (guanine-N(1)-)-methyltransferase; Reviewed; Region: trmD; PRK00026
31964003558	HMMPfam hit to PF01746, tRNA (guanine-N1-)-methyltransferase, score 8.1e-119
31964003559	Methionine Aminopeptidase 1. E.C. 3.4.11.18. Also known as methionyl aminopeptidase and Peptidase M. Catalyzes release of N-terminal amino acids, preferentially methionine, from peptides and arylamides; Region: MetAP1; cd01086
31964003560	active site
31964003561	HMMPfam hit to PF00557, Peptidase M24, score 1.5e-54
31964003562	4 probable transmembrane helices predicted for CMS0760 by TMHMM2.0 at aa 13-35, 42-64, 71-93 and 98-120
31964003563	50S ribosomal protein L19; Provisional; Region: rplS; PRK05338
31964003564	HMMPfam hit to PF01245, Ribosomal protein L19,score 1.6e-65
31964003565	signal peptidase I, bacterial type; Region: sigpep_I_bact; TIGR02227
31964003566	The S26 Type I signal peptidase (SPase; LepB; leader peptidase B; leader peptidase I; EC 3.4.21.89) family members are essential membrane-bound serine proteases that function to cleave the amino-terminal signal peptide extension from proteins that are...; Region: S26_SPase_I; cd06530
31964003567	Catalytic site [active]
31964003568	1 probable transmembrane helix predicted for CMS0762 by TMHMM2.0 at aa 31-50
31964003569	HMMPfam hit to PF00717, Peptidase S24, S26A and S26B, score 1.1e-11
31964003570	PS00761 Signal peptidases I signature 3.
31964003571	bacterial Ribonuclease HII-like; Region: RNase_HII_bacteria_HII_like; cd07182
31964003572	RNA/DNA hybrid binding site [nucleotide binding]; other site
31964003573	active site
31964003574	HMMPfam hit to PF01351, Ribonuclease HII/HIII,score 1.4e-37
31964003575	Protein of unknown function (DUF2469); Region: DUF2469; pfam10611
31964003576	hypothetical protein; Reviewed; Region: PRK12497
31964003577	Domain of unknown function (DUF4143); Region: DUF4143; pfam13635
31964003578	HMMPfam hit to PF02021, Protein of unknown function UPF0102, score 1.2e-31
31964003579	Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones]; Region: COG0606
31964003580	Subunit ChlI of Mg-chelatase; Region: ChlI; pfam13541
31964003581	Magnesium chelatase, subunit ChlI; Region: Mg_chelatase; pfam01078
31964003582	Magnesium chelatase, subunit ChlI; Region: Mg_chelatase_2; pfam13335
31964003583	HMMPfam hit to PF01078, Magnesium chelatase, ChlI subunit, score 6.3e-39
31964003584	PS00017 ATP/GTP-binding site motif A (P-loop).
31964003585	DNA recombination-mediator protein A; Region: DNA_processg_A; pfam02481
31964003586	DNA protecting protein DprA; Region: dprA; TIGR00732
31964003587	HMMPfam hit to PF02481, SMF protein, score 2.6e-79
31964003588	site-specific tyrosine recombinase XerC; Reviewed; Region: xerC; PRK00236
31964003589	DNA breaking-rejoining enzymes, C-terminal catalytic domain. The DNA breaking-rejoining enzyme superfamily includes type IB topoisomerases and tyrosine recombinases that share the same fold in their catalytic domain containing six conserved active site...; Region: DNA_BRE_C; cl00213
31964003590	active site
31964003591	DNA binding site [nucleotide binding]
31964003592	Int/Topo IB signature motif; other site
31964003593	HMMPfam hit to PF02899, Phage integrase, N-terminal SAM-like, score 6.3e-11
31964003594	HMMPfam hit to PF00589, Phage integrase, score 6.8e-47
31964003595	Membrane proteins related to metalloendopeptidases [Cell envelope biogenesis, outer membrane]; Region: NlpD; COG0739
31964003596	Peptidase family M23; Region: Peptidase_M23; pfam01551
31964003597	PS01098 Lipolytic enzymes G-D-S-L family, serine active site.
31964003598	D-xylose transporter XylE; Provisional; Region: xylE; PRK10077
31964003599	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
31964003600	putative substrate translocation pore; other site
31964003601	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
31964003602	12 probable transmembrane helices predicted for CMS0770 by TMHMM2.0 at aa 23-45, 60-79, 91-113, 117-139,155-177, 187-209, 271-293, 308-330, 337-357, 377-399,412-434 and 439-458
31964003603	HMMPfam hit to PF00083, General substrate transporter, score 2.3e-133
31964003604	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964003605	PS00216 Sugar transport proteins signature 1.
31964003606	PS00216 Sugar transport proteins signature 1.
31964003607	Ribosomal protein S2 (RPS2), involved in formation of the translation initiation complex, where it might contact the messenger RNA and several components of the ribosome. It has been shown that in Escherichia coli RPS2 is essential for the binding of...; Region: RPS2; cd01425
31964003608	rRNA interaction site [nucleotide binding]; other site
31964003609	S8 interaction site; other site
31964003610	putative laminin-1 binding site; other site
31964003611	PS00962 Ribosomal protein S2 signature 1.
31964003612	HMMPfam hit to PF00318, Ribosomal protein S2, score 1.6e-80
31964003613	elongation factor Ts; Provisional; Region: tsf; PRK09377
31964003614	UBA/TS-N domain; Region: UBA; pfam00627
31964003615	Elongation factor TS; Region: EF_TS; pfam00889
31964003616	Elongation factor TS; Region: EF_TS; pfam00889
31964003617	HMMPfam hit to PF00627, Ubiquitin-associated, score 1.2e-08
31964003618	HMMPfam hit to PF00889, Elongation factor Ts, score 1.6e-74
31964003619	UMP kinase (UMPK)-Ec, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and...; Region: AAK_UMPK-PyrH-Ec; cd04254
31964003620	putative nucleotide binding site [chemical binding]; other site
31964003621	uridine monophosphate binding site [chemical binding]; other site
31964003622	homohexameric interface [polypeptide binding]; other site
31964003623	HMMPfam hit to PF00696,Aspartate/glutamate/uridylate kinase, score 1.3e-59
31964003624	ribosome recycling factor; Reviewed; Region: frr; PRK00083
31964003625	Ribosome recycling factor (RRF). Ribosome recycling factor dissociates the posttermination complex, composed of the ribosome, deacylated tRNA, and mRNA, after termination of translation.  Thus ribosomes are "recycled" and ready for another...; Region: RRF; cd00520
31964003626	hinge region; other site
31964003627	HMMPfam hit to PF01765, Ribosome recycling factor,score 2.1e-62
31964003628	Cytidylyltransferase family; Region: CTP_transf_1; pfam01148
31964003629	CDP-diglyceride synthetase [Lipid metabolism]; Region: CdsA; COG0575
31964003630	8 probable transmembrane helices predicted for CMS0775 by TMHMM2.0 at aa 73-95, 100-119, 126-145,150-167, 180-202, 212-234, 254-273 and 278-300
31964003631	HMMPfam hit to PF01148, Phosphatidate cytidylyltransferase, score 1.9e-67
31964003632	DivIVA domain repeat protein; Region: divI1A_rptt_fam; TIGR03543
31964003633	DivIVA domain; Region: DivI1A_domain; TIGR03544
31964003634	DivIVA domain; Region: DivI1A_domain; TIGR03544
31964003635	lysozyme_like domain.  This contains several members including Soluble Lytic Transglycosylases (SLT), Goose Egg-White Lysozymes (GEWL), Hen Egg-White Lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, and chitosanases; Region: lysozyme_like; cl00222
31964003636	catalytic residue [active]
31964003637	NhaP-type Na+/H+ and K+/H+ antiporters [Inorganic ion transport and metabolism]; Region: NhaP; COG0025
31964003638	HMMPfam hit to PF00999, Sodium/hydrogen exchanger,score 4.3e-65
31964003639	9 probable transmembrane helices predicted for CMS0778 by TMHMM2.0 at aa 4-21, 26-44, 54-76, 83-105,176-198, 263-285, 305-327, 382-404 and 419-441
31964003640	Alpha/beta hydrolase family; Region: Abhydrolase_5; pfam12695
31964003641	Domain of unknown function DUF20; Region: UPF0118; pfam01594
31964003642	Predicted permease, member of the PurR regulon [General function prediction only]; Region: yhhT; COG0628
31964003643	HMMPfam hit to PF01594, Protein of unknown function UPF0118, score 6.1e-46
31964003644	8 probable transmembrane helices predicted for CMS0781 by TMHMM2.0 at aa 9-28, 32-54, 66-88, 151-173,215-237, 242-264, 276-295 and 310-341
31964003645	3 probable transmembrane helices predicted for CMS0783 by TMHMM2.0 at aa 5-27, 191-213 and 266-288
31964003646	Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones]; Region: COG3118
31964003647	Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold; Region: Thioredoxin_like; cl00388
31964003648	glycogen branching enzyme; Provisional; Region: PRK05402
31964003649	N-terminal Early set domain associated with the catalytic domain of prokaryotic glycogen branching enzyme; Region: E_set_GBE_prok_N; cd02855
31964003650	Alpha amylase catalytic domain found in the Glycogen branching enzyme (also called 1,4-alpha-glucan branching enzyme); Region: AmyAc_Glg_BE; cd11322
31964003651	active site
31964003652	catalytic site [active]
31964003653	Alpha amylase, C-terminal all-beta domain; Region: Alpha-amylase_C; pfam02806
31964003654	HMMPfam hit to PF00128, Alpha amylase, catalytic region, score 2.6e-08
31964003655	HMMPfam hit to PF02922, Glycoside hydrolase, family 13, N-terminal, score 3.3e-27
31964003656	Domain of unknown function (DUF3416); Region: DUF3416; pfam11896
31964003657	Alpha amylase catalytic domain found in GlgE-like proteins; Region: AmyAc_GlgE_like; cd11344
31964003658	Glycosidases [Carbohydrate transport and metabolism]; Region: AmyA; COG0366
31964003659	active site
31964003660	homodimer interface [polypeptide binding]; other site
31964003661	catalytic site [active]
31964003662	acceptor binding site [chemical binding]; other site
31964003663	HMMPfam hit to PF00128, Alpha amylase, catalytic region, score 5.2e-05
31964003664	PS01039 Bacterial extracellular solute-binding proteins, family 3 signature.
31964003665	leucine-zipper of insertion element IS481; Region: LZ_Tnp_IS481; pfam13011
31964003666	Winged helix-turn helix; Region: HTH_29; pfam13551
31964003667	Integrase core domain; Region: rve; pfam00665
31964003668	Integrase core domain; Region: rve_3; pfam13683
31964003669	HMMPfam hit to PF00665, Integrase, catalytic region, score 2.1e-37
31964003670	beta-phosphoglucomutase family hydrolase; Region: PGMB-YQAB-SF; TIGR02009
31964003671	Haloacid dehalogenase-like hydrolases. The haloacid dehalogenase-like (HAD) superfamily includes L-2-haloacid dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, and many others; Region: HAD_like; cd01427
31964003672	motif II; other site
31964003673	HMMPfam hit to PF00702, Haloacid dehalogenase-like hydrolase, score 2.4e-27
31964003674	Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate...; Region: Glycosyltransferase_GTB_type; cl10013
31964003675	Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate...; Region: Glycosyltransferase_GTB_type; cl10013
31964003676	2 probable transmembrane helices predicted for CMS0791 by TMHMM2.0 at aa 13-35 and 45-67
31964003677	2 probable transmembrane helices predicted for CMS0792 by TMHMM2.0 at aa 10-28 and 41-63
31964003678	N-methyltryptophan oxidase; Provisional; Region: solA; PRK11259
31964003679	NAD(P)-binding Rossmann-like domain; Region: NAD_binding_8; pfam13450
31964003680	HMMPfam hit to PF01266, FAD dependent oxidoreductase, score 2.4e-45
31964003681	1 probable transmembrane helix predicted for CMS0794 by TMHMM2.0 at aa 10-32
31964003682	Acetyl xylan esterase (AXE1); Region: AXE1; pfam05448
31964003683	Prolyl oligopeptidase family; Region: Peptidase_S9; pfam00326
31964003684	HMMPfam hit to PF05448, Acetyl xylan esterase,score 8.4e-126
31964003685	TetR family transcriptional regulator; Provisional; Region: PRK14996
31964003686	Bacterial regulatory proteins, tetR family; Region: TetR_N; pfam00440
31964003687	Bacterial transcriptional repressor; Region: TetR_C_6; pfam13977
31964003688	HMMPfam hit to PF00440, Bacterial regulatory protein, TetR, score 1.6e-12
31964003689	Predicted helix-turn-helix motif with score 1395.000, SD 3.94 at aa 63-84, sequence TGLRDIAAEGDVSVGTVTYHFA
31964003690	X-Pro dipeptidyl-peptidase (S15 family); Region: Peptidase_S15; pfam02129
31964003691	Prolyl oligopeptidase family; Region: Peptidase_S9; pfam00326
31964003692	X-Pro dipeptidyl-peptidase C-terminal non-catalytic domain; Region: PepX_C; smart00939
31964003693	HMMPfam hit to PF02129, Peptidase S15, score 2.5e-127
31964003694	ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]; Region: COG1123
31964003695	ATP-binding cassette domain of nickel/oligopeptides specific transporters; Region: ABC_NikE_OppD_transporters; cd03257
31964003696	Walker A/P-loop; other site
31964003697	ATP binding site [chemical binding]; other site
31964003698	Q-loop/lid; other site
31964003699	ABC transporter signature motif; other site
31964003700	Walker B; other site
31964003701	D-loop; other site
31964003702	H-loop/switch region; other site
31964003703	Oligopeptide/dipeptide transporter, C-terminal region; Region: oligo_HPY; cl07097
31964003704	ATP-binding cassette domain of nickel/oligopeptides specific transporters; Region: ABC_NikE_OppD_transporters; cd03257
31964003705	Walker A/P-loop; other site
31964003706	ATP binding site [chemical binding]; other site
31964003707	Q-loop/lid; other site
31964003708	ABC transporter signature motif; other site
31964003709	Walker B; other site
31964003710	D-loop; other site
31964003711	H-loop/switch region; other site
31964003712	Oligopeptide/dipeptide transporter, C-terminal region; Region: oligo_HPY; cl07097
31964003713	HMMPfam hit to PF00005, ABC transporter, score 1.2e-50
31964003714	PS00211 ABC transporters family signature.
31964003715	PS00017 ATP/GTP-binding site motif A (P-loop).
31964003716	HMMPfam hit to PF00005, ABC transporter, score 2.3e-53
31964003717	PS00211 ABC transporters family signature.
31964003718	PS00017 ATP/GTP-binding site motif A (P-loop).
31964003719	nickel ABC transporter, permease subunit NikC; Region: nickel_nikC; TIGR02790
31964003720	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964003721	dimer interface [polypeptide binding]; other site
31964003722	conserved gate region; other site
31964003723	putative PBP binding loops; other site
31964003724	ABC-ATPase subunit interface; other site
31964003725	ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism]; Region: DppB; COG0601
31964003726	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964003727	ABC-ATPase subunit interface; other site
31964003728	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 3.5e-48
31964003729	6 probable transmembrane helices predicted for CMS0799 by TMHMM2.0 at aa 12-34, 102-124, 137-159,179-201, 236-258 and 287-309
31964003730	HMMPfam hit to PF00496, Bacterial extracellular solute-binding protein, family 5, score 1.5e-52
31964003731	1 probable transmembrane helix predicted for CMS0801 by TMHMM2.0 at aa 35-57
31964003732	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964003733	Escherichia coli PhnB and similar proteins; the E. coli phnB gene is found next to an operon involved in the cleavage of carbon-phosphorus bonds in unactivated alkylphosphonates; Region: PhnB_like; cd06588
31964003734	dimer interface [polypeptide binding]; other site
31964003735	Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily; Region: Glyoxalase; pfam00903
31964003736	HMMPfam hit to PF00903, Glyoxalase/bleomycin resistance protein/dioxygenase, score 0.00073
31964003737	HTH domain; Region: HTH_11; pfam08279
31964003738	WYL domain; Region: WYL; pfam13280
31964003739	PS00894 Bacterial regulatory proteins, deoR family signature.
31964003740	Predicted helix-turn-helix motif with score 1383.000, SD 3.90 at aa 21-42, sequence WPGRILAERLEVTPRTVRRDVE
31964003741	2 probable transmembrane helices predicted for CMS0805 by TMHMM2.0 at aa 12-29 and 33-52
31964003742	PS00178 Aminoacyl-transfer RNA synthetases class-I signature.
31964003743	4 probable transmembrane helices predicted for CMS0808 by TMHMM2.0 at aa 21-38, 42-64, 76-94 and 99-116
31964003744	6 probable transmembrane helices predicted for CMS0809 by TMHMM2.0 at aa 69-91, 125-147, 167-186,193-215, 235-257 and 288-310
31964003745	1 probable transmembrane helix predicted for CMS0810 by TMHMM2.0 at aa 15-37
31964003746	Beta protein; Region: Beta_protein; pfam14350
31964003747	Protein of unknown function (DUF3892); Region: DUF3892; pfam13031
31964003748	short chain dehydrogenase; Provisional; Region: PRK06180
31964003749	17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs; Region: 17beta-HSD-like_SDR_c; cd05374
31964003750	NADP binding site [chemical binding]; other site
31964003751	active site
31964003752	steroid binding site; other site
31964003753	HMMPfam hit to PF00106, Short-chain dehydrogenase/reductase SDR, score 8e-47
31964003754	Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily; Region: Glyoxalase; pfam00903
31964003755	This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins; Region: Glo_EDI_BRP_like; cd06587
31964003756	active site
31964003757	metal binding site [ion binding]; metal-binding site
31964003758	HMMPfam hit to PF00903, Glyoxalase/bleomycin resistance protein/dioxygenase, score 1.4e-10
31964003759	2 probable transmembrane helices predicted for CMS0816 by TMHMM2.0 at aa 26-43 and 48-65
31964003760	1 probable transmembrane helix predicted for CMS0817 by TMHMM2.0 at aa 47-66
31964003761	Methylated DNA-protein cysteine methyltransferase [DNA replication, recombination, and repair]; Region: Ada; COG0350
31964003762	6-O-methylguanine DNA methyltransferase, ribonuclease-like domain; Region: Methyltransf_1N; pfam02870
31964003763	The DNA repair protein O6-alkylguanine-DNA alkyltransferase (ATase; also known as AGT, AGAT and MGMT) reverses O6-alkylation DNA damage by transferring O6-alkyl adducts to an active site cysteine irreversibly, without inducing DNA strand breaks. ATases...; Region: ATase; cd06445
31964003764	DNA binding site [nucleotide binding]
31964003765	active site
31964003766	HMMPfam hit to PF01035,Methylated-DNA-[protein]-cysteine S-methyltransferase,score 9.6e-35
31964003767	PS00374 Methylated-DNA--protein-cysteine methyltransferase active site.
31964003768	HMMPfam hit to PF02870, Methylguanine DNA methyltransferase, ribonuclease-like, score 2.9e-07
31964003769	RNA polymerase sigma factor, sigma-70 family; Region: sigma70-ECF; TIGR02937
31964003770	Sigma-70 region 2; Region: Sigma70_r2; pfam04542
31964003771	Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs). A SF is a dissociable subunit of RNA polymerase, it directs bacterial or...; Region: Sigma70_r4; cd06171
31964003772	DNA binding residues [nucleotide binding]
31964003773	HMMPfam hit to PF04545, Sigma-70 region 4, score 1.1e-10
31964003774	Predicted helix-turn-helix motif with score 1370.000, SD 3.85 at aa 125-146, sequence LPHAEVAEIVGGTPEAVRRAAA
31964003775	HMMPfam hit to PF04542, Sigma-70 region 2, score 9.2e-17
31964003776	Response regulator receiver domain; Region: Response_reg; pfam00072
31964003777	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
31964003778	active site
31964003779	phosphorylation site [posttranslational modification]
31964003780	intermolecular recognition site; other site
31964003781	dimerization interface [polypeptide binding]; other site
31964003782	Effector domain of response regulator. Bacteria and certain eukaryotes like protozoa and higher plants use two-component signal transduction systems to detect and respond to changes in the environment. The system consists of a sensor histidine kinase and...; Region: trans_reg_C; cl17355
31964003783	HMMPfam hit to PF00072, Response regulator receiver, score 9.9e-32
31964003784	2 probable transmembrane helices predicted for CMS0821 by TMHMM2.0 at aa 13-35 and 392-414
31964003785	PS00343 Gram-positive cocci surface proteins 'anchoring' hexapeptide.
31964003786	Predicted dehydrogenases and related proteins [General function prediction only]; Region: MviM; COG0673
31964003787	Oxidoreductase family, NAD-binding Rossmann fold; Region: GFO_IDH_MocA; pfam01408
31964003788	Oxidoreductase family, C-terminal alpha/beta domain; Region: GFO_IDH_MocA_C; pfam02894
31964003789	HMMPfam hit to PF01408, Oxidoreductase, N-terminal,score 1.4e-35
31964003790	HMMPfam hit to PF02894, Oxidoreductase, C-terminal,score 5.2e-09
31964003791	5 probable transmembrane helices predicted for CMS0823 by TMHMM2.0 at aa 12-29, 33-55, 60-82, 141-163 and 176-198
31964003792	Reeler-like domain of YcnI and similar proteins; Region: YcnI_like; cd08545
31964003793	2 probable transmembrane helices predicted for CMS0824 by TMHMM2.0 at aa 12-34 and 198-220
31964003794	Uncharacterized iron-regulated membrane protein [Function unknown]; Region: PiuB; COG3182
31964003795	PepSY-associated TM helix; Region: PepSY_TM_2; pfam13703
31964003796	5 probable transmembrane helices predicted for CMS0825 by TMHMM2.0 at aa 32-54, 174-196, 223-245, 392-414 and 435-457
31964003797	HMMPfam hit to PF03929, PepSY-associated TM helix,score 0.27
31964003798	PS00138 Serine proteases, subtilase family, serine active site.
31964003799	HMMPfam hit to PF03929, PepSY-associated TM helix,score 0.0067
31964003800	HMMPfam hit to PF03929, PepSY-associated TM helix,score 13
31964003801	PS00343 Gram-positive cocci surface proteins 'anchoring' hexapeptide.
31964003802	HMMPfam hit to PF03929, PepSY-associated TM helix,score 11
31964003803	Transcriptional regulators [Transcription]; Region: PurR; COG1609
31964003804	Helix-turn-helix (HTH) DNA binding domain of the LacI family of transcriptional regulators; Region: HTH_LacI; cd01392
31964003805	DNA binding site [nucleotide binding]
31964003806	domain linker motif; other site
31964003807	Ligand binding domain of the LacI tanscriptional regulator family belonging to the type I periplasmic-binding fold protein superfamily; Region: PBP1_LacI_sugar_binding_like; cd06267
31964003808	dimerization interface [polypeptide binding]; other site
31964003809	ligand binding site [chemical binding]; other site
31964003810	HMMPfam hit to PF00532, Periplasmic binding protein/LacI transcriptional regulator, score 0.00014
31964003811	PS00216 Sugar transport proteins signature 1.
31964003812	PS00356 Bacterial regulatory proteins, lacI family signature.
31964003813	6 probable transmembrane helices predicted for CMS0827 by TMHMM2.0 at aa 9-31, 51-73, 86-108, 123-142,151-173 and 201-223
31964003814	Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate...; Region: Glycosyltransferase_GTB_type; cl10013
31964003815	Glycosyltransferase [Cell envelope biogenesis, outer membrane]; Region: RfaG; COG0438
31964003816	HMMPfam hit to PF00534, Glycosyl transferase, group 1, score 3.5e-05
31964003817	YdcF-like. YdcF-like is a large family of mainly bacterial proteins, with a few members found in fungi, plants, and archaea. Escherichia coli YdcF has been shown to bind S-adenosyl-L-methionine (AdoMet), but a biochemical function has not been...; Region: YdcF-like; cl00630
31964003818	putative active site [active]
31964003819	HMMPfam hit to PF02698, Protein of unknown function DUF218, score 2.3e-05
31964003820	1 probable transmembrane helix predicted for CMS0829 by TMHMM2.0 at aa 7-29
31964003821	Domain of unknown function (DUF4287); Region: DUF4287; pfam14117
31964003822	CrcB-like protein; Region: CRCB; pfam02537
31964003823	4 probable transmembrane helices predicted for CMS0830 by TMHMM2.0 at aa 91-110, 120-142, 155-174 and 189-211
31964003824	HMMPfam hit to PF02537, Camphor resistance CrcB protein, score 4.1e-06
31964003825	CrcB-like protein; Region: CRCB; cl09114
31964003826	4 probable transmembrane helices predicted for CMS0831 by TMHMM2.0 at aa 5-24, 34-56, 63-85 and 100-122
31964003827	HMMPfam hit to PF02537, Camphor resistance CrcB protein, score 3.8e-28
31964003828	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cl17182
31964003829	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 8.4e-08
31964003830	ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate. Like other members of the Nudix hydrolase superfamily, it requires a divalent cation, such as Mg2+; Region: ADPRase_NUDT5; cd03424
31964003831	ADP-ribose binding site [chemical binding]; other site
31964003832	dimer interface [polypeptide binding]; other site
31964003833	active site
31964003834	nudix motif; other site
31964003835	metal binding site [ion binding]; metal-binding site
31964003836	HMMPfam hit to PF00293, NUDIX hydrolase, score 3.2e-16
31964003837	PS00893 mutT domain signature.
31964003838	D-alanine--D-alanine ligase; Reviewed; Region: ddl; PRK01372
31964003839	D-ala D-ala ligase N-terminus; Region: Dala_Dala_lig_N; pfam01820
31964003840	ATP-grasp domain; Region: ATP-grasp_4; cl17255
31964003841	HMMPfam hit to PF07478, D-alanine--D-alanine ligase, C-terminal, score 4.6e-55
31964003842	HMMPfam hit to PF01820, D-alanine--D-alanine ligase, N-terminal, score 3.6e-28
31964003843	PS00843 D-alanine--D-alanine ligase signature 1.
31964003844	1 probable transmembrane helix predicted for CMS0835 by TMHMM2.0 at aa 13-35
31964003845	RibD C-terminal domain; Region: RibD_C; cl17279
31964003846	HMMPfam hit to PF01872, Bacterial bifunctional deaminase-reductase, C-terminal, score 9e-12
31964003847	Bacterial extracellular solute-binding protein; Region: SBP_bac_8; pfam13416
31964003848	Bacterial extracellular solute-binding protein; Region: SBP_bac_1; pfam01547
31964003849	HMMPfam hit to PF01547, Bacterial extracellular solute-binding protein, family 1, score 4.9e-26
31964003850	PS00017 ATP/GTP-binding site motif A (P-loop).
31964003851	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964003852	dimer interface [polypeptide binding]; other site
31964003853	conserved gate region; other site
31964003854	putative PBP binding loops; other site
31964003855	ABC-ATPase subunit interface; other site
31964003856	6 probable transmembrane helices predicted for CMS0838 by TMHMM2.0 at aa 17-39, 83-105, 112-134, 159-181,225-247 and 273-295
31964003857	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 3.5e-07
31964003858	ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism]; Region: UgpE; COG0395
31964003859	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964003860	dimer interface [polypeptide binding]; other site
31964003861	conserved gate region; other site
31964003862	ABC-ATPase subunit interface; other site
31964003863	6 probable transmembrane helices predicted for CMS0839 by TMHMM2.0 at aa 30-52, 92-114, 123-145, 160-182,203-225 and 260-279
31964003864	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 1.2e-12
31964003865	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964003866	Type 1 glutamine amidotransferase (GATase1)-like domain; Region: GAT_1; cl00020
31964003867	conserved cys residue [active]
31964003868	HMMPfam hit to PF06283, Protein of unknown function DUF1037, score 1.6e-100
31964003869	Predicted dehydrogenases and related proteins [General function prediction only]; Region: MviM; COG0673
31964003870	Oxidoreductase family, NAD-binding Rossmann fold; Region: GFO_IDH_MocA; pfam01408
31964003871	HMMPfam hit to PF01408, Oxidoreductase, N-terminal,score 1.9e-23
31964003872	HMMPfam hit to PF02894, Oxidoreductase, C-terminal,score 1.5e-05
31964003873	Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism]; Region: NagC; COG1940
31964003874	Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily; Region: NBD_sugar-kinase_HSP70_actin; cl17037
31964003875	Predicted helix-turn-helix motif with score 1222.000, SD 3.35 at aa 74-95, sequence ASRSELTRETGLNRSTIAALVG
31964003876	HMMPfam hit to PF00480, ROK, score 4.4e-25
31964003877	Predicted phosphatase/phosphohexomutase [General function prediction only]; Region: COG0637
31964003878	Haloacid dehalogenase-like hydrolases. The haloacid dehalogenase-like (HAD) superfamily includes L-2-haloacid dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, and many others; Region: HAD_like; cd01427
31964003879	motif II; other site
31964003880	HMMPfam hit to PF00702, Haloacid dehalogenase-like hydrolase, score 4.4e-26
31964003881	7 probable transmembrane helices predicted for CMS0844 by TMHMM2.0 at aa 43-65, 77-99, 126-148, 155-174,189-211, 218-240 and 270-292
31964003882	Chorismate mutase type II; Region: CM_2; cl00693
31964003883	1 probable transmembrane helix predicted for CMS0845 by TMHMM2.0 at aa 5-24
31964003884	HMMPfam hit to PF01817, Chorismate mutase, score 7.5e-05
31964003885	hypothetical protein; Provisional; Region: PRK02237
31964003886	HMMPfam hit to PF02694, Protein of unknown function UPF0060, score 1.7e-59
31964003887	4 probable transmembrane helices predicted for CMS0846 by TMHMM2.0 at aa 5-27, 32-54, 61-80 and 90-107
31964003888	AAA domain; Region: AAA_17; pfam13207
31964003889	PS00017 ATP/GTP-binding site motif A (P-loop).
31964003890	10 probable transmembrane helices predicted for CMS0851 by TMHMM2.0 at aa 5-27, 37-59, 66-88, 92-114,121-140, 144-166, 175-197, 207-229, 236-258 and 262-281
31964003891	Transcriptional regulator [Transcription]; Region: AcrR; COG1309
31964003892	Bacterial regulatory proteins, tetR family; Region: TetR_N; pfam00440
31964003893	Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases [Nucleotide transport and metabolism / Carbohydrate transport and metabolism / General function prediction only]; Region: Hit; COG0537
31964003894	nucleotide binding site/active site [active]
31964003895	HIT family signature motif; other site
31964003896	catalytic residue [active]
31964003897	HMMPfam hit to PF01230, Histidine triad (HIT) protein, score 9.5e-09
31964003898	Pleckstrin homology (PH)-like domains in bacteria (PHb); Region: PH-like_bacteria; cd13225
31964003899	pentamer interface [polypeptide binding]; other site
31964003900	dodecaamer interface [polypeptide binding]; other site
31964003901	YceI-like domain; Region: YceI; pfam04264
31964003902	HTH domain; Region: HTH_11; pfam08279
31964003903	WYL domain; Region: WYL; pfam13280
31964003904	Predicted helix-turn-helix motif with score 1198.000, SD 3.27 at aa 21-42, sequence WNAEQLAAELRVTDRTIRRDVG
31964003905	PS00894 Bacterial regulatory proteins, deoR family signature.
31964003906	Prostaglandin dehydrogenases; Region: PGDH; cd05288
31964003907	Putative NADP-dependent oxidoreductases [General function prediction only]; Region: COG2130
31964003908	NAD(P) binding site [chemical binding]; other site
31964003909	substrate binding site [chemical binding]; other site
31964003910	dimer interface [polypeptide binding]; other site
31964003911	HMMPfam hit to PF00107, Zinc-containing alcohol dehydrogenase superfamily, score 2e-17
31964003912	RNA polymerase sigma factor SigL; Provisional; Region: PRK09645
31964003913	Sigma-70 region 2; Region: Sigma70_r2; pfam04542
31964003914	Sigma-70, region 4; Region: Sigma70_r4_2; pfam08281
31964003915	DNA binding residues [nucleotide binding]
31964003916	HMMPfam hit to PF04542, Sigma-70 region 2, score 1.2e-19
31964003917	HMMPfam hit to PF04545, Sigma-70 region 4, score 4.3e-12
31964003918	Predicted helix-turn-helix motif with score 1287.000, SD 3.57 at aa 130-151, sequence RSVAETAEREGVPPGTIKSRLH
31964003919	Putative zinc-finger; Region: zf-HC2; pfam13490
31964003920	1 probable transmembrane helix predicted for CMS0859 by TMHMM2.0 at aa 112-134
31964003921	Predicted transcriptional regulators [Transcription]; Region: HipB; COG1396
31964003922	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
31964003923	non-specific DNA binding site [nucleotide binding]; other site
31964003924	salt bridge; other site
31964003925	sequence-specific DNA binding site [nucleotide binding]; other site
31964003926	HMMPfam hit to PF01381, Helix-turn-helix motif,score 1.1e-12
31964003927	Predicted helix-turn-helix motif with score 1362.000, SD 3.83 at aa 16-37, sequence YTQRQLSGRSGVAQSTLSELES
31964003928	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
31964003929	H+ Antiporter protein; Region: 2A0121; TIGR00900
31964003930	putative substrate translocation pore; other site
31964003931	HMMPfam hit to PF05977, Bacterial protein of unknown function DUF894, score 4.4e-05
31964003932	12 probable transmembrane helices predicted for CMS0862 by TMHMM2.0 at aa 26-48, 58-80, 87-106, 111-128,161-183, 187-209, 230-252, 267-289, 296-315, 319-341,354-376 and 386-408
31964003933	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964003934	1 probable transmembrane helix predicted for CMS0863 by TMHMM2.0 at aa 7-29
31964003935	HMMPfam hit to PF00149, Metallophosphoesterase,score 6.8e-13
31964003936	Tetratrico peptide repeat; Region: TPR_5; pfam12688
31964003937	Transcriptional regulators [Transcription]; Region: PurR; COG1609
31964003938	Helix-turn-helix (HTH) DNA binding domain of the LacI family of transcriptional regulators; Region: HTH_LacI; cd01392
31964003939	DNA binding site [nucleotide binding]
31964003940	domain linker motif; other site
31964003941	Ligand-binding domain of a LacI-like transcriptional regulator, CatR which is involved in catechol degradation; Region: PBP1_CatR_like; cd06296
31964003942	putative dimerization interface [polypeptide binding]; other site
31964003943	putative ligand binding site [chemical binding]; other site
31964003944	HMMPfam hit to PF00532, Periplasmic binding protein/LacI transcriptional regulator, score 9.5e-15
31964003945	HMMPfam hit to PF00356, Bacterial regulatory protein, LacI, score 3.8e-09
31964003946	Predicted helix-turn-helix motif with score 1875.000, SD 5.57 at aa 8-29, sequence PTIHDVAAAAGVSVSTVSKAVN
31964003947	PS00356 Bacterial regulatory proteins, lacI family signature.
31964003948	ABC-type sugar transport system, periplasmic component [Carbohydrate transport and metabolism]; Region: UgpB; COG1653
31964003949	Bacterial extracellular solute-binding protein; Region: SBP_bac_1; pfam01547
31964003950	HMMPfam hit to PF01547, Bacterial extracellular solute-binding protein, family 1, score 3.7e-11
31964003951	ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism]; Region: PotC; COG1177
31964003952	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964003953	dimer interface [polypeptide binding]; other site
31964003954	conserved gate region; other site
31964003955	putative PBP binding loops; other site
31964003956	ABC-ATPase subunit interface; other site
31964003957	7 probable transmembrane helices predicted for CMS0869 by TMHMM2.0 at aa 2-22, 42-61, 73-95, 122-144,174-196, 201-223 and 230-252
31964003958	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 0.00033
31964003959	ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism]; Region: UgpE; COG0395
31964003960	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964003961	dimer interface [polypeptide binding]; other site
31964003962	conserved gate region; other site
31964003963	putative PBP binding loops; other site
31964003964	ABC-ATPase subunit interface; other site
31964003965	6 probable transmembrane helices predicted for CMS0870 by TMHMM2.0 at aa 36-58, 99-121, 133-155, 165-187,208-230 and 269-287
31964003966	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 1.7e-12
31964003967	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964003968	beta-D-glucoside glucohydrolase; Provisional; Region: PRK15098
31964003969	Glycosyl hydrolase family 3 N terminal domain; Region: Glyco_hydro_3; pfam00933
31964003970	Fibronectin type III-like domain; Region: Fn3-like; pfam14310
31964003971	HMMPfam hit to PF00933, Glycoside hydrolase, family 3, N-terminal, score 9.1e-68
31964003972	HMMPfam hit to PF01915, Glycoside hydrolase, family 3, C-terminal, score 1.5e-77
31964003973	Helix-turn-helix domain; Region: HTH_31; pfam13560
31964003974	sequence-specific DNA binding site [nucleotide binding]; other site
31964003975	salt bridge; other site
31964003976	HMMPfam hit to PF01381, Helix-turn-helix motif,score 6.8e-08
31964003977	Predicted helix-turn-helix motif with score 1410.000, SD 3.99 at aa 33-54, sequence LRREELAALAGVSVDYVVRLEQ
31964003978	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
31964003979	Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only]; Region: FabG; COG1028
31964003980	NAD(P) binding site [chemical binding]; other site
31964003981	active site
31964003982	PS00038 Myc-type, 'helix-loop-helix' dimerization domain signature.
31964003983	Acetyltransferase (GNAT) domain; Region: Acetyltransf_3; pfam13302
31964003984	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cl17182
31964003985	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 0.0042
31964003986	2 probable transmembrane helices predicted for CMS0877 by TMHMM2.0 at aa 7-29 and 49-71
31964003987	Beta-lactamase; Region: Beta-lactamase; pfam00144
31964003988	Beta-lactamase class C and other penicillin binding proteins [Defense mechanisms]; Region: AmpC; COG1680
31964003989	HMMPfam hit to PF00144, Beta-lactamase, score 5.9e-15
31964003990	PS00017 ATP/GTP-binding site motif A (P-loop).
31964003991	Alpha-L-arabinofuranosidase [Carbohydrate transport and metabolism]; Region: AbfA; COG3534
31964003992	Alpha-L-arabinofuranosidase C-terminus; Region: Alpha-L-AF_C; pfam06964
31964003993	HMMPfam hit to PF06964,Alpha-L-arabinofuranosidase, C-terminal, score 6.5e-73
31964003994	Lsr2; Region: Lsr2; pfam11774
31964003995	PS00178 Aminoacyl-transfer RNA synthetases class-I signature.
31964003996	Cobalamin synthesis protein cobW C-terminal domain; Region: CobW_C; smart00833
31964003997	HMMPfam hit to PF07683, Cobalamin synthesis protein cobW C-terminal domain, score 1.5e-10
31964003998	Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones]; Region: TrxB; COG0492
31964003999	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
31964004000	ATPases associated with a variety of cellular activities; Region: AAA; smart00382
31964004001	Walker A motif; other site
31964004002	ATP binding site [chemical binding]; other site
31964004003	Walker B motif; other site
31964004004	arginine finger; other site
31964004005	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
31964004006	ATPases associated with a variety of cellular activities; Region: AAA; smart00382
31964004007	Walker A motif; other site
31964004008	ATP binding site [chemical binding]; other site
31964004009	Walker B motif; other site
31964004010	arginine finger; other site
31964004011	C-terminal, D2-small domain, of ClpB protein; Region: ClpB_D2-small; pfam10431
31964004012	HMMPfam hit to PF00004, AAA ATPase, central region,score 1.1e-11
31964004013	PS00017 ATP/GTP-binding site motif A (P-loop).
31964004014	HMMPfam hit to PF07724, ATPase family associated with various cellular activities (AAA), score 3.2e-106
31964004015	HMMPfam hit to PF00004, AAA ATPase, central region,score 9.3e-05
31964004016	PS00017 ATP/GTP-binding site motif A (P-loop).
31964004017	cell division ATP-binding protein FtsE; Region: FtsE; TIGR02673
31964004018	ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A; Region: ABC_DR_subfamily_A; cd03230
31964004019	Walker A/P-loop; other site
31964004020	ATP binding site [chemical binding]; other site
31964004021	Q-loop/lid; other site
31964004022	ABC transporter signature motif; other site
31964004023	Walker B; other site
31964004024	D-loop; other site
31964004025	H-loop/switch region; other site
31964004026	HMMPfam hit to PF00005, ABC transporter, score 1.1e-47
31964004027	PS00017 ATP/GTP-binding site motif A (P-loop).
31964004028	6 probable transmembrane helices predicted for CMS0887 by TMHMM2.0 at aa 5-23, 43-62, 99-121, 136-158,165-187 and 202-224
31964004029	5 probable transmembrane helices predicted for tmhmm2embl_unknown_000002_929788_930456 by TMHMM2.0 at aa 15-37, 61-83, 103-125, 138-160 and 180-202
31964004030	6 probable transmembrane helices predicted for CMS0889 by TMHMM2.0 at aa 12-29, 44-66, 90-112, 165-187,192-214 and 234-256
31964004031	Alpha-galactosidase [Carbohydrate transport and metabolism]; Region: GalA; COG3345
31964004032	Melibiase; Region: Melibiase; pfam02065
31964004033	HMMPfam hit to PF02065, Glycoside hydrolase, clan GH-D, score 1.2e-149
31964004034	PS00512 Alpha-galactosidase signature.
31964004035	Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols. AKRs are present in all phyla and are of importance to both health and industrial...; Region: Aldo_ket_red; cd06660
31964004036	Aldo/keto reductase family; Region: Aldo_ket_red; pfam00248
31964004037	active site
31964004038	catalytic tetrad [active]
31964004039	HMMPfam hit to PF00248, Aldo/keto reductase, score 9.7e-71
31964004040	renal dipeptidase (rDP), best studied in mammals and also called membrane or microsomal dipeptidase, is a membrane-bound glycoprotein hydrolyzing dipeptides and is involved in hydrolytic metabolism of penem and carbapenem beta-lactam antibiotics; Region: rDP_like; cd01301
31964004041	active site
31964004042	Zn-dependent dipeptidase, microsomal dipeptidase homolog [Amino acid transport and metabolism]; Region: COG2355
31964004043	dimer interface [polypeptide binding]; other site
31964004044	HMMPfam hit to PF01244, Peptidase M19, renal dipeptidase, score 8.5e-124
31964004045	Acetyltransferase (GNAT) family; Region: Acetyltransf_1; pfam00583
31964004046	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 4.9e-14
31964004047	Predicted membrane protein (DUF2207); Region: DUF2207; pfam09972
31964004048	Predicted membrane protein (DUF2207); Region: DUF2207; pfam09972
31964004049	4 probable transmembrane helices predicted for CMS0896 by TMHMM2.0 at aa 17-39, 251-273, 406-428 and 438-460
31964004050	Beta-lactamase enzyme family; Region: Beta-lactamase2; pfam13354
31964004051	BacA is a bacterial lysin from Enterococcus faecalis that degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. BacA is homologous to the YbfG and YkuG lysins of...; Region: GH25_BacA-like; cd06418
31964004052	active site
31964004053	HMMPfam hit to PF07332, Protein of unknown function DUF1469, score 2.5e-05
31964004054	2 probable transmembrane helices predicted for CMS0900 by TMHMM2.0 at aa 24-46 and 50-72
31964004055	2 probable transmembrane helices predicted for CMS0901 by TMHMM2.0 at aa 7-29 and 60-82
31964004056	2 probable transmembrane helices predicted for CMS0902 by TMHMM2.0 at aa 7-29 and 60-82
31964004057	1 probable transmembrane helix predicted for CMS0904 by TMHMM2.0 at aa 10-32
31964004058	Asp23 family; Region: Asp23; pfam03780
31964004059	helix_turn_helix, arabinose operon control protein; Region: HTH_ARAC; smart00342
31964004060	HMMPfam hit to PF00165, Helix-turn-helix, AraC type, score 0.0055
31964004061	PS00041 Bacterial regulatory proteins, araC family signature.
31964004062	HMMPfam hit to PF00165, Helix-turn-helix, AraC type, score 6.8e-05
31964004063	Predicted helix-turn-helix motif with score 1068.000, SD 2.82 at aa 306-327, sequence ITPADAARAAGISTRVLQLAVR
31964004064	Ferritin-like domain; Region: Ferritin_2; pfam13668
31964004065	1 probable transmembrane helix predicted for CMS0907 by TMHMM2.0 at aa 24-46
31964004066	Homeodomain-like domain; Region: HTH_23; cl17451
31964004067	Winged helix-turn helix; Region: HTH_29; pfam13551
31964004068	Integrase core domain; Region: rve; pfam00665
31964004069	Integrase core domain; Region: rve_3; pfam13683
31964004070	Predicted helix-turn-helix motif with score 1316.000, SD 3.67 at aa 25-46, sequence WPVRRAAERFQCSPATASRWAR
31964004071	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.4e-41
31964004072	4 probable transmembrane helices predicted for CMS0909 by TMHMM2.0 at aa 13-35, 55-74, 95-112 and 145-162
31964004073	4 probable transmembrane helices predicted for CMS0910 by TMHMM2.0 at aa 7-26, 36-53, 60-82 and 92-114
31964004074	Transcriptional regulators [Transcription]; Region: PhnF; COG2188
31964004075	Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators; Region: WHTH_GntR; cd07377
31964004076	DNA-binding site [nucleotide binding]; DNA binding site
31964004077	The UbiC transcription regulator-associated (UTRA) domain is a conserved ligand-binding domain; Region: UTRA; smart00866
31964004078	HMMPfam hit to PF07702, UbiC transcription regulator-associated, score 2.2e-44
31964004079	HMMPfam hit to PF00392, Bacterial regulatory protein, GntR, score 3.1e-16
31964004080	Predicted helix-turn-helix motif with score 1379.000, SD 3.88 at aa 45-66, sequence PSERELAMTHDVSRATVRQAIR
31964004081	PTS_IIA, PTS system, glucose/sucrose specific IIA subunit. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. This family...; Region: PTS_IIA_glc; cl00162
31964004082	HPr interaction site; other site
31964004083	glycerol kinase (GK) interaction site [polypeptide binding]; other site
31964004084	active site
31964004085	phosphorylation site [posttranslational modification]
31964004086	HMMPfam hit to PF00358, Sugar-specific permease,EIIA 1 domain, score 1.5e-24
31964004087	PS00371 PTS EIIA domains phosphorylation site signature 1.
31964004088	Phosphotransferase system IIC components, glucose/maltose/N-acetylglucosamine-specific [Carbohydrate transport and metabolism]; Region: PtsG; COG1263
31964004089	6-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminase [Carbohydrate transport and metabolism]; Region: NagB; COG0363
31964004090	GlcN6P_deaminase: Glucosamine-6-phosphate (GlcN6P) deaminase subfamily; GlcN6P deaminase catalyzes the reversible conversion of GlcN6P to D-fructose-6-phosphate (Fru6P) and ammonium. The reaction is an aldo-keto isomerization coupled with an amination or...; Region: GlcN6P_deaminase; cd01399
31964004091	active site
31964004092	trimer interface [polypeptide binding]; other site
31964004093	allosteric site; other site
31964004094	active site lid [active]
31964004095	HMMPfam hit to PF02378, Phosphotransferase system,EIIC, score 2.3e-39
31964004096	8 probable transmembrane helices predicted for CMS0913 by TMHMM2.0 at aa 17-39, 49-68, 89-111, 115-137,184-206, 216-233, 240-262 and 293-315
31964004097	HMMPfam hit to PF01182,Glucosamine/galactosamine-6-phosphate isomerase, score 9.6e-63
31964004098	PS01161 Glucosamine/galactosamine-6-phosphate isomerases signature.
31964004099	N-terminal catalytic domain of endoplasmic reticulum(ER)/cytosolic class II alpha-mannosidases; glycoside hydrolase family 38 (GH38); Region: GH38N_AMII_ER_cytosolic; cd10789
31964004100	active site
31964004101	catalytic site [active]
31964004102	Alpha mannosidase, middle domain; Region: Alpha-mann_mid; pfam09261
31964004103	Glycosyl hydrolases family 38 C-terminal domain; Region: Glyco_hydro_38C; pfam07748
31964004104	HMMPfam hit to PF07748, Glycosyl hydrolases family 38 C-terminal domain, score 1.5e-94
31964004105	HMMPfam hit to PF01074, Glycoside hydrolase, family 38, score 3.1e-130
31964004106	Glycoside Hydrolases Family 4; Phospho-beta-glucosidase; Region: GH4_P_beta_glucosidase; cd05296
31964004107	NAD binding site [chemical binding]; other site
31964004108	sugar binding site [chemical binding]; other site
31964004109	divalent metal binding site [ion binding]; other site
31964004110	tetramer (dimer of dimers) interface [polypeptide binding]; other site
31964004111	dimer interface [polypeptide binding]; other site
31964004112	HMMPfam hit to PF02056, Glycoside hydrolase, family 4, score 1.6e-60
31964004113	PS01324 Glycosyl hydrolases family 4 signature.
31964004114	Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism]; Region: GlpR; COG1349
31964004115	DeoR-like helix-turn-helix domain; Region: HTH_DeoR; pfam08220
31964004116	DeoR C terminal sensor domain; Region: DeoRC; pfam00455
31964004117	HMMPfam hit to PF00455, Bacterial regulatory protein, DeoR, score 4e-60
31964004118	Predicted helix-turn-helix motif with score 1398.000, SD 3.95 at aa 12-33, sequence ATVAELAEAAGTSDATIRRDLA
31964004119	Sugar kinases, ribokinase family [Carbohydrate transport and metabolism]; Region: RbsK; COG0524
31964004120	ribokinase/pfkB superfamily: Kinases that accept a wide variety of substrates, including carbohydrates and aromatic small molecules, all are phosphorylated at a hydroxyl group. The superfamily includes ribokinase, fructokinase, ketohexokinase; Region: ribokinase_pfkB_like; cl00192
31964004121	substrate binding site [chemical binding]; other site
31964004122	ATP binding site [chemical binding]; other site
31964004123	PS00430 TonB-dependent receptor proteins signature 1.
31964004124	HMMPfam hit to PF00294, Carbohydrate kinase, PfkB,score 8.9e-24
31964004125	Bacterial extracellular solute-binding protein; Region: SBP_bac_8; pfam13416
31964004126	HMMPfam hit to PF01547, Bacterial extracellular solute-binding protein, family 1, score 2.1e-14
31964004127	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964004128	ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism]; Region: PotC; COG1177
31964004129	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964004130	putative PBP binding loops; other site
31964004131	dimer interface [polypeptide binding]; other site
31964004132	ABC-ATPase subunit interface; other site
31964004133	6 probable transmembrane helices predicted for CMS0921 by TMHMM2.0 at aa 41-63, 103-125, 137-159,184-206, 237-259 and 300-322
31964004134	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 6.6e-15
31964004135	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964004136	ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism]; Region: UgpE; COG0395
31964004137	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964004138	dimer interface [polypeptide binding]; other site
31964004139	conserved gate region; other site
31964004140	putative PBP binding loops; other site
31964004141	ABC-ATPase subunit interface; other site
31964004142	6 probable transmembrane helices predicted for CMS0922 by TMHMM2.0 at aa 2-24, 63-85, 98-120, 125-147,174-196 and 231-253
31964004143	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 7.6e-13
31964004144	GlcN6P_deaminase: Glucosamine-6-phosphate (GlcN6P) deaminase subfamily; GlcN6P deaminase catalyzes the reversible conversion of GlcN6P to D-fructose-6-phosphate (Fru6P) and ammonium. The reaction is an aldo-keto isomerization coupled with an amination or...; Region: GlcN6P_deaminase; cd01399
31964004145	active site
31964004146	trimer interface [polypeptide binding]; other site
31964004147	allosteric site; other site
31964004148	active site lid [active]
31964004149	hexamer (dimer of trimers) interface [polypeptide binding]; other site
31964004150	HMMPfam hit to PF01182,Glucosamine/galactosamine-6-phosphate isomerase, score 2.8e-44
31964004151	cryptic beta-D-galactosidase subunit alpha; Reviewed; Region: ebgA; PRK10340
31964004152	Glycosyl hydrolases family 2, sugar binding domain; Region: Glyco_hydro_2_N; pfam02837
31964004153	Glycosyl hydrolases family 2; Region: Glyco_hydro_2; pfam00703
31964004154	Glycosyl hydrolases family 2, TIM barrel domain; Region: Glyco_hydro_2_C; pfam02836
31964004155	Beta galactosidase small chain; Region: Bgal_small_N; cl03787
31964004156	HMMPfam hit to PF02837, Glycoside hydrolase, family 2, sugar binding, score 1.7e-58
31964004157	HMMPfam hit to PF00703, Glycoside hydrolase family 2, immunoglobulin-like beta-sandwich domain, score 0.021
31964004158	HMMPfam hit to PF02836, Glycoside hydrolase, family 2, TIM barrel domain, score 7.9e-126
31964004159	PS00719 Glycosyl hydrolases family 2 signature 1.
31964004160	PS00608 Glycosyl hydrolases family 2 acid/base catalyst.
31964004161	HMMPfam hit to PF02929, Glycoside hydrolase, family 42, small chain, N-terminal, score 3.3e-07
31964004162	HMMPfam hit to PF02930, Glycoside hydrolase, family 42, small chain, C-terminal, score 5.8e-13
31964004163	4-hydroxybenzoyl-CoA thioesterase (4HBT). Catalyzes the final step in the 4-chlorobenzoate degradation pathway in which 4-chlorobenzoate is converted to 4-hydroxybenzoate in certain soil-dwelling bacteria. 4HBT forms a homotetramer with four active sites; Region: 4HBT; cd00586
31964004164	active site
31964004165	HMMPfam hit to PF03061, Thioesterase superfamily,score 2.7e-10
31964004166	Predicted flavoprotein [General function prediction only]; Region: COG0431
31964004167	NADPH-dependent FMN reductase; Region: FMN_red; pfam03358
31964004168	HMMPfam hit to PF03358, NADPH-dependent FMN reductase, score 4.7e-25
31964004169	2 probable transmembrane helices predicted for CMS0927 by TMHMM2.0 at aa 26-45 and 49-71
31964004170	Helical backbone metal receptor (TroA-like domain). These proteins have been shown to function in the ABC transport of ferric siderophores and metal ions such as Mn2+, Fe3+, Cu2+ and/or Zn2+.  Their ligand binding site is formed in the interface between...; Region: TroA-like; cl00262
31964004171	proposed F420-0 ABC transporter, periplasmic F420-0 binding protein; Region: F420-O_ABCperi; TIGR03868
31964004172	intersubunit interface [polypeptide binding]; other site
31964004173	HMMPfam hit to PF01497, Periplasmic binding protein, score 1.9e-05
31964004174	iron-hydroxamate transporter permease subunit; Provisional; Region: PRK10577
31964004175	Transmembrane subunit (TM), of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters involved in the uptake of siderophores, heme, vitamin B12, or the divalent cations Mg2+ and Zn2+. PBP-dependent ABC transporters consist of...; Region: TM_ABC_iron-siderophores_like; cd06550
31964004176	ABC-ATPase subunit  interface; other site
31964004177	dimer interface [polypeptide binding]; other site
31964004178	putative PBP binding regions; other site
31964004179	8 probable transmembrane helices predicted for CMS0929 by TMHMM2.0 at aa 7-29, 70-92, 99-118, 123-145,157-179, 251-273, 286-303 and 313-335
31964004180	HMMPfam hit to PF01032, Bacterial transport system permease protein, score 7.2e-80
31964004181	ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]; Region: FepC; COG1120
31964004182	ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins; Region: ABC_Iron-Siderophores_B12_Hemin; cd03214
31964004183	Walker A/P-loop; other site
31964004184	ATP binding site [chemical binding]; other site
31964004185	Q-loop/lid; other site
31964004186	ABC transporter signature motif; other site
31964004187	Walker B; other site
31964004188	D-loop; other site
31964004189	H-loop/switch region; other site
31964004190	HMMPfam hit to PF00005, ABC transporter, score 5.8e-53
31964004191	PS00017 ATP/GTP-binding site motif A (P-loop).
31964004192	Homeodomain-like domain; Region: HTH_23; cl17451
31964004193	Winged helix-turn helix; Region: HTH_29; pfam13551
31964004194	Integrase core domain; Region: rve; pfam00665
31964004195	Integrase core domain; Region: rve_3; pfam13683
31964004196	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964004197	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964004198	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964004199	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.6e-38
31964004200	GDP-mannose pyrophosphatase NudK; Provisional; Region: PRK15009
31964004201	ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate. Like other members of the Nudix hydrolase superfamily, it requires a divalent cation, such as Mg2+; Region: ADPRase_NUDT5; cd03424
31964004202	dimer interface [polypeptide binding]; other site
31964004203	ADP-ribose binding site [chemical binding]; other site
31964004204	active site
31964004205	nudix motif; other site
31964004206	metal binding site [ion binding]; metal-binding site
31964004207	HMMPfam hit to PF00293, NUDIX hydrolase, score 5.6e-20
31964004208	PS00017 ATP/GTP-binding site motif A (P-loop).
31964004209	Transcriptional regulators [Transcription]; Region: PurR; COG1609
31964004210	Helix-turn-helix (HTH) DNA binding domain of the LacI family of transcriptional regulators; Region: HTH_LacI; cd01392
31964004211	DNA binding site [nucleotide binding]
31964004212	domain linker motif; other site
31964004213	Ligand-binding domain of DNA-binding regulatory proteins specific to sucrose that are members of the LacI-GalR family of bacterial transcription repressors; Region: PBP1_sucrose_transcription_regulator; cd06288
31964004214	putative dimerization interface [polypeptide binding]; other site
31964004215	putative ligand binding site [chemical binding]; other site
31964004216	HMMPfam hit to PF00356, Bacterial regulatory protein, LacI, score 4.4e-07
31964004217	Predicted helix-turn-helix motif with score 1576.000, SD 4.55 at aa 29-50, sequence VGIRDVAEAAGVSLTTVSHSLS
31964004218	HMMPfam hit to PF00532, Periplasmic binding protein/LacI transcriptional regulator, score 1.2e-29
31964004219	Homeodomain-like domain; Region: HTH_23; cl17451
31964004220	Integrase core domain; Region: rve; pfam00665
31964004221	Integrase core domain; Region: rve_3; pfam13683
31964004222	HMMPfam hit to PF00665, Integrase, catalytic region, score 1e-41
31964004223	Predicted helix-turn-helix motif with score 1316.000, SD 3.67 at aa 25-46, sequence WPVRRAAERFQCSPATASRWAR
31964004224	ABC-type sugar transport system, periplasmic component [Carbohydrate transport and metabolism]; Region: UgpB; COG1653
31964004225	Bacterial extracellular solute-binding protein; Region: SBP_bac_1; pfam01547
31964004226	HMMPfam hit to PF01547, Bacterial extracellular solute-binding protein, family 1, score 3.5e-17
31964004227	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964004228	putative PBP binding loops; other site
31964004229	dimer interface [polypeptide binding]; other site
31964004230	ABC-ATPase subunit interface; other site
31964004231	6 probable transmembrane helices predicted for CMS0936 by TMHMM2.0 at aa 61-83, 119-141, 154-173,204-226, 258-280 and 311-333
31964004232	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 9.1e-07
31964004233	ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism]; Region: UgpE; COG0395
31964004234	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964004235	dimer interface [polypeptide binding]; other site
31964004236	conserved gate region; other site
31964004237	putative PBP binding loops; other site
31964004238	ABC-ATPase subunit interface; other site
31964004239	7 probable transmembrane helices predicted for CMS0937 by TMHMM2.0 at aa 4-21, 28-50, 65-87, 96-118,138-160, 189-211 and 241-263
31964004240	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 1.2e-13
31964004241	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964004242	Glycosyl hydrolase families 32 and 68, which for the clan GH-J; Region: GH_J; cd08979
31964004243	active site
31964004244	Beta-fructosidases (levanase/invertase) [Carbohydrate transport and metabolism]; Region: SacC; COG1621
31964004245	Glycosyl hydrolase family 32, beta-fructosidases; Region: GH32_B_Fructosidase; cd08996
31964004246	substrate binding [chemical binding]; other site
31964004247	active site
31964004248	Glycosyl hydrolases family 32 C terminal; Region: Glyco_hydro_32C; pfam08244
31964004249	HMMPfam hit to PF00251, Glycoside hydrolase, family 32, score 1.5e-20
31964004250	Asp23 family; Region: Asp23; pfam03780
31964004251	HMMPfam hit to PF03780, Protein of unknown function DUF322, score 2.4e-11
31964004252	Major intrinsic protein (MIP) superfamily. Members of the MIP superfamily function as membrane channels that selectively transport water, small neutral molecules, and ions out of and between cells. The channel proteins share a common fold: the N-terminal...; Region: MIP; cl00200
31964004253	amphipathic channel; other site
31964004254	Asn-Pro-Ala signature motifs; other site
31964004255	HMMPfam hit to PF00230, Major intrinsic protein,score 7.7e-39
31964004256	6 probable transmembrane helices predicted for CMS0941 by TMHMM2.0 at aa 36-58, 73-95, 116-138, 167-189,196-218 and 238-260
31964004257	PS00221 MIP family signature.
31964004258	Asp23 family; Region: Asp23; pfam03780
31964004259	HMMPfam hit to PF02987, Late embryogenesis abundant protein, score 2.3e-07
31964004260	HMMPfam hit to PF02987, Late embryogenesis abundant protein, score 0.083
31964004261	1 probable transmembrane helix predicted for CMS0944 by TMHMM2.0 at aa 20-39
31964004262	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964004263	Protein of unknown function (DUF805); Region: DUF805; pfam05656
31964004264	HMMPfam hit to PF05656, Protein of unknown function DUF805, score 8.2e-21
31964004265	3 probable transmembrane helices predicted for CMS0945 by TMHMM2.0 at aa 20-37, 57-79 and 92-111
31964004266	4 probable transmembrane helices predicted for CMS0946 by TMHMM2.0 at aa 19-41, 46-68, 97-119 and 129-151
31964004267	ABC-2 family transporter protein; Region: ABC2_membrane_3; pfam12698
31964004268	7 probable transmembrane helices predicted for CMS0947 by TMHMM2.0 at aa 35-57, 159-181, 212-234,244-266, 279-301, 306-328 and 335-357
31964004269	ABC-type uncharacterized transport system, ATPase component [General function prediction only]; Region: COG4152
31964004270	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
31964004271	Walker A/P-loop; other site
31964004272	ATP binding site [chemical binding]; other site
31964004273	Q-loop/lid; other site
31964004274	ABC transporter signature motif; other site
31964004275	Walker B; other site
31964004276	D-loop; other site
31964004277	H-loop/switch region; other site
31964004278	Domain of unknown function (DUF4162); Region: DUF4162; pfam13732
31964004279	HMMPfam hit to PF00005, ABC transporter, score 1e-49
31964004280	PS00211 ABC transporters family signature.
31964004281	PS00017 ATP/GTP-binding site motif A (P-loop).
31964004282	3 probable transmembrane helices predicted for CMS0949 by TMHMM2.0 at aa 15-37, 54-73 and 77-99
31964004283	SMP-30/Gluconolaconase/LRE-like region; Region: SGL; pfam08450
31964004284	HMMPfam hit to PF03758, Senescence marker protein-30 (SMP-30), score 3.1e-70
31964004285	3-ketoacyl-(acyl-carrier-protein) reductase; Validated; Region: fabG; PRK05653
31964004286	classical (c) SDRs; Region: SDR_c; cd05233
31964004287	NAD(P) binding site [chemical binding]; other site
31964004288	active site
31964004289	HMMPfam hit to PF00106, Short-chain dehydrogenase/reductase SDR, score 3.4e-75
31964004290	PS00061 Short-chain dehydrogenases/reductases family signature.
31964004291	classical (c) SDRs; Region: SDR_c; cd05233
31964004292	NAD(P) binding site [chemical binding]; other site
31964004293	active site
31964004294	HMMPfam hit to PF00106, Short-chain dehydrogenase/reductase SDR, score 1.3e-30
31964004295	sn-glycerol-3-phosphate transporter; Provisional; Region: glpT; PRK11273
31964004296	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
31964004297	putative substrate translocation pore; other site
31964004298	12 probable transmembrane helices predicted for CMS0954 by TMHMM2.0 at aa 43-62, 77-99, 112-134, 138-160,181-203, 207-226, 272-294, 309-331, 343-360, 370-392,405-427 and 432-454
31964004299	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964004300	PS00942 glpT family of transporters signature.
31964004301	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
31964004302	NAD(P) binding site [chemical binding]; other site
31964004303	active site
31964004304	Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription]; Region: CitB; COG2197
31964004305	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
31964004306	active site
31964004307	phosphorylation site [posttranslational modification]
31964004308	intermolecular recognition site; other site
31964004309	dimerization interface [polypeptide binding]; other site
31964004310	C-terminal DNA-binding domain of LuxR-like proteins. This domain contains a helix-turn-helix motif and binds DNA. Proteins belonging to this group are response regulators; some act as transcriptional activators, others as transcriptional repressors. Many...; Region: LuxR_C_like; cd06170
31964004311	DNA binding residues [nucleotide binding]
31964004312	dimerization interface [polypeptide binding]; other site
31964004313	HMMPfam hit to PF00196, Bacterial regulatory protein, LuxR, score 2.2e-24
31964004314	PS00622 Bacterial regulatory proteins, luxR family signature.
31964004315	HMMPfam hit to PF00072, Response regulator receiver, score 4.2e-33
31964004316	Signal transduction histidine kinase [Signal transduction mechanisms]; Region: COG4585
31964004317	Histidine kinase; Region: HisKA_3; pfam07730
31964004318	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; Region: HATPase_c; pfam02518
31964004319	HMMPfam hit to PF02518, ATP-binding region,ATPase-like, score 3.4e-14
31964004320	HMMPfam hit to PF07730, Histidine kinase
31964004321	6 probable transmembrane helices predicted for CMS0958 by TMHMM2.0 at aa 40-62, 67-85, 92-109, 113-130,137-156 and 181-203
31964004322	HMMPfam hit to PF01839, Integrins alpha chain,score 0.0041
31964004323	HMMPfam hit to PF01839, Integrins alpha chain,score 0.00012
31964004324	limit of DNA match with upstream gene
31964004325	Rhamnogalacturonan lyase of the polysaccharide lyase family 11; Region: RGL11; cd10318
31964004326	metal binding site [ion binding]; metal-binding site
31964004327	active site
31964004328	HMMPfam hit to PF01839, Integrins alpha chain,score 0.017
31964004329	HMMPfam hit to PF01839, Integrins alpha chain,score 0.0035
31964004330	HMMPfam hit to PF01839, Integrins alpha chain,score 0.00024
31964004331	limit of DNA match with downstream gene
31964004332	1 probable transmembrane helix predicted for CMS0960 by TMHMM2.0 at aa 13-35
31964004333	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
31964004334	putative substrate translocation pore; other site
31964004335	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
31964004336	13 probable transmembrane helices predicted for CMS0961 by TMHMM2.0 at aa 15-37, 50-72, 82-100, 107-129,142-164, 176-195, 236-253, 260-282, 308-330, 366-388,403-425, 446-468 and 481-503
31964004337	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964004338	This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases; Region: Glo_EDI_BRP_like_24; cd09012
31964004339	Alpha/beta hydrolase family; Region: Abhydrolase_6; pfam12697
31964004340	HMMPfam hit to PF00561, Alpha/beta hydrolase fold,score 7e-15
31964004341	Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism]; Region: COG1233
31964004342	NAD(P)-binding Rossmann-like domain; Region: NAD_binding_8; pfam13450
31964004343	hydroxyglutarate oxidase; Provisional; Region: PRK11728
31964004344	prenyltransferase; Provisional; Region: ubiA; PRK13595
31964004345	UbiA prenyltransferase family; Region: UbiA; pfam01040
31964004346	7 probable transmembrane helices predicted for CMS0966 by TMHMM2.0 at aa 30-49, 54-76, 102-121, 125-147,160-182, 232-254 and 274-296
31964004347	HMMPfam hit to PF01040, UbiA prenyltransferase,score 1.8e-05
31964004348	Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms]; Region: COG1819
31964004349	This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the...; Region: GT1_Gtf_like; cd03784
31964004350	homodimer interface [polypeptide binding]; other site
31964004351	active site
31964004352	TDP-binding site; other site
31964004353	acceptor substrate-binding pocket; other site
31964004354	HMMPfam hit to PF03033, Glycosyl transferase,family 28, score 0.00016
31964004355	short chain dehydrogenase; Validated; Region: PRK08264
31964004356	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
31964004357	NAD(P) binding site [chemical binding]; other site
31964004358	active site
31964004359	HMMPfam hit to PF00106, Short-chain dehydrogenase/reductase SDR, score 1.1e-22
31964004360	Helix-Turn-Helix DNA binding domain of transcription regulators from the MerR superfamily; Region: HTH_MerR-SF; cl02600
31964004361	MerR HTH family regulatory protein; Region: MerR_1; pfam13411
31964004362	DNA binding residues [nucleotide binding]
31964004363	1 probable transmembrane helix predicted for CMS0969 by TMHMM2.0 at aa 12-31
31964004364	Predicted helix-turn-helix motif with score 1490.000, SD 4.26 at aa 38-59, sequence LRIGDVAGRAGVSTRALRYYEE
31964004365	HMMPfam hit to PF00376, Bacterial regulatory protein, MerR, score 1.2e-12
31964004366	PS00552 Bacterial regulatory proteins, merR family signature.
31964004367	1 probable transmembrane helix predicted for CMS0970 by TMHMM2.0 at aa 20-42
31964004368	Transcriptional regulators [Transcription]; Region: MarR; COG1846
31964004369	MarR family; Region: MarR; pfam01047
31964004370	HMMPfam hit to PF01047, Bacterial regulatory protein, MarR, score 1.6e-18
31964004371	peroxiredoxin, Ohr subfamily; Region: organ_hyd_perox; TIGR03561
31964004372	HMMPfam hit to PF02566, OsmC-like protein, score 1.8e-37
31964004373	4 probable transmembrane helices predicted for CMS0975 by TMHMM2.0 at aa 13-32, 47-69, 76-98 and 113-132
31964004374	RES domain; Region: RES; pfam08808
31964004375	2 probable transmembrane helices predicted for CMS0978 by TMHMM2.0 at aa 20-37 and 41-63
31964004376	This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases; Region: Glo_EDI_BRP_like_24; cd09012
31964004377	Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily; Region: Glyoxalase; pfam00903
31964004378	Insertion in Cms relative to Cmm. Typical GC content.
31964004379	1 probable transmembrane helix predicted for CMS0981 by TMHMM2.0 at aa 31-53
31964004380	Alpha/beta hydrolase family; Region: Abhydrolase_5; pfam12695
31964004381	Prolyl oligopeptidase family; Region: Peptidase_S9; pfam00326
31964004382	1 probable transmembrane helix predicted for CMS0983 by TMHMM2.0 at aa 12-34
31964004383	Helix-turn-helix domain; Region: HTH_38; pfam13936
31964004384	Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair]; Region: Tra8; COG2826
31964004385	Integrase core domain; Region: rve; pfam00665
31964004386	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.8e-28
31964004387	PS01043 Transposases, IS30 family, signature.
31964004388	Predicted helix-turn-helix motif with score 1119.000, SD 3.00 at aa 43-64, sequence MSRRVAASRVGVHERTAQDWDR
31964004389	PS00017 ATP/GTP-binding site motif A (P-loop).
31964004390	Homeodomain-like domain; Region: HTH_23; cl17451
31964004391	Winged helix-turn helix; Region: HTH_29; pfam13551
31964004392	Integrase core domain; Region: rve; pfam00665
31964004393	Integrase core domain; Region: rve_3; pfam13683
31964004394	HMMPfam hit to PF00665, Integrase, catalytic region, score 3.7e-42
31964004395	Predicted helix-turn-helix motif with score 1316.000, SD 3.67 at aa 25-46, sequence WPVRRAAERFQCSPATASRWAR
31964004396	3-oxoadipate enol-lactonase; Region: protocat_pcaD; TIGR02427
31964004397	Domain of unknown function (DU1801); Region: DUF1801; pfam08818
31964004398	progesterone 5-beta-reductase-like proteins (5beta-POR), atypical (a) SDRs; Region: 5beta-POR_like_SDR_a; cd08948
31964004399	NAD dependent epimerase/dehydratase family; Region: Epimerase; pfam01370
31964004400	NAD(P) binding site [chemical binding]; other site
31964004401	active site
31964004402	Protein of unknown function (DUF418); Region: DUF418; pfam04235
31964004403	HMMPfam hit to PF04235, Protein of unknown function DUF418, score 6.4e-24
31964004404	10 probable transmembrane helices predicted for CMS0990 by TMHMM2.0 at aa 54-73, 104-121, 137-156,161-178, 185-204, 232-254, 275-297, 307-329, 358-380 and 385-403
31964004405	HMMPfam hit to PF04171, Protein of unknown function DUF405, score 1.3e-26
31964004406	ABC-type multidrug transport system, ATPase component [Defense mechanisms]; Region: CcmA; COG1131
31964004407	ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A; Region: ABC_DR_subfamily_A; cd03230
31964004408	Walker A/P-loop; other site
31964004409	ATP binding site [chemical binding]; other site
31964004410	Q-loop/lid; other site
31964004411	ABC transporter signature motif; other site
31964004412	Walker B; other site
31964004413	D-loop; other site
31964004414	H-loop/switch region; other site
31964004415	HMMPfam hit to PF00005, ABC transporter, score 6.9e-51
31964004416	PS00017 ATP/GTP-binding site motif A (P-loop).
31964004417	PS00211 ABC transporters family signature.
31964004418	ABC-type multidrug transport system, permease component [Defense mechanisms]; Region: COG0842
31964004419	ABC-2 type transporter; Region: ABC2_membrane; pfam01061
31964004420	6 probable transmembrane helices predicted for CMS0992 by TMHMM2.0 at aa 42-64, 79-101, 133-152, 162-184,196-218 and 258-280
31964004421	HMMPfam hit to PF01061, ABC-2, score 1.5e-08
31964004422	Signal transduction histidine kinase [Signal transduction mechanisms]; Region: COG4585
31964004423	Histidine kinase; Region: HisKA_3; pfam07730
31964004424	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
31964004425	ATP binding site [chemical binding]; other site
31964004426	Mg2+ binding site [ion binding]; other site
31964004427	G-X-G motif; other site
31964004428	6 probable transmembrane helices predicted for CMS0993 by TMHMM2.0 at aa 21-38, 43-60, 81-98, 102-119,126-145 and 150-172
31964004429	HMMPfam hit to PF07730, Histidine kinase
31964004430	HMMPfam hit to PF02518, ATP-binding region,ATPase-like, score 6.8e-19
31964004431	Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription]; Region: CitB; COG2197
31964004432	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
31964004433	active site
31964004434	phosphorylation site [posttranslational modification]
31964004435	intermolecular recognition site; other site
31964004436	dimerization interface [polypeptide binding]; other site
31964004437	C-terminal DNA-binding domain of LuxR-like proteins. This domain contains a helix-turn-helix motif and binds DNA. Proteins belonging to this group are response regulators; some act as transcriptional activators, others as transcriptional repressors. Many...; Region: LuxR_C_like; cd06170
31964004438	DNA binding residues [nucleotide binding]
31964004439	dimerization interface [polypeptide binding]; other site
31964004440	HMMPfam hit to PF00072, Response regulator receiver, score 3.5e-35
31964004441	HMMPfam hit to PF00196, Bacterial regulatory protein, LuxR, score 2.5e-18
31964004442	PS00622 Bacterial regulatory proteins, luxR family signature.
31964004443	Predicted helix-turn-helix motif with score 1167.000, SD 3.16 at aa 170-191, sequence RTNARIALELHVTPATVKTHLL
31964004444	ABC-type xylose transport system, periplasmic component [Carbohydrate transport and metabolism]; Region: XylF; COG4213
31964004445	Periplasmic xylose-binding component of the ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily; Region: PBP1_ABC_xylose_binding; cd01538
31964004446	putative ligand binding site [chemical binding]; other site
31964004447	HMMPfam hit to PF00532, Periplasmic binding protein/LacI transcriptional regulator, score 0.017
31964004448	ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism]; Region: MglA; COG1129
31964004449	First domain of the ATP-binding cassette component of monosaccharide transport system; Region: ABC_Carb_Monos_I; cd03216
31964004450	Walker A/P-loop; other site
31964004451	ATP binding site [chemical binding]; other site
31964004452	Q-loop/lid; other site
31964004453	ABC transporter signature motif; other site
31964004454	Walker B; other site
31964004455	D-loop; other site
31964004456	H-loop/switch region; other site
31964004457	Second domain of the ATP-binding cassette component of monosaccharide transport system; Region: ABC_Carb_Monos_II; cd03215
31964004458	HMMPfam hit to PF00005, ABC transporter, score 1.6e-50
31964004459	PS00017 ATP/GTP-binding site motif A (P-loop).
31964004460	HMMPfam hit to PF00005, ABC transporter, score 1e-18
31964004461	PS00211 ABC transporters family signature.
31964004462	Branched-chain amino acid transport system / permease component; Region: BPD_transp_2; pfam02653
31964004463	Transmembrane subunit (TM) of Escherichia coli AraH and related proteins. E. coli AraH is the TM of a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of the monosaccharide arabinose. This group...; Region: TM_PBP1_transp_AraH_like; cd06579
31964004464	TM-ABC transporter signature motif; other site
31964004465	10 probable transmembrane helices predicted for CMS0997 by TMHMM2.0 at aa 29-48, 63-85, 87-104, 114-136,143-165, 180-202, 223-245, 250-272, 292-314 and 334-356
31964004466	HMMPfam hit to PF02653, Bacterial inner-membrane translocator, score 1.4e-56
31964004467	PS00144 Asparaginase / glutaminase active site signature 1.
31964004468	The S26 Type I signal peptidase (SPase; LepB; leader peptidase B; leader peptidase I; EC 3.4.21.89) family members are essential membrane-bound serine proteases that function to cleave the amino-terminal signal peptide extension from proteins that are...; Region: S26_SPase_I; cd06530
31964004469	Catalytic site [active]
31964004470	PS00761 Signal peptidases I signature 3.
31964004471	2 probable transmembrane helices predicted for CMS0999 by TMHMM2.0 at aa 45-67 and 183-205
31964004472	PS00017 ATP/GTP-binding site motif A (P-loop).
31964004473	1 probable transmembrane helix predicted for CMS1000 by TMHMM2.0 at aa 13-35
31964004474	1 probable transmembrane helix predicted for CMS1001 by TMHMM2.0 at aa 26-48
31964004475	alternate signal-mediated exported protein, RER_14450 family; Region: exp_by_SipW_III; TIGR04089
31964004476	1 probable transmembrane helix predicted for CMS1002 by TMHMM2.0 at aa 37-59
31964004477	phosphate regulon sensor kinase PhoR; Region: phoR_proteo; TIGR02966
31964004478	Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via...; Region: HisKA; cd00082
31964004479	dimer interface [polypeptide binding]; other site
31964004480	phosphorylation site [posttranslational modification]
31964004481	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
31964004482	ATP binding site [chemical binding]; other site
31964004483	Mg2+ binding site [ion binding]; other site
31964004484	G-X-G motif; other site
31964004485	5 probable transmembrane helices predicted for CMS1003 by TMHMM2.0 at aa 54-71, 81-103, 124-146, 151-173 and 180-202
31964004486	HMMPfam hit to PF00512, Histidine kinase A,N-terminal, score 1.5e-14
31964004487	HMMPfam hit to PF02518, ATP-binding region,ATPase-like, score 1.7e-38
31964004488	BCCT family transporter; Region: BCCT; pfam02028
31964004489	12 probable transmembrane helices predicted for CMS1004 by TMHMM2.0 at aa 73-92, 107-129, 150-172,206-225, 256-278, 293-315, 327-349, 383-402, 415-437,465-487, 509-531 and 541-560
31964004490	HMMPfam hit to PF02028, BCCT transporter, score 3.6e-227
31964004491	PS01303 BCCT family of transporters signature.
31964004492	Sphingosine kinase and enzymes related to eukaryotic diacylglycerol kinase [Lipid metabolism / General function prediction only]; Region: LCB5; COG1597
31964004493	Diacylglycerol kinase catalytic domain; Region: DAGK_cat; pfam00781
31964004494	HMMPfam hit to PF00781, Diacylglycerol kinase,catalytic region, score 2.4e-20
31964004495	Predicted ATPase [General function prediction only]; Region: COG4637
31964004496	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
31964004497	Walker A/P-loop; other site
31964004498	ATP binding site [chemical binding]; other site
31964004499	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
31964004500	Walker B; other site
31964004501	D-loop; other site
31964004502	H-loop/switch region; other site
31964004503	PS00017 ATP/GTP-binding site motif A (P-loop).
31964004504	Fatty acid desaturase; Region: FA_desaturase; pfam00487
31964004505	The Delta6 Fatty Acid Desaturase (Delta6-FADS)-like CD includes the integral-membrane enzymes: delta-4, delta-5, delta-6, delta-8, delta-8-sphingolipid, and delta-11 desaturases found in vertebrates, higher plants, fungi, and bacteria. These desaturases...; Region: Delta6-FADS-like; cd03506
31964004506	putative di-iron ligands [ion binding]; other site
31964004507	HMMPfam hit to PF00487, Fatty acid desaturase,score 2.5e-45
31964004508	3 probable transmembrane helices predicted for CMS1007 by TMHMM2.0 at aa 51-73, 78-97 and 221-243
31964004509	Zn-dependent alcohol dehydrogenases [General function prediction only]; Region: AdhP; COG1064
31964004510	D-arabinose dehydrogenase; Region: arabinose_DH_like; cd05284
31964004511	NAD binding site [chemical binding]; other site
31964004512	substrate binding site [chemical binding]; other site
31964004513	catalytic Zn binding site [ion binding]; other site
31964004514	structural Zn binding site [ion binding]; other site
31964004515	HMMPfam hit to PF00107, Zinc-containing alcohol dehydrogenase superfamily, score 5.2e-84
31964004516	PS00059 Zinc-containing alcohol dehydrogenases signature.
31964004517	4 probable transmembrane helices predicted for CMS1009 by TMHMM2.0 at aa 47-69, 79-101, 151-173 and 178-200
31964004518	Protein of unknown function (DUF664); Region: DUF664; pfam04978
31964004519	DinB superfamily; Region: DinB_2; pfam12867
31964004520	HMMPfam hit to PF04978, Protein of unknown function DUF664, score 1.7e-50
31964004521	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.6e-38
31964004522	Predicted helix-turn-helix motif with score 1638.000, SD 4.77 at aa 39-60, sequence RPVSHVARELGVSRQCAHRWVA
31964004523	N-terminal catalytic domain of endoplasmic reticulum(ER)/cytosolic class II alpha-mannosidases; glycoside hydrolase family 38 (GH38); Region: GH38N_AMII_ER_cytosolic; cd10789
31964004524	active site
31964004525	catalytic site [active]
31964004526	Alpha mannosidase, middle domain; Region: Alpha-mann_mid; pfam09261
31964004527	Glycosyl hydrolases family 38 C-terminal domain; Region: Glyco_hydro_38C; pfam07748
31964004528	HMMPfam hit to PF07748, Glycosyl hydrolases family 38 C-terminal domain, score 1.7e-92
31964004529	HMMPfam hit to PF01074, Glycoside hydrolase, family 38, score 1.6e-135
31964004530	ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism]; Region: UgpE; COG0395
31964004531	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964004532	dimer interface [polypeptide binding]; other site
31964004533	conserved gate region; other site
31964004534	putative PBP binding loops; other site
31964004535	ABC-ATPase subunit interface; other site
31964004536	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 1.5e-09
31964004537	6 probable transmembrane helices predicted for CMS1013 by TMHMM2.0 at aa 5-27, 62-84, 97-119, 129-148,186-208 and 231-253
31964004538	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964004539	ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism]; Region: PotC; COG1177
31964004540	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964004541	dimer interface [polypeptide binding]; other site
31964004542	conserved gate region; other site
31964004543	putative PBP binding loops; other site
31964004544	ABC-ATPase subunit interface; other site
31964004545	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 4.6e-10
31964004546	6 probable transmembrane helices predicted for CMS1014 by TMHMM2.0 at aa 47-69, 107-129, 142-164,179-201, 264-286 and 296-318
31964004547	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964004548	Bacterial extracellular solute-binding protein; Region: SBP_bac_1; pfam01547
31964004549	Bacterial extracellular solute-binding protein; Region: SBP_bac_8; pfam13416
31964004550	HMMPfam hit to PF01547, Bacterial extracellular solute-binding protein, family 1, score 2.2e-22
31964004551	1 probable transmembrane helix predicted for CMS1015 by TMHMM2.0 at aa 20-42
31964004552	helix_turn_helix, cAMP Regulatory protein C-terminus; DNA binding domain of prokaryotic regulatory proteins belonging to the catabolite activator protein family; Region: HTH_CRP; cd00092
31964004553	non-specific DNA interactions [nucleotide binding]; other site
31964004554	DNA binding site [nucleotide binding]
31964004555	sequence specific DNA binding site [nucleotide binding]; other site
31964004556	putative cAMP binding site [chemical binding]; other site
31964004557	Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism]; Region: NagC; COG1940
31964004558	Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily; Region: NBD_sugar-kinase_HSP70_actin; cl17037
31964004559	HMMPfam hit to PF00480, ROK, score 2e-30
31964004560	Predicted helix-turn-helix motif with score 1554.000, SD 4.48 at aa 52-73, sequence ASRSEIAERTGLSAQTVTNVSR
31964004561	Zinc finger domain containing protein (CDGSH-type) [Function unknown]; Region: COG3369
31964004562	Iron-binding zinc finger CDGSH type; Region: zf-CDGSH; pfam09360
31964004563	Homeodomain-like domain; Region: HTH_23; cl17451
31964004564	Winged helix-turn helix; Region: HTH_29; pfam13551
31964004565	Integrase core domain; Region: rve; pfam00665
31964004566	Integrase core domain; Region: rve_3; pfam13683
31964004567	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964004568	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964004569	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964004570	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.6e-38
31964004571	Hemolysins and related proteins containing CBS domains [General function prediction only]; Region: TlyC; COG1253
31964004572	Domain of unknown function DUF21; Region: DUF21; pfam01595
31964004573	This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain. CorC_HlyC is a transporter associated domain. This small domain is found in Na+/H+ antiporters, in proteins involved in...; Region: CBS_pair_CorC_HlyC_assoc; cd04590
31964004574	Transporter associated domain; Region: CorC_HlyC; smart01091
31964004575	HMMPfam hit to PF03471, Transporter-associated region, score 2.8e-18
31964004576	HMMPfam hit to PF00571, CBS, score 1.9e-06
31964004577	HMMPfam hit to PF00571, CBS, score 9.7e-06
31964004578	HMMPfam hit to PF01595, Protein of unknown function DUF21, score 2.1e-57
31964004579	4 probable transmembrane helices predicted for CMS1020 by TMHMM2.0 at aa 5-24, 62-84, 99-121 and 134-156
31964004580	4 probable transmembrane helices predicted for CMS1021 by TMHMM2.0 at aa 35-54, 64-86, 99-121 and 126-148
31964004581	hypothetical protein; Provisional; Region: PRK07588
31964004582	hypothetical protein; Provisional; Region: PRK07236
31964004583	HMMPfam hit to PF01360, Flavoprotein monooxygenase,score 5.1e-07
31964004584	MarR family; Region: MarR_2; pfam12802
31964004585	Glycosyltransferases involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane]; Region: WcaA; COG0463
31964004586	EpsO protein participates in the methanolan synthesis; Region: EpsO_like; cd06438
31964004587	HMMPfam hit to PF00535, Glycosyl transferase,family 2, score 2.3e-15
31964004588	Acyl-CoA dehydrogenase; Region: ACAD; cl09933
31964004589	Acyl-CoA dehydrogenases [Lipid metabolism]; Region: CaiA; COG1960
31964004590	GlcNAc-PI de-N-acetylase; Region: PIG-L; cl00929
31964004591	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
31964004592	S-adenosylmethionine binding site [chemical binding]; other site
31964004593	HMMPfam hit to PF02585, LmbE-like protein, score 1.7e-30
31964004594	non-metazoan 5-aminoimidazole-4-(N-succinylcarboxamide) ribonucleotide (SAICAR) synthase; Region: SAICAR_synt_Sc; cd01414
31964004595	active site
31964004596	ATP binding site [chemical binding]; other site
31964004597	substrate binding site [chemical binding]; other site
31964004598	HMMPfam hit to PF01259, SAICAR synthetase, score 2.3e-95
31964004599	PS01058 SAICAR synthetase signature 2.
31964004600	PS01057 SAICAR synthetase signature 1.
31964004601	phosphoribosylamine--glycine ligase; Provisional; Region: PRK00885
31964004602	Phosphoribosylglycinamide synthetase, N domain; Region: GARS_N; pfam02844
31964004603	Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain; Region: GARS_A; pfam01071
31964004604	Phosphoribosylglycinamide synthetase, C domain; Region: GARS_C; pfam02843
31964004605	HMMPfam hit to PF02843, Phosphoribosylglycinamide synthetase, score 1.4e-31
31964004606	HMMPfam hit to PF01071, Phosphoribosylglycinamide synthetase, score 6.5e-71
31964004607	PS00184 Phosphoribosylglycinamide synthetase signature.
31964004608	HMMPfam hit to PF02842, Phosphoribosylglycinamide synthetase, score 6.6e-18
31964004609	HMMPfam hit to PF02844, Phosphoribosylglycinamide synthetase, score 3.4e-36
31964004610	2 probable transmembrane helices predicted for CMS1030 by TMHMM2.0 at aa 25-47 and 57-79
31964004611	amidophosphoribosyltransferase; Provisional; Region: PRK09246
31964004612	Glutamine amidotransferases class-II (GN-AT)_GPAT- type. This domain is found at the N-terminus of  glutamine phosphoribosylpyrophosphate (Prpp) amidotransferase (GPATase) . The glutaminase domain catalyzes amide nitrogen transfer from glutamine to the...; Region: GPATase_N; cd00715
31964004613	active site
31964004614	tetramer interface [polypeptide binding]; other site
31964004615	Phosphoribosyl transferase (PRT)-type I domain; Region: PRTases_typeI; cd06223
31964004616	active site
31964004617	HMMPfam hit to PF00156, Phosphoribosyltransferase,score 1.5e-08
31964004618	PS00103 Purine/pyrimidine phosphoribosyl transferases signature.
31964004619	HMMPfam hit to PF00310, Glutamine amidotransferase,class-II, score 2e-48
31964004620	phosphoribosylaminoimidazole synthetase; Provisional; Region: PRK05385
31964004621	PurM (Aminoimidazole Ribonucleotide [AIR] synthetase), one of eleven enzymes required for purine biosynthesis, catalyzes the conversion of formylglycinamide ribonucleotide (FGAM) and ATP to AIR, ADP, and Pi, the fifth step in de novo purine biosynthesis; Region: PurM; cd02196
31964004622	dimerization interface [polypeptide binding]; other site
31964004623	putative ATP binding site [chemical binding]; other site
31964004624	HMMPfam hit to PF00586, AIR synthase related protein, score 3.2e-59
31964004625	HMMPfam hit to PF02769, AIR synthase related protein, C-terminal, score 5.8e-23
31964004626	Protein of unknown function (DUF3073); Region: DUF3073; pfam11273
31964004627	Pyridine nucleotide-disulphide oxidoreductase; Region: Pyr_redox_2; pfam07992
31964004628	NAD(P)-binding Rossmann-like domain; Region: NAD_binding_8; cl17500
31964004629	Protein of unknown function (DUF3618); Region: DUF3618; pfam12277
31964004630	HMMPfam hit to PF02987, Late embryogenesis abundant protein, score 0.042
31964004631	Protein of unknown function (DUF1469); Region: DUF1469; pfam07332
31964004632	HMMPfam hit to PF07332, Protein of unknown function DUF1469, score 2.9e-34
31964004633	2 probable transmembrane helices predicted for CMS1036 by TMHMM2.0 at aa 55-77 and 87-106
31964004634	HMMPfam hit to PF02987, Late embryogenesis abundant protein, score 0.25
31964004635	Amino acid transporters [Amino acid transport and metabolism]; Region: PotE; COG0531
31964004636	12 probable transmembrane helices predicted for CMS1038 by TMHMM2.0 at aa 65-87, 116-138, 148-170,177-199, 221-243, 264-286, 330-352, 373-395, 400-422,442-461, 466-488 and 623-645
31964004637	Uncharacterized BCR, YitT family COG1284; Region: DUF161; pfam02588
31964004638	Predicted membrane protein [Function unknown]; Region: COG2364
31964004639	Uncharacterized BCR, YitT family COG1284; Region: DUF161; pfam02588
31964004640	HMMPfam hit to PF02588, Protein of unknown function DUF161, score 8.4e-16
31964004641	5 probable transmembrane helices predicted for CMS1039 by TMHMM2.0 at aa 9-28, 43-65, 72-94, 98-120 and 155-177
31964004642	HMMPfam hit to PF02588, Protein of unknown function DUF161, score 4.6e-08
31964004643	Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism]; Region: ARO8; COG1167
31964004644	Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators; Region: WHTH_GntR; cd07377
31964004645	DNA-binding site [nucleotide binding]; DNA binding site
31964004646	Aspartate aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). Pyridoxal phosphate combines with an alpha-amino acid to form a compound called a Schiff base or aldimine...; Region: AAT_like; cd00609
31964004647	pyridoxal 5'-phosphate binding site [chemical binding]; other site
31964004648	homodimer interface [polypeptide binding]; other site
31964004649	catalytic residue [active]
31964004650	HMMPfam hit to PF00392, Bacterial regulatory protein, GntR, score 1.4e-11
31964004651	PS00043 Bacterial regulatory proteins, gntR family signature.
31964004652	HMMPfam hit to PF00155, Aminotransferase, class I and II, score 5.6e-06
31964004653	V8-like Glu-specific endopeptidase [Amino acid transport and metabolism]; Region: COG3591
31964004654	glycogen debranching enzyme GlgX; Region: glgX_debranch; TIGR02100
31964004655	N-terminal Early set domain associated with the catalytic domain of Glycogen debranching enzyme and bacterial isoamylase (also called glycogen 6-glucanohydrolase); Region: E_set_GDE_Isoamylase_N; cd02856
31964004656	Alpha amylase catalytic domain found in glycogen debranching enzymes; Region: AmyAc_Glg_debranch; cd11326
31964004657	active site
31964004658	catalytic site [active]
31964004659	HMMPfam hit to PF02922, Glycoside hydrolase, family 13, N-terminal, score 4.6e-20
31964004660	HMMPfam hit to PF00128, Alpha amylase, catalytic region, score 5.1e-12
31964004661	leucine-zipper of insertion element IS481; Region: LZ_Tnp_IS481; pfam13011
31964004662	Winged helix-turn helix; Region: HTH_29; pfam13551
31964004663	Integrase core domain; Region: rve; pfam00665
31964004664	Integrase core domain; Region: rve_3; pfam13683
31964004665	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964004666	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964004667	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964004668	HMMPfam hit to PF00665, Integrase, catalytic region, score 3.5E-36
31964004669	This family is most closely related to the oligosaccharide phosphorylase domain family and other unidentified sequences. Oligosaccharide phosphorylase catalyzes the breakdown of oligosaccharides into glucose-1-phosphate units. They are important...; Region: GT1_Glycogen_Phosphorylase_like; cd04299
31964004670	putative homodimer interface [polypeptide binding]; other site
31964004671	putative active site pocket [active]
31964004672	alpha-glucan phosphorylases; Region: more_P_ylases; TIGR02094
31964004673	HMMPfam hit to PF00343, Glycosyl transferase,family 35, score 4.2e-09
31964004674	PS00102 Phosphorylase pyridoxal-phosphate attachment site.
31964004675	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely...; Region: SGNH_hydrolase; cl01053
31964004676	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely...; Region: SGNH_hydrolase; cd00229
31964004677	active site
31964004678	catalytic triad [active]
31964004679	glycogen debranching enzyme GlgX; Region: glgX_debranch; TIGR02100
31964004680	N-terminal Early set domain associated with the catalytic domain of Glycogen debranching enzyme and bacterial isoamylase (also called glycogen 6-glucanohydrolase); Region: E_set_GDE_Isoamylase_N; cd02856
31964004681	Alpha amylase catalytic domain found in glycogen debranching enzymes; Region: AmyAc_Glg_debranch; cd11326
31964004682	active site
31964004683	catalytic site [active]
31964004684	HMMPfam hit to PF00128, Alpha amylase, catalytic region, score 4.2e-10
31964004685	HMMPfam hit to PF02922, Glycoside hydrolase, family 13, N-terminal, score 1.3e-14
31964004686	Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism]; Region: NifS; COG1104
31964004687	cysteine desulfurase NifS; Region: FeS_nifS; TIGR03402
31964004688	pyridoxal 5'-phosphate binding pocket [chemical binding]; other site
31964004689	catalytic residue [active]
31964004690	HMMPfam hit to PF00266, Aminotransferase, class V,score 2.5e-55
31964004691	PS00595 Aminotransferases class-V pyridoxal-phosphate attachment site.
31964004692	tRNA methyl transferase; Region: tRNA_Me_trans; pfam03054
31964004693	tRNA methyl transferase. This family represents tRNA(5-methylaminomethyl-2-thiouridine)-methyltransferase which is involved in the biosynthesis of the modified nucleoside 5-methylaminomethyl-2-thiouridine present in the wobble position of some tRNAs; Region: tRNA_Me_trans; cd01998
31964004694	HMMPfam hit to PF03054, tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase, score 2.9e-148
31964004695	NAD-dependent DNA ligase LigA; Validated; Region: ligA; PRK07956
31964004696	NAD+ dependent DNA ligase adenylation domain. DNA ligases catalyze the crucial step of joining the breaks in duplex DNA during DNA replication, repair and recombination, utilizing either ATP or NAD(+) as a cofactor, but using the same basic reaction...; Region: LIGANc; cd00114
31964004697	nucleotide binding pocket [chemical binding]; other site
31964004698	K-X-D-G motif; other site
31964004699	catalytic site [active]
31964004700	NAD-dependent DNA ligase OB-fold domain; Region: DNA_ligase_OB; pfam03120
31964004701	NAD-dependent DNA ligase C4 zinc finger domain; Region: DNA_ligase_ZBD; pfam03119
31964004702	Breast Cancer Suppressor Protein (BRCA1), carboxy-terminal domain. The BRCT domain is found within many DNA damage repair and cell cycle checkpoint proteins. The unique diversity of this domain superfamily allows BRCT modules to interact forming homo...; Region: BRCT; cd00027
31964004703	Dimer interface [polypeptide binding]; other site
31964004704	HMMPfam hit to PF01653, NAD-dependent DNA ligase,score 1.6e-129
31964004705	PS01055 NAD-dependent DNA ligase signature 1.
31964004706	HMMPfam hit to PF03120, NAD-dependent DNA ligase OB-fold, score 2.8e-42
31964004707	HMMPfam hit to PF03119, Zn-finger in NAD-dependent DNA ligase, C4 type, score 4.2e-12
31964004708	HMMPfam hit to PF00633, Helix-hairpin-helix motif,score 1.4e-05
31964004709	HMMPfam hit to PF00533, BRCT, score 1.1e-07
31964004710	Alpha/beta hydrolase; Region: Abhydrolase_8; pfam06259
31964004711	HMMPfam hit to PF06259, Protein of unknown function DUF1023, score 3.1e-12
31964004712	aspartyl/glutamyl-tRNA amidotransferase subunit C; Reviewed; Region: gatC; PRK00034
31964004713	HMMPfam hit to PF02686, Glu-tRNAGln amidotransferase, C subunit, score 8.4e-15
31964004714	Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases [Translation, ribosomal structure and biogenesis]; Region: GatA; COG0154
31964004715	aspartyl/glutamyl-tRNA amidotransferase subunit A; Reviewed; Region: gatA; PRK00012
31964004716	HMMPfam hit to PF01425, Amidase, score 5.9e-195
31964004717	PS00017 ATP/GTP-binding site motif A (P-loop).
31964004718	aspartyl/glutamyl-tRNA amidotransferase subunit B; Validated; Region: gatB; PRK05477
31964004719	GatB/GatE catalytic domain; Region: GatB_N; pfam02934
31964004720	GatB domain; Region: GatB_Yqey; smart00845
31964004721	HMMPfam hit to PF02934, GatB N-terminal region,score 6.1e-131
31964004722	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964004723	HMMPfam hit to PF01162, GatB, central region, score 2.8e-18
31964004724	HMMPfam hit to PF02637, GatB/Yqey, score 5.3e-40
31964004725	ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only]; Region: Uup; COG0488
31964004726	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
31964004727	Walker A/P-loop; other site
31964004728	ATP binding site [chemical binding]; other site
31964004729	Q-loop/lid; other site
31964004730	ABC transporter signature motif; other site
31964004731	Walker B; other site
31964004732	D-loop; other site
31964004733	H-loop/switch region; other site
31964004734	ABC transporter; Region: ABC_tran_2; pfam12848
31964004735	ATP-binding cassette domain of elongation factor 3, subfamily F; Region: ABCF_EF-3; cd03221
31964004736	HMMPfam hit to PF00005, ABC transporter, score 2.1e-39
31964004737	PS00017 ATP/GTP-binding site motif A (P-loop).
31964004738	PS00211 ABC transporters family signature.
31964004739	HMMPfam hit to PF00005, ABC transporter, score 2e-35
31964004740	PS00017 ATP/GTP-binding site motif A (P-loop).
31964004741	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964004742	Homeodomain-like domain; Region: HTH_23; cl17451
31964004743	Winged helix-turn helix; Region: HTH_29; pfam13551
31964004744	Integrase core domain; Region: rve; pfam00665
31964004745	Integrase core domain; Region: rve_3; pfam13683
31964004746	HMMPfam hit to PF00665, Integrase, catalytic region, score 1e-41
31964004747	Predicted helix-turn-helix motif with score 1316.000, SD 3.67 at aa 25-46, sequence WPVRRAAERFQCSPATASRWAR
31964004748	long-chain-fatty-acid--CoA ligase; Validated; Region: PRK05605
31964004749	Adenylate forming domain, Class I; Region: AFD_class_I; cl17068
31964004750	Adenylate forming domain, Class I; Region: AFD_class_I; cl17068
31964004751	acyl-activating enzyme (AAE) consensus motif; other site
31964004752	AMP binding site [chemical binding]; other site
31964004753	active site
31964004754	CoA binding site [chemical binding]; other site
31964004755	HMMPfam hit to PF00501, AMP-dependent synthetase and ligase, score 6e-126
31964004756	Predicted helix-turn-helix motif with score 1082.000, SD 2.87 at aa 315-336, sequence KRLREAAEAEGVSLAGISISIS
31964004757	PS00455  AMP-binding domain signature.
31964004758	START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC (SRPBCC) ligand-binding domain superfamily; Region: SRPBCC; cd07812
31964004759	hydrophobic ligand binding site; other site
31964004760	type VII secretion protein EccCa; Region: T7SS_EccC_a; TIGR03924
31964004761	FtsK/SpoIIIE family; Region: FtsK_SpoIIIE; pfam01580
31964004762	type VII secretion protein EccCb; Region: T7SS_EccC_b; TIGR03925
31964004763	FtsK/SpoIIIE family; Region: FtsK_SpoIIIE; pfam01580
31964004764	FtsK/SpoIIIE family; Region: FtsK_SpoIIIE; pfam01580
31964004765	PS00017 ATP/GTP-binding site motif A (P-loop).
31964004766	HMMPfam hit to PF01580, Cell divisionFtsK/SpoIIIE protein, score 4.1e-28
31964004767	HMMPfam hit to PF01580, Cell divisionFtsK/SpoIIIE protein, score 3.1e-36
31964004768	PS00017 ATP/GTP-binding site motif A (P-loop).
31964004769	1 probable transmembrane helix predicted for tmhmm2embl_unknown_000003_1114408_1118565 by TMHMM2.0 at aa 63-85
31964004770	WXG100 protein secretion system (Wss), protein YukD; Region: YukD; pfam08817
31964004771	11 probable transmembrane helices predicted for CMS1064 by TMHMM2.0 at aa 110-132, 137-157, 162-184,194-216, 223-245, 250-272, 300-322, 326-345, 352-371,375-397 and 410-432
31964004772	1 probable transmembrane helix predicted for CMS1065 by TMHMM2.0 at aa 42-64
31964004773	HMMPfam hit to PF06271, RDD, score 0.0011
31964004774	1 probable transmembrane helix predicted for CMS1066 by TMHMM2.0 at aa 86-108
31964004775	DNA/RNA non-specific endonuclease; Region: Endonuclea_NS_2; pfam13930
31964004776	submitted with no further information
31964004777	DNA/RNA non-specific endonuclease; Region: Endonuclea_NS_2; cl17626
31964004778	Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism]; Region: COG1233
31964004779	NAD(P)-binding Rossmann-like domain; Region: NAD_binding_8; pfam13450
31964004780	short chain dehydrogenase; Provisional; Region: PRK07109
31964004781	classical (c) SDR, subgroup 3; Region: SDR_c3; cd05360
31964004782	putative NAD(P) binding site [chemical binding]; other site
31964004783	active site
31964004784	1 probable transmembrane helix predicted for CMS1080 by TMHMM2.0 at aa 310-329
31964004785	HMMPfam hit to PF00106, Short-chain dehydrogenase/reductase SDR, score 1.1e-41
31964004786	long-chain-fatty-acid--CoA ligase; Validated; Region: PRK05605
31964004787	Adenylate forming domain, Class I; Region: AFD_class_I; cl17068
31964004788	Adenylate forming domain, Class I; Region: AFD_class_I; cl17068
31964004789	acyl-activating enzyme (AAE) consensus motif; other site
31964004790	AMP binding site [chemical binding]; other site
31964004791	active site
31964004792	CoA binding site [chemical binding]; other site
31964004793	HMMPfam hit to PF00501, AMP-dependent synthetase and ligase, score 2.1e-122
31964004794	short chain dehydrogenase; Provisional; Region: PRK06197
31964004795	retinol dehydrogenase (retinol-DH), Light dependent Protochlorophyllide (Pchlide) OxidoReductase (LPOR) and related proteins, classical (c) SDRs; Region: retinol-DH_like_SDR_c_like; cd05327
31964004796	putative NAD(P) binding site [chemical binding]; other site
31964004797	active site
31964004798	HMMPfam hit to PF00106, Short-chain dehydrogenase/reductase SDR, score 2.1e-19
31964004799	Zinc peptidases M18, M20, M28, and M42; Region: Zinc_peptidase_like; cl14876
31964004800	Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase and related deacylases [Amino acid transport and metabolism]; Region: ArgE; COG0624
31964004801	metal binding site [ion binding]; metal-binding site
31964004802	PS00758 ArgE / dapE / ACY1 / CPG2 / yscS family signature 1.
31964004803	HMMPfam hit to PF01546, Peptidase M20, score 1.4e-18
31964004804	HMMPfam hit to PF07687, Peptidase dimerisation domain, score 1e-22
31964004805	Homeodomain-like domain; Region: HTH_23; cl17451
31964004806	Winged helix-turn helix; Region: HTH_29; pfam13551
31964004807	Integrase core domain; Region: rve; pfam00665
31964004808	Integrase core domain; Region: rve_3; pfam13683
31964004809	Predicted helix-turn-helix motif with score 1316.000, SD 3.67 at aa 25-46, sequence WPVRRAAERFQCSPATASRWAR
31964004810	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.4e-41
31964004811	Alpha/beta hydrolase family; Region: Abhydrolase_6; pfam12697
31964004812	Prolyl oligopeptidase family; Region: Peptidase_S9; pfam00326
31964004813	HMMPfam hit to PF00326, Peptidase S9, prolyl oligopeptidase active site region, score 1.1e-45
31964004814	2-haloalkanoic acid dehalogenase, type II; Region: HAD_type_II; TIGR01428
31964004815	Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase; Region: HAD-SF-IA-v2; TIGR01493
31964004816	HMMPfam hit to PF00702, Haloacid dehalogenase-like hydrolase, score 9.2e-16
31964004817	Protein of unknown function (DUF1684); Region: DUF1684; pfam07920
31964004818	pyruvate dehydrogenase; Provisional; Region: PRK06546
31964004819	Pyrimidine (PYR) binding domain of POX; Region: TPP_PYR_POX; cd07039
31964004820	PYR/PP interface [polypeptide binding]; other site
31964004821	dimer interface [polypeptide binding]; other site
31964004822	tetramer interface [polypeptide binding]; other site
31964004823	TPP binding site [chemical binding]; other site
31964004824	Thiamine pyrophosphate enzyme, central domain; Region: TPP_enzyme_M; pfam00205
31964004825	Thiamine pyrophosphate (TPP) family, Pyruvate oxidase (POX) subfamily, TPP-binding module; composed of proteins similar to Lactobacillus plantarum POX, which plays a key role in controlling acetate production under aerobic conditions. POX decarboxylates...; Region: TPP_POX; cd02014
31964004826	TPP-binding site [chemical binding]; other site
31964004827	HMMPfam hit to PF02776, Pyruvate decarboxylase,score 7.2e-53
31964004828	HMMPfam hit to PF00205, Pyruvate decarboxylase,score 5e-22
31964004829	HMMPfam hit to PF02775, Pyruvate decarboxylase,score 1.9e-06
31964004830	Uncharacterized conserved protein [Function unknown]; Region: COG1359
31964004831	HMMPfam hit to PF03992, Antibiotic biosynthesis monooxygenase, score 2e-08
31964004832	Alcohol dehydrogenases of the MDR family; Region: Zn_ADH6; cd08260
31964004833	Zn-dependent alcohol dehydrogenases [General function prediction only]; Region: AdhP; COG1064
31964004834	putative NAD(P) binding site [chemical binding]; other site
31964004835	catalytic Zn binding site [ion binding]; other site
31964004836	structural Zn binding site [ion binding]; other site
31964004837	HMMPfam hit to PF00107, Zinc-containing alcohol dehydrogenase superfamily, score 2.6e-84
31964004838	1 probable transmembrane helix predicted for CMS1091 by Phobius
31964004839	PS00059 Zinc-containing alcohol dehydrogenases signature.
31964004840	4 probable transmembrane helices predicted for CMS1092 by TMHMM2.0 at aa 13-32, 37-56, 61-80 and 90-109
31964004841	alpha/beta hydrolase fold; Region: Abhydrolase_3; pfam07859
31964004842	submitted with no further information
31964004843	Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]; Region: ECM4; COG0435
31964004844	Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold; Region: Thioredoxin_like; cl00388
31964004845	C-terminal, alpha helical domain of Class Omega-like Glutathione S-transferases; Region: GST_C_Omega_like; cd03190
31964004846	putative dimer interface [polypeptide binding]; other site
31964004847	N-terminal domain interface [polypeptide binding]; other site
31964004848	putative substrate binding pocket (H-site) [chemical binding]; other site
31964004849	DEAD-like helicases superfamily; Region: DEXDc; smart00487
31964004850	DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region; Region: DEXDc; cd00046
31964004851	ATP binding site [chemical binding]; other site
31964004852	putative Mg++ binding site [ion binding]; other site
31964004853	Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may...; Region: HELICc; cd00079
31964004854	nucleotide binding region [chemical binding]; other site
31964004855	ATP-binding site [chemical binding]; other site
31964004856	HMMPfam hit to PF00270, DEAD/DEAH box helicase,N-terminal, score 1.8e-06
31964004857	HMMPfam hit to PF00176, SNF2-related, score 1.2e-08
31964004858	HMMPfam hit to PF00271, Helicase, C-terminal, score 1.3e-18
31964004859	submitted with no further information
31964004860	Helix-turn-helix domain; Region: HTH_38; pfam13936
31964004861	Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair]; Region: Tra8; COG2826
31964004862	Integrase core domain; Region: rve; pfam00665
31964004863	PS00017 ATP/GTP-binding site motif A (P-loop).
31964004864	Predicted helix-turn-helix motif with score 1119.000, SD 3.00 at aa 43-64, sequence MSRRVAASRVGVHERTAQDWDR
31964004865	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.8e-28
31964004866	PS01043 Transposases, IS30 family, signature.
31964004867	2 probable transmembrane helices predicted for CMS1100 by TMHMM2.0 at aa 65-87 and 92-114
31964004868	benzoate transport; Region: 2A0115; TIGR00895
31964004869	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
31964004870	putative substrate translocation pore; other site
31964004871	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
31964004872	HMMPfam hit to PF00083, General substrate transporter, score 2.9e-48
31964004873	11 probable transmembrane helices predicted for CMS1101 by TMHMM2.0 at aa 30-52, 62-84, 91-113, 117-139,152-174, 179-201, 278-300, 310-332, 339-358, 363-385 and 420-442
31964004874	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964004875	PS00217 Sugar transport proteins signature 2.
31964004876	PS00216 Sugar transport proteins signature 1.
31964004877	Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown]; Region: COG1917
31964004878	multifunctional thiamine-phosphate pyrophosphorylase/synthase/phosphomethylpyrimidine kinase; Provisional; Region: PRK09517
31964004879	Thiamine monophosphate synthase (TMP synthase)/TenI. TMP synthase catalyzes an important step in the thiamine biosynthesis pathway, the substitution of the pyrophosphate of 2-methyl-4-amino-5- hydroxymethylpyrimidine pyrophosphate by 4-methyl-5-; Region: TMP_TenI; cd00564
31964004880	pyrophosphate binding site [ion binding]; other site
31964004881	4-amino-5-hydroxymethyl-2-methyl-pyrimidine phosphate kinase (HMPP-kinase) catalyzes two consecutive phosphorylation steps in the thiamine phosphate biosynthesis pathway, leading to the synthesis of vitamin B1. The first step is the phosphorylation of...; Region: HMPP_kinase; cd01169
31964004882	dimer interface [polypeptide binding]; other site
31964004883	substrate binding site [chemical binding]; other site
31964004884	ATP binding site [chemical binding]; other site
31964004885	TENA/THI-4/PQQC family; Region: TENA_THI-4; cl15243
31964004886	HMMPfam hit to PF03070, TENA/THI-4 protein, score 8.8e-20
31964004887	HMMPfam hit to PF02581, Thiamine monophosphate synthase, score 2.6e-31
31964004888	4-methyl-5-beta-hydroxyethylthiazole (Thz) kinase catalyzes the phosphorylation of the hydroxylgroup of Thz. A reaction that allows cells to recycle Thz into the thiamine biosynthesis pathway, as an alternative to its synthesis from cysteine, tyrosine...; Region: THZ_kinase; cd01170
31964004889	substrate binding site [chemical binding]; other site
31964004890	multimerization interface [polypeptide binding]; other site
31964004891	ATP binding site [chemical binding]; other site
31964004892	HMMPfam hit to PF02110, Hydroxyethylthiazole kinase, score 2.3e-92
31964004893	submitted with no further information
31964004894	Protease II [Amino acid transport and metabolism]; Region: PtrB; COG1770
31964004895	Prolyl oligopeptidase family; Region: Peptidase_S9; pfam00326
31964004896	HMMPfam hit to PF00326, Peptidase S9, prolyl oligopeptidase active site region, score 1.4e-93
31964004897	PS00708 Prolyl endopeptidase family serine active site.
31964004898	HMMPfam hit to PF02897, Peptidase S9A, prolyl oligopeptidase, N-terminal beta-propeller, score 2.9e-139
31964004899	2 probable transmembrane helices predicted for CMS1108 by TMHMM2.0 at aa 13-32 and 42-61
31964004900	Uncharacterized protein, probably involved in trehalose biosynthesis [Carbohydrate transport and metabolism]; Region: Ble; COG3281
31964004901	PS00017 ATP/GTP-binding site motif A (P-loop).
31964004902	NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile. In vitro, it displays protein disulfide reductase...; Region: NrdH; cd02976
31964004903	catalytic residues [active]
31964004904	FAD-linked oxidoreductase; Region: bact_FAD_ox; TIGR01679
31964004905	FAD binding domain; Region: FAD_binding_4; pfam01565
31964004906	D-arabinono-1,4-lactone oxidase; Region: ALO; pfam04030
31964004907	HMMPfam hit to PF01565, FAD linked oxidase,N-terminal, score 4.3e-28
31964004908	Glycosyl hydrolases family 2, sugar binding domain; Region: Glyco_hydro_2_N; pfam02837
31964004909	cryptic beta-D-galactosidase subunit alpha; Reviewed; Region: ebgA; PRK10340
31964004910	Glycosyl hydrolases family 2; Region: Glyco_hydro_2; pfam00703
31964004911	Glycosyl hydrolases family 2, TIM barrel domain; Region: Glyco_hydro_2_C; pfam02836
31964004912	Beta galactosidase small chain; Region: Bgal_small_N; smart01038
31964004913	HMMPfam hit to PF02930, Glycoside hydrolase, family 42, small chain, C-terminal, score 5.8e-20
31964004914	HMMPfam hit to PF02929, Glycoside hydrolase, family 42, small chain, N-terminal, score 2.8e-21
31964004915	HMMPfam hit to PF02836, Glycoside hydrolase, family 2, TIM barrel domain, score 9e-130
31964004916	PS00608 Glycosyl hydrolases family 2 acid/base catalyst.
31964004917	PS00719 Glycosyl hydrolases family 2 signature 1.
31964004918	HMMPfam hit to PF00703, Glycoside hydrolase family 2, immunoglobulin-like beta-sandwich domain, score 0.015
31964004919	HMMPfam hit to PF02837, Glycoside hydrolase, family 2, sugar binding, score 2.8e-79
31964004920	ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism]; Region: UgpE; COG0395
31964004921	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964004922	dimer interface [polypeptide binding]; other site
31964004923	conserved gate region; other site
31964004924	putative PBP binding loops; other site
31964004925	ABC-ATPase subunit interface; other site
31964004926	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 0.00039
31964004927	6 probable transmembrane helices predicted for CMS1113 by TMHMM2.0 at aa 51-73, 118-140, 149-171,181-203, 238-260 and 285-307
31964004928	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964004929	dimer interface [polypeptide binding]; other site
31964004930	conserved gate region; other site
31964004931	putative PBP binding loops; other site
31964004932	ABC-ATPase subunit interface; other site
31964004933	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 0.00048
31964004934	6 probable transmembrane helices predicted for CMS1114 by TMHMM2.0 at aa 36-58, 105-127, 140-162,187-209, 238-260 and 295-317
31964004935	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964004936	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964004937	HMMPfam hit to PF01957, Protein of unknown function DUF107, score 0.00044
31964004938	2 probable transmembrane helices predicted for CMS1118 by TMHMM2.0 at aa 5-27 and 37-59
31964004939	SPFH domain / Band 7 family; Region: Band_7; pfam01145
31964004940	1 probable transmembrane helix predicted for CMS1119 by TMHMM2.0 at aa 7-29
31964004941	HMMPfam hit to PF01145, Band 7 protein, score 3.7e-11
31964004942	H+ Antiporter protein; Region: 2A0121; TIGR00900
31964004943	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
31964004944	putative substrate translocation pore; other site
31964004945	10 probable transmembrane helices predicted for CMS1120 by TMHMM2.0 at aa 9-31, 41-63, 84-106, 157-179,222-244, 254-276, 283-305, 309-331, 351-373 and 377-394
31964004946	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964004947	Metallo-beta-lactamase superfamily; Region: Lactamase_B; smart00849
31964004948	HMMPfam hit to PF00753, Beta-lactamase-like, score 6.2e-23
31964004949	Rieske domain; a [2Fe-2S] cluster binding domain commonly found in Rieske non-heme iron oxygenase (RO) systems such as naphthalene and biphenyl dioxygenases, as well as in plant/cyanobacterial chloroplast b6f and mitochondrial cytochrome bc(1) complexes; Region: Rieske; cd03467
31964004950	iron-sulfur cluster [ion binding]; other site
31964004951	[2Fe-2S] cluster binding site [ion binding]; other site
31964004952	HMMPfam hit to PF00355, Rieske [2Fe-2S] region,score 7.9e-20
31964004953	H+ Antiporter protein; Region: 2A0121; TIGR00900
31964004954	7 probable transmembrane helices predicted for CMS1126 by TMHMM2.0 at aa 31-53, 63-85, 97-119, 129-151,172-194, 247-269 and 276-298
31964004955	2 probable transmembrane helices predicted for CMS1127 by TMHMM2.0 at aa 66-88 and 95-117
31964004956	oxidoreductase; Provisional; Region: PRK06128
31964004957	classical (c) SDR, subgroup 1; Region: SDR_c1; cd05355
31964004958	NAD binding site [chemical binding]; other site
31964004959	metal binding site [ion binding]; metal-binding site
31964004960	active site
31964004961	HMMPfam hit to PF00106, Short-chain dehydrogenase/reductase SDR, score 1.4e-79
31964004962	PS00061 Short-chain dehydrogenases/reductases family signature.
31964004963	DOPA decarboxylase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD correspond to DOPA/tyrosine decarboxylase (DDC), histidine decarboxylase (HDC), and...; Region: DOPA_deC_like; cd06450
31964004964	pyridoxal 5'-phosphate binding site [chemical binding]; other site
31964004965	catalytic residue [active]
31964004966	HMMPfam hit to PF00282, Pyridoxal-dependent decarboxylase, score 5.8e-49
31964004967	Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism]; Region: IucD; COG3486
31964004968	Acetyltransferase (GNAT) domain; Region: Acetyltransf_8; pfam13523
31964004969	Siderophore biosynthesis protein domain; Region: AlcB; smart01006
31964004970	Siderophore synthetase component [Secondary metabolites biosynthesis, transport, and catabolism]; Region: RhbC; COG4264
31964004971	IucA / IucC family; Region: IucA_IucC; pfam04183
31964004972	Ferric iron reductase FhuF-like transporter; Region: FhuF; pfam06276
31964004973	HMMPfam hit to PF04183, IucA/IucC, score 5e-130
31964004974	PS00148 Arginase family signature 2.
31964004975	Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones]; Region: IbpA; COG0071
31964004976	Alpha-crystallin domain (ACD) of alpha-crystallin-type small(s) heat shock proteins (Hsps). sHsps are small stress induced proteins with monomeric masses between 12 -43 kDa, whose common feature is the Alpha-crystallin domain  (ACD). sHsps are generally...; Region: ACD_sHsps-like; cd06464
31964004977	putative dimer interface [polypeptide binding]; other site
31964004978	HMMPfam hit to PF00011, Heat shock protein Hsp20,score 6.3e-25
31964004979	short chain dehydrogenase; Provisional; Region: PRK08219
31964004980	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
31964004981	NAD(P) binding site [chemical binding]; other site
31964004982	active site
31964004983	HMMPfam hit to PF00106, Short-chain dehydrogenase/reductase SDR, score 2.1e-35
31964004984	PS00061 Short-chain dehydrogenases/reductases family signature.
31964004985	Winged helix DNA-binding domain; Region: HTH_27; pfam13463
31964004986	helix_turn_helix multiple antibiotic resistance protein; Region: HTH_MARR; smart00347
31964004987	HMMPfam hit to PF01047, Bacterial regulatory protein, MarR, score 1.7e-12
31964004988	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
31964004989	NAD(P) binding site [chemical binding]; other site
31964004990	active site
31964004991	Putative NADP-dependent oxidoreductases [General function prediction only]; Region: COG2130
31964004992	Prostaglandin dehydrogenases; Region: PGDH; cd05288
31964004993	NAD(P) binding site [chemical binding]; other site
31964004994	substrate binding site [chemical binding]; other site
31964004995	dimer interface [polypeptide binding]; other site
31964004996	HMMPfam hit to PF00107, Zinc-containing alcohol dehydrogenase superfamily, score 3.1e-34
31964004997	Virulence factor BrkB; Region: Virul_fac_BrkB; pfam03631
31964004998	HMMPfam hit to PF03631, Ribonuclease BN, score 6.7e-39
31964004999	6 probable transmembrane helices predicted for CMS1142 by TMHMM2.0 at aa 58-80, 120-142, 163-185,205-227, 240-262 and 272-294
31964005000	CYTH-like (also known as triphosphate tunnel metalloenzyme (TTM)-like) Phosphatases; Region: CYTH-like_Pase; cd07374
31964005001	putative active site; other site
31964005002	putative metal binding residues [ion binding]; other site
31964005003	signature motif; other site
31964005004	putative triphosphate binding site [ion binding]; other site
31964005005	The CHAD domain is an alpha-helical domain functionally associated with some members of the adenylate cyclase family; Region: CHAD; smart00880
31964005006	HMMPfam hit to PF01928, Adenylate cyclase, score 1.9e-12
31964005007	HMMPfam hit to PF05235, CHAD, score 6.7e-36
31964005008	Esterases and lipases (includes fungal lipases, cholinesterases, etc.)  These enzymes act on carboxylic esters (EC: 3.1.1.-). The catalytic apparatus involves three residues (catalytic triad): a serine, a glutamate or aspartate and a histidine.These...; Region: Esterase_lipase; cd00312
31964005009	Carboxylesterase type B [Lipid metabolism]; Region: PnbA; COG2272
31964005010	substrate binding pocket [chemical binding]; other site
31964005011	catalytic triad [active]
31964005012	HMMPfam hit to PF00135, Carboxylesterase, type B,score 2.9e-106
31964005013	PS00941 Carboxylesterases type-B signature 2.
31964005014	PS00122 Carboxylesterases type-B serine active site.
31964005015	Phosphate/sulphate permeases [Inorganic ion transport and metabolism]; Region: PitA; COG0306
31964005016	9 probable transmembrane helices predicted for CMS1145 by TMHMM2.0 at aa 20-39, 60-79, 94-116, 129-151,155-172, 216-233, 238-260, 326-348 and 352-371
31964005017	HMMPfam hit to PF01384, Phosphate transporter,score 2.7e-87
31964005018	2 probable transmembrane helices predicted for CMS1146 by TMHMM2.0 at aa 7-29 and 56-78
31964005019	Xanthine/uracil/vitamin C permease [Nucleotide transport and    metabolism]; Region: COG2252
31964005020	HMMPfam hit to PF00860, Xanthine/uracil/vitamin C permease, score 2.3e-10
31964005021	11 probable transmembrane helices predicted for CMS1147 by TMHMM2.0 at aa 39-61, 76-98, 103-125, 130-152,159-181, 196-218, 225-247, 285-307, 372-394, 433-455 and 468-485
31964005022	Mn2+ and Fe2+ transporters of the NRAMP family [Inorganic ion transport and metabolism]; Region: MntH; COG1914
31964005023	Natural resistance-associated macrophage protein; Region: Nramp; pfam01566
31964005024	11 probable transmembrane helices predicted for CMS1148 by TMHMM2.0 at aa 20-42, 52-71, 92-114, 124-146,158-180, 195-217, 237-259, 284-306, 339-356, 361-383 and 396-418
31964005025	Predicted membrane protein [Function unknown]; Region: COG2246
31964005026	GtrA-like protein; Region: GtrA; pfam04138
31964005027	HMMPfam hit to PF04138, GtrA-like protein, score 7.8e-17
31964005028	4 probable transmembrane helices predicted for CMS1149 by TMHMM2.0 at aa 12-34, 38-60, 73-95 and 118-140
31964005029	DPM1_like represents putative enzymes similar to eukaryotic DPM1; Region: DPM1_like; cd06442
31964005030	Ligand binding site; other site
31964005031	Putative Catalytic site; other site
31964005032	DXD motif; other site
31964005033	HMMPfam hit to PF00535, Glycosyl transferase,family 2, score 2.7e-19
31964005034	Predicted nuclease (RNAse H fold) [General function prediction only]; Region: COG4328
31964005035	aspartate ammonia-lyase; Provisional; Region: aspA; PRK12273
31964005036	Aspartase; Region: Aspartase; cd01357
31964005037	active sites [active]
31964005038	tetramer interface [polypeptide binding]; other site
31964005039	HMMPfam hit to PF00206, Fumarate lyase, score 8e-141
31964005040	PS00163 Fumarate lyases signature.
31964005041	Apolipoprotein A1/A4/E domain; Region: Apolipoprotein; pfam01442
31964005042	HMMPfam hit to PF02987, Late embryogenesis abundant protein, score 3.3e-05
31964005043	HMMPfam hit to PF02987, Late embryogenesis abundant protein, score 0.075
31964005044	2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway) [Secondary metabolites biosynthesis, transport, and catabolism]; Region: MhpD; COG0179
31964005045	Fumarylacetoacetate (FAA) hydrolase family; Region: FAA_hydrolase; pfam01557
31964005046	HMMPfam hit to PF01557, Fumarylacetoacetate (FAA) hydrolase, score 2.2e-54
31964005047	HMMPfam hit to PF04679, ATP-dependent DNA ligase,score 2.1e-12
31964005048	HMMPfam hit to PF01068, ATP-dependent DNA ligase,score 3.4e-34
31964005049	PS00697 ATP-dependent DNA ligase AMP-binding site.
31964005050	Ku protein, prokaryotic; Region: Ku_bact; TIGR02772
31964005051	Ku-core domain, Ku-like subfamily; composed of prokaryotic homologs of the eukaryotic DNA binding protein Ku. The alignment includes the core domain shared by the prokaryotic YkoV-like proteins and the eukaryotic Ku70 and Ku80. The prokaryotic Ku...; Region: KU_like; cd00789
31964005052	putative DNA binding site [nucleotide binding]; other site
31964005053	putative homodimer interface [polypeptide binding]; other site
31964005054	HMMPfam hit to PF02735, Ku, score 8.7e-58
31964005055	Homeodomain-like domain; Region: HTH_23; cl17451
31964005056	Winged helix-turn helix; Region: HTH_29; pfam13551
31964005057	Integrase core domain; Region: rve; pfam00665
31964005058	Integrase core domain; Region: rve_3; pfam13683
31964005059	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.6e-38
31964005060	2 probable transmembrane helices predicted for CMS1160 by TMHMM2.0 at aa 121-143 and 148-170
31964005061	AlkA N-terminal domain; Region: AlkA_N; pfam06029
31964005062	3-methyl-adenine DNA glycosylase II; Provisional; Region: PRK10308
31964005063	endonuclease III; includes endonuclease III (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA glycosidases (Alka-family) and other DNA glycosidases; Region: ENDO3c; cd00056
31964005064	minor groove reading motif; other site
31964005065	helix-hairpin-helix signature motif; other site
31964005066	substrate binding pocket [chemical binding]; other site
31964005067	active site
31964005068	HMMPfam hit to PF06029, AlkA, N-terminal, score 8.7e-09
31964005069	FAD binding domain; Region: FAD_binding_4; pfam01565
31964005070	glycolate oxidase, subunit GlcD; Region: glcD; TIGR00387
31964005071	HMMPfam hit to PF01565, FAD linked oxidase,N-terminal, score 2.5e-60
31964005072	HMMPfam hit to PF02913, FAD linked oxidase,C-terminal, score 2.8e-59
31964005073	Protease prsW family; Region: PrsW-protease; pfam13367
31964005074	8 probable transmembrane helices predicted for CMS1163 by TMHMM2.0 at aa 30-52, 56-78, 91-113, 133-155,167-189, 204-226, 231-253 and 263-285
31964005075	Protein of unknown function (DUF3072); Region: DUF3072; pfam11272
31964005076	Site-specific recombinases, DNA invertase Pin homologs [DNA replication, recombination, and repair]; Region: PinR; COG1961
31964005077	Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and...; Region: SR_ResInv; cd03768
31964005078	catalytic residues [active]
31964005079	catalytic nucleophile [active]
31964005080	HMMPfam hit to PF00239, Resolvase, N-terminal,score 2.3e-19
31964005081	Predicted helix-turn-helix motif with score 1244.000, SD 3.42 at aa 173-194, sequence RDTAEIARVLDVSERVVTRALA
31964005082	D-alanyl-D-alanine carboxypeptidase, serine-type, PBP4 family; Region: PBP4; TIGR00666
31964005083	D-Ala-D-Ala carboxypeptidase 3 (S13) family; Region: Peptidase_S13; cl17429
31964005084	HMMPfam hit to PF02113, Peptidase S13, D-Ala-D-Ala carboxypeptidase C, score 3e-10
31964005085	PS00017 ATP/GTP-binding site motif A (P-loop).
31964005086	Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription]; Region: CitB; COG2197
31964005087	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
31964005088	active site
31964005089	phosphorylation site [posttranslational modification]
31964005090	intermolecular recognition site; other site
31964005091	dimerization interface [polypeptide binding]; other site
31964005092	C-terminal DNA-binding domain of LuxR-like proteins. This domain contains a helix-turn-helix motif and binds DNA. Proteins belonging to this group are response regulators; some act as transcriptional activators, others as transcriptional repressors. Many...; Region: LuxR_C_like; cd06170
31964005093	DNA binding residues [nucleotide binding]
31964005094	dimerization interface [polypeptide binding]; other site
31964005095	HMMPfam hit to PF00196, Bacterial regulatory protein, LuxR, score 2.4e-17
31964005096	Predicted helix-turn-helix motif with score 1238.000, SD 3.40 at aa 170-191, sequence LSNAEVAALEFVSESTVKTHVS
31964005097	HMMPfam hit to PF00072, Response regulator receiver, score 4.6e-26
31964005098	Histidine kinase; Region: HisKA_3; pfam07730
31964005099	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; Region: HATPase_c; pfam02518
31964005100	Mg2+ binding site [ion binding]; other site
31964005101	HMMPfam hit to PF02518, ATP-binding region,ATPase-like, score 5.5e-08
31964005102	HMMPfam hit to PF07730, Histidine kinase
31964005103	3 probable transmembrane helices predicted for CMS1168 by TMHMM2.0 at aa 20-42, 87-109 and 124-146
31964005104	Protein of unknown function (DUF2945); Region: DUF2945; pfam11160
31964005105	HMMPfam hit to PF00106, Short-chain dehydrogenase/reductase SDR, score 6.1e-67
31964005106	DNA-binding ferritin-like protein (oxidative damage protectant) [Inorganic ion transport and metabolism]; Region: Dps; COG0783
31964005107	DPS protein, ferritin-like diiron-binding domain; Region: DPS; cd01043
31964005108	dimerization interface [polypeptide binding]; other site
31964005109	DPS ferroxidase diiron center [ion binding]; other site
31964005110	ion pore; other site
31964005111	HMMPfam hit to PF00210, Ferritin and Dps, score 6.2e-15
31964005112	PS00818 Dps protein family signature 1.
31964005113	SMP-30/Gluconolaconase/LRE-like region; Region: SGL; pfam08450
31964005114	HMMPfam hit to PF03758, Senescence marker protein-30 (SMP-30), score 9.7e-66
31964005115	A type 1 glutamine amidotransferase (GATase1)-like domain found in PfpI from Pyrococcus furiosus; Region: GATase1_PfpI_like; cd03134
31964005116	intracellular protease, PfpI family; Region: PfpI; TIGR01382
31964005117	proposed catalytic triad [active]
31964005118	conserved cys residue [active]
31964005119	HMMPfam hit to PF01965, ThiJ/PfpI, score 5.7e-50
31964005120	2 probable transmembrane helices predicted for CMS1174 by TMHMM2.0 at aa 20-37 and 42-61
31964005121	Signal peptidase (SPase) II; Region: Peptidase_A8; pfam01252
31964005122	4 probable transmembrane helices predicted for CMS1175 by TMHMM2.0 at aa 13-32, 74-96, 103-125 and 140-162
31964005123	HMMPfam hit to PF01252, Peptidase A8, signal peptidase II, score 1.1e-18
31964005124	PS00855 Signal peptidases II signature.
31964005125	Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols. AKRs are present in all phyla and are of importance to both health and industrial...; Region: Aldo_ket_red; cd06660
31964005126	Aldo/keto reductase family; Region: Aldo_ket_red; pfam00248
31964005127	active site
31964005128	catalytic tetrad [active]
31964005129	HMMPfam hit to PF00248, Aldo/keto reductase, score 1.3e-107
31964005130	PS00798 Aldo/keto reductase family signature 1.
31964005131	PS00063 Aldo/keto reductase family  active site signature.
31964005132	Peptidase M50B-like; Region: Peptidase_M50B; pfam13398
31964005133	5 probable transmembrane helices predicted for CMS1177 by TMHMM2.0 at aa 21-43, 91-113, 120-142, 157-179 and 212-234
31964005134	adenine phosphoribosyltransferase; Provisional; Region: PRK02304
31964005135	HMMPfam hit to PF00156, Phosphoribosyltransferase,score 1.2e-37
31964005136	PS00103 Purine/pyrimidine phosphoribosyl transferases signature.
31964005137	CIMS - Cobalamine-independent methonine synthase, or MetE, C-terminal domain_like. Many members have been characterized as 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferases, EC:2.1.1.14, mostly from bacteria and plants. This enzyme...; Region: CIMS_C_terminal_like; cd03311
31964005138	substrate binding site [chemical binding]; other site
31964005139	THF binding site; other site
31964005140	zinc-binding site [ion binding]; other site
31964005141	VanZ like family; Region: VanZ; cl01971
31964005142	4 probable transmembrane helices predicted for CMS1180 by TMHMM2.0 at aa 7-24, 55-77, 82-104 and 114-133
31964005143	HMMPfam hit to PF04892, VanZ like protein, score 3.3e-11
31964005144	Superfamily I DNA and RNA helicases [General function prediction only]; Region: COG3973
31964005145	Part of AAA domain; Region: AAA_19; pfam13245
31964005146	Family description; Region: UvrD_C_2; pfam13538
31964005147	PS00017 ATP/GTP-binding site motif A (P-loop).
31964005148	Di- and tricarboxylate transporters [Inorganic ion transport and metabolism]; Region: CitT; COG0471
31964005149	Anion permease ArsB/NhaD.  These permeases have been shown to translocate sodium, arsenate, antimonite, sulfate and organic anions across biological membranes in all three kingdoms of life.  A typical anion permease contains 8-13 transmembrane helices...; Region: ArsB_NhaD_permease; cd00625
31964005150	transmembrane helices; other site
31964005151	HMMPfam hit to PF00939, Sodium/sulphate symporter,score 2.7e-173
31964005152	12 probable transmembrane helices predicted for CMS1182 by TMHMM2.0 at aa 37-59, 74-96, 109-131, 146-168,204-226, 246-268, 310-332, 342-364, 371-393, 408-430,435-457 and 477-499
31964005153	Protein of unknown function (DUF1524); Region: DUF1524; pfam07510
31964005154	1 probable transmembrane helix predicted for CMS1183 by TMHMM2.0 at aa 9-28
31964005155	enterobactin exporter EntS; Provisional; Region: PRK10489
31964005156	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
31964005157	putative substrate translocation pore; other site
31964005158	HMMPfam hit to PF05977, Bacterial protein of unknown function DUF894, score 4.1e-06
31964005159	11 probable transmembrane helices predicted for CMS1184 by TMHMM2.0 at aa 51-73, 80-102, 112-134, 141-163,178-200, 207-229, 284-306, 319-341, 359-381, 401-423 and 427-449
31964005160	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964005161	Ribosomal protein S15 (prokaryotic)_S13 (eukaryotic) binds the central domain of 16S rRNA and is required for assembly of the small ribosomal subunit and for intersubunit association, thus representing a key element in the assembly of the whole ribosome; Region: Ribosomal_S15p_S13e; cd00353
31964005162	16S/18S rRNA binding site [nucleotide binding]; other site
31964005163	S13e-L30e interaction site [polypeptide binding]; other site
31964005164	25S rRNA binding site [nucleotide binding]; other site
31964005165	HMMPfam hit to PF00312, Ribosomal protein S15,score 1e-34
31964005166	guanosine pentaphosphate synthetase I/polynucleotide phosphorylase; Region: pppGpp_PNP; TIGR02696
31964005167	RNase PH-like 3'-5' exoribonucleases; Region: RNase_PH; cl03114
31964005168	oligomer interface [polypeptide binding]; other site
31964005169	RNA binding site [nucleotide binding]; other site
31964005170	Polyribonucleotide nucleotidyltransferase, RNA binding domain; Region: PNPase; pfam03726
31964005171	Polyribonucleotide nucleotidyltransferase, repeat 2; Region: RNase_PH_PNPase_2; cd11364
31964005172	RNase E interface [polypeptide binding]; other site
31964005173	trimer interface [polypeptide binding]; other site
31964005174	active site
31964005175	Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH). PNPase is a polyribonucleotide nucleotidyl transferase that degrades mRNA in prokaryotes and plant chloroplasts. The C-terminal region of PNPase contains domains homologous to...; Region: PNPase_KH; cd02393
31964005176	putative nucleic acid binding region [nucleotide binding]; other site
31964005177	G-X-X-G motif; other site
31964005178	S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain. PNPase  is a polyribonucleotide nucleotidyl transferase that degrades mRNA. It is a trimeric multidomain protein. The C-terminus contains the S1 domain which binds ssRNA; Region: S1_PNPase; cd04472
31964005179	RNA binding site [nucleotide binding]; other site
31964005180	domain interface; other site
31964005181	HMMPfam hit to PF01138, 3' exoribonuclease, score 1.1e-31
31964005182	HMMPfam hit to PF03726, 3' exoribonuclease, score 5.3e-16
31964005183	HMMPfam hit to PF01138, 3' exoribonuclease, score 1.7e-44
31964005184	HMMPfam hit to PF03725, 3' exoribonuclease, score 5.9e-19
31964005185	HMMPfam hit to PF00013, KH, type 1, score 2.7e-14
31964005186	HMMPfam hit to PF00575, RNA binding S1, score 2.5e-12
31964005187	1 probable transmembrane helix predicted for CMS1187 by TMHMM2.0 at aa 24-46
31964005188	PhosphatidylEthanolamine-Binding Protein (PEBP) domain present in bacteria and archaea; Region: PEBP_bact_arch; cd00865
31964005189	substrate binding site [chemical binding]; other site
31964005190	HMMPfam hit to PF01161, PEBP, score 4e-08
31964005191	Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols. AKRs are present in all phyla and are of importance to both health and industrial...; Region: Aldo_ket_red; cd06660
31964005192	Aldo/keto reductase family; Region: Aldo_ket_red; pfam00248
31964005193	active site
31964005194	catalytic tetrad [active]
31964005195	HMMPfam hit to PF00248, Aldo/keto reductase, score 4.7e-39
31964005196	Predicted Zn-dependent peptidases [General function prediction only]; Region: PqqL; COG0612
31964005197	Insulinase (Peptidase family M16); Region: Peptidase_M16; pfam00675
31964005198	Peptidase M16 inactive domain; Region: Peptidase_M16_C; pfam05193
31964005199	HMMPfam hit to PF00675, Insulinase-like, score 2.9e-40
31964005200	PS00143 Insulinase family, zinc-binding region signature.
31964005201	HMMPfam hit to PF05193, Peptidase M16, C-terminal,score 3.6e-40
31964005202	Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction; Region: HP_PGM_like; cd07067
31964005203	catalytic core [active]
31964005204	HMMPfam hit to PF00300,Phosphoglycerate/bisphosphoglycerate mutase, score 2.1e-05
31964005205	dihydrodipicolinate reductase; Provisional; Region: PRK00048
31964005206	Dihydrodipicolinate reductase, N-terminus; Region: DapB_N; pfam01113
31964005207	Dihydrodipicolinate reductase, C-terminus; Region: DapB_C; pfam05173
31964005208	HMMPfam hit to PF01113, Dihydrodipicolinate reductase, score 1.4e-22
31964005209	1 probable transmembrane helix predicted for CMS1194 by TMHMM2.0 at aa 93-115
31964005210	HMMPfam hit to PF05173, Dihydrodipicolinate reductase, score 7.5e-43
31964005211	PS01298 Dihydrodipicolinate reductase signature.
31964005212	2 probable transmembrane helices predicted for CMS1195 by TMHMM2.0 at aa 7-29 and 34-56
31964005213	HMMPfam hit to PF07719, Tetratricopeptide repeat,score 0.00041
31964005214	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
31964005215	Predicted nucleoside-diphosphate sugar epimerase [General function prediction only]; Region: COG1090
31964005216	NAD(P) binding site [chemical binding]; other site
31964005217	active site
31964005218	FAD-dependent thymidylate synthase; Reviewed; Region: thyX; PRK00847
31964005219	HMMPfam hit to PF02511, Thymidylate synthase complementing protein, score 2e-68
31964005220	Dihydrodipicolinate synthase (DHDPS); Region: DHDPS; cd00950
31964005221	Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane]; Region: DapA; COG0329
31964005222	dimer interface [polypeptide binding]; other site
31964005223	active site
31964005224	catalytic residue [active]
31964005225	HMMPfam hit to PF00701, Dihydrodipicolinate synthetase, score 3.5e-79
31964005226	PS00666 Dihydrodipicolinate synthetase signature 2.
31964005227	mRNA degradation ribonucleases J1/J2 (metallo-beta-lactamase superfamily) [Translation, ribosomal structure and biogenesis; Replication, recombination and repair]; Region: COG0595
31964005228	Metallo-beta-lactamase superfamily; Region: Lactamase_B; smart00849
31964005229	RNA-metabolising metallo-beta-lactamase; Region: RMMBL; pfam07521
31964005230	HMMPfam hit to PF00753, Beta-lactamase-like, score 1.2e-22
31964005231	HMMPfam hit to PF07521, RNA-metabolising metallo-beta-lactamase, score 1.6e-13
31964005232	ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]; Region: SalX; COG1136
31964005233	ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein; Region: ABC_MJ0796_LolCDE_FtsE; cd03255
31964005234	Walker A/P-loop; other site
31964005235	ATP binding site [chemical binding]; other site
31964005236	Q-loop/lid; other site
31964005237	ABC transporter signature motif; other site
31964005238	Walker B; other site
31964005239	D-loop; other site
31964005240	H-loop/switch region; other site
31964005241	HMMPfam hit to PF00005, ABC transporter, score 5.1e-53
31964005242	PS00017 ATP/GTP-binding site motif A (P-loop).
31964005243	PS00211 ABC transporters family signature.
31964005244	FtsX-like permease family; Region: FtsX; pfam02687
31964005245	4 probable transmembrane helices predicted for CMS1202 by TMHMM2.0 at aa 32-54, 283-305, 326-348 and 378-400
31964005246	HMMPfam hit to PF02687, Protein of unknown function DUF214, score 3.4e-25
31964005247	Predicted permeases [General function prediction only]; Region: COG0730
31964005248	Domain of unknown function (DUF4117); Region: DUF4117; pfam13491
31964005249	DNA segregation ATPase FtsK/SpoIIIE and related proteins [Cell division and chromosome partitioning]; Region: FtsK; COG1674
31964005250	FtsK/SpoIIIE family; Region: FtsK_SpoIIIE; pfam01580
31964005251	Ftsk gamma domain; Region: Ftsk_gamma; pfam09397
31964005252	5 probable transmembrane helices predicted for CMS1203 by TMHMM2.0 at aa 107-124, 139-161, 174-196,201-218 and 223-245
31964005253	HMMPfam hit to PF01580, Cell divisionFtsK/SpoIIIE protein, score 1e-78
31964005254	PS00017 ATP/GTP-binding site motif A (P-loop).
31964005255	CDP-alcohol phosphatidyltransferase; Region: CDP-OH_P_transf; cl00453
31964005256	5 probable transmembrane helices predicted for CMS1204 by TMHMM2.0 at aa 28-50, 59-81, 101-123, 144-166 and 176-198
31964005257	HMMPfam hit to PF01066, CDP-alcohol phosphatidyltransferase, score 1.2e-32
31964005258	PS00379 CDP-alcohol phosphatidyltransferases signature.
31964005259	Competence-damaged protein; Region: CinA; cl00666
31964005260	HMMPfam hit to PF02464, CinA, C-terminal, score 1.4e-47
31964005261	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
31964005262	non-specific DNA binding site [nucleotide binding]; other site
31964005263	salt bridge; other site
31964005264	sequence-specific DNA binding site [nucleotide binding]; other site
31964005265	HMMPfam hit to PF01381, Helix-turn-helix motif,score 4.5e-10
31964005266	Protein of unknown function (DUF3046); Region: DUF3046; pfam11248
31964005267	recombinase A; Provisional; Region: recA; PRK09354
31964005268	RecA is a  bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response.  RecA couples ATP hydrolysis to DNA strand exchange; Region: recA; cd00983
31964005269	hexamer interface [polypeptide binding]; other site
31964005270	Walker A motif; other site
31964005271	ATP binding site [chemical binding]; other site
31964005272	Walker B motif; other site
31964005273	HMMPfam hit to PF00154, RecA bacterial DNA recombination protein, score 3e-237
31964005274	PS00017 ATP/GTP-binding site motif A (P-loop).
31964005275	PS00321 recA signature.
31964005276	RecX family; Region: RecX; pfam02631
31964005277	HMMPfam hit to PF02631, Regulatory protein RecX,score 0.0095
31964005278	(dimethylallyl)adenosine tRNA methylthiotransferase; Provisional; Region: PRK14326
31964005279	Uncharacterized protein family UPF0004; Region: UPF0004; pfam00919
31964005280	Radical SAM superfamily. Enzymes of this family generate radicals by combining a 4Fe-4S cluster and S-adenosylmethionine (SAM) in close proximity. They are characterized by a conserved CxxxCxxC motif, which coordinates the conserved iron-sulfur cluster; Region: Radical_SAM; cd01335
31964005281	FeS/SAM binding site; other site
31964005282	TRAM domain; Region: TRAM; cl01282
31964005283	HMMPfam hit to PF00919, Protein of unknown function UPF0004, score 2.1e-41
31964005284	HMMPfam hit to PF04055, Radical SAM, score 2.9e-33
31964005285	PS01278 Uncharacterized protein family UPF0004 signature.
31964005286	HMMPfam hit to PF01938, Deoxyribonuclease/rho motif-related TRAM, score 0.032
31964005287	tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed; Region: miaA; PRK00091
31964005288	tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis]; Region: MiaA; COG0324
31964005289	PS00017 ATP/GTP-binding site motif A (P-loop).
31964005290	HMMPfam hit to PF01715, tRNA isopentenyltransferase, score 1.4e-92
31964005291	diaminopimelate epimerase; Provisional; Region: dapF; PRK00450
31964005292	Diaminopimelate epimerase; Region: DAP_epimerase; pfam01678
31964005293	Diaminopimelate epimerase; Region: DAP_epimerase; pfam01678
31964005294	HMMPfam hit to PF01678, Diaminopimelate epimerase,score 2e-25
31964005295	PS01326 Diaminopimelate epimerase signature.
31964005296	HMMPfam hit to PF01678, Diaminopimelate epimerase,score 2.9e-14
31964005297	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
31964005298	S-adenosylmethionine binding site [chemical binding]; other site
31964005299	GTP-binding protein HflX; Region: GTP_HflX; TIGR03156
31964005300	GTP-binding GTPase N-terminal; Region: GTP-bdg_N; pfam13167
31964005301	HflX GTPase family; Region: HflX; cd01878
31964005302	G1 box; other site
31964005303	GTP/Mg2+ binding site [chemical binding]; other site
31964005304	Switch I region; other site
31964005305	G2 box; other site
31964005306	G3 box; other site
31964005307	Switch II region; other site
31964005308	G4 box; other site
31964005309	G5 box; other site
31964005310	HMMPfam hit to PF01926, GTP-binding protein,HSR1-related, score 1.5e-39
31964005311	PS00017 ATP/GTP-binding site motif A (P-loop).
31964005312	LexA repressor; Validated; Region: PRK00215
31964005313	LexA DNA binding domain; Region: LexA_DNA_bind; pfam01726
31964005314	Peptidase S24 LexA-like proteins are involved in the SOS response leading to the repair of single-stranded DNA within the bacterial cell. This family includes: the lambda repressor CI/C2 family and related bacterial prophage repressor proteins; LexA (EC...; Region: S24_LexA-like; cd06529
31964005315	Catalytic site [active]
31964005316	HMMPfam hit to PF00717, Peptidase S24, S26A and S26B, score 8.5e-20
31964005317	HMMPfam hit to PF01726, LexA DNA-binding region,score 1.6e-23
31964005318	Lysine Motif is a small domain involved in binding peptidoglycan; Region: LysM; cl00107
31964005319	Imidazoleglycerol-phosphate dehydratase; Region: IGPD; cd07914
31964005320	putative active site pocket [active]
31964005321	4-fold oligomerization interface [polypeptide binding]; other site
31964005322	metal binding residues [ion binding]; metal-binding site
31964005323	3-fold/trimer interface [polypeptide binding]; other site
31964005324	HMMPfam hit to PF00475, Imidazoleglycerol-phosphate dehydratase, score 1.4e-67
31964005325	PS00955 Imidazoleglycerol-phosphate dehydratase signature 2.
31964005326	imidazole glycerol phosphate synthase subunit HisH; Provisional; Region: hisH; PRK13146
31964005327	Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS); Region: GATase1_IGP_Synthase; cd01748
31964005328	putative active site [active]
31964005329	oxyanion strand; other site
31964005330	catalytic triad [active]
31964005331	HMMPfam hit to PF00117, Glutamine amidotransferase class-I, score 1.4e-38
31964005332	PS00442 Glutamine amidotransferases class-I active site.
31964005333	HisA.  Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase catalyzes the fourth step in histidine biosynthesis, an isomerisation of the aminoaldose moiety of ProFAR to the aminoketose of PRFAR (N-(5'-phospho-D-1...; Region: HisA; cd04732
31964005334	phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase; Region: TIGR00007
31964005335	catalytic residues [active]
31964005336	HMMPfam hit to PF00977, Histidine biosynthesis protein, score 1.5e-81
31964005337	translation initiation factor IF-3; Reviewed; Region: infC; PRK00028
31964005338	Translation initiation factor IF-3, N-terminal domain; Region: IF3_N; pfam05198
31964005339	Translation initiation factor IF-3, C-terminal domain; Region: IF3_C; pfam00707
31964005340	PS00938 Initiation factor 3 signature.
31964005341	HMMPfam hit to PF00707, Initiation factor 3, score 2.3e-40
31964005342	50S ribosomal protein L35; Reviewed; Region: rpmI; PRK00172
31964005343	HMMPfam hit to PF01632, Ribosomal protein L35,score 1.6e-16
31964005344	Ribosomal protein L20; Region: Ribosomal_L20; cd07026
31964005345	23S rRNA binding site [nucleotide binding]; other site
31964005346	L21 binding site [polypeptide binding]; other site
31964005347	L13 binding site [polypeptide binding]; other site
31964005348	HMMPfam hit to PF00453, Ribosomal protein L20,score 2.8e-44
31964005349	rRNA methylases [Translation, ribosomal structure and biogenesis]; Region: SpoU; COG0566
31964005350	RNA 2'-O ribose methyltransferase substrate binding; Region: SpoU_sub_bind; smart00967
31964005351	SpoU rRNA Methylase family; Region: SpoU_methylase; pfam00588
31964005352	HMMPfam hit to PF00588, tRNA/rRNA methyltransferase (SpoU), score 2.7e-29
31964005353	ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]; Region: GlnQ; COG1126
31964005354	ATP-binding cassette domain of the histidine and glutamine transporters; Region: ABC_HisP_GlnQ; cd03262
31964005355	Walker A/P-loop; other site
31964005356	ATP binding site [chemical binding]; other site
31964005357	Q-loop/lid; other site
31964005358	ABC transporter signature motif; other site
31964005359	Walker B; other site
31964005360	D-loop; other site
31964005361	H-loop/switch region; other site
31964005362	HMMPfam hit to PF00005, ABC transporter, score 4.4e-69
31964005363	PS00017 ATP/GTP-binding site motif A (P-loop).
31964005364	PS00211 ABC transporters family signature.
31964005365	Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of  substrates, such as, amino acids, peptides, sugars, vitamins and inorganic...; Region: PBPb; cd00134
31964005366	Bacterial extracellular solute-binding proteins, family 3; Region: SBP_bac_3; pfam00497
31964005367	substrate binding pocket [chemical binding]; other site
31964005368	membrane-bound complex binding site; other site
31964005369	hinge residues; other site
31964005370	1 probable transmembrane helix predicted for CMS1226 by TMHMM2.0 at aa 29-51
31964005371	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964005372	HMMPfam hit to PF00497, Bacterial extracellular solute-binding protein, family 3, score 1.7e-40
31964005373	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964005374	dimer interface [polypeptide binding]; other site
31964005375	conserved gate region; other site
31964005376	putative PBP binding loops; other site
31964005377	ABC-ATPase subunit interface; other site
31964005378	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 1.1e-23
31964005379	4 probable transmembrane helices predicted for CMS1227 by TMHMM2.0 at aa 20-42, 63-85, 146-168 and 181-203
31964005380	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964005381	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964005382	dimer interface [polypeptide binding]; other site
31964005383	conserved gate region; other site
31964005384	putative PBP binding loops; other site
31964005385	ABC-ATPase subunit interface; other site
31964005386	4 probable transmembrane helices predicted for CMS1228 by TMHMM2.0 at aa 20-37, 68-90, 111-133 and 229-251
31964005387	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 2.5e-21
31964005388	phenylalanyl-tRNA synthetase subunit alpha; Validated; Region: pheS; PRK00488
31964005389	Aminoacyl tRNA synthetase class II, N-terminal domain; Region: Phe_tRNA-synt_N; pfam02912
31964005390	Phenylalanyl-tRNA synthetase (PheRS) alpha chain catalytic core domain. PheRS belongs to class II aminoacyl-tRNA synthetases (aaRS) based upon its structure and the presence of three characteristic sequence motifs. This domain is primarily responsible...; Region: PheRS_alpha_core; cd00496
31964005391	dimer interface [polypeptide binding]; other site
31964005392	motif 1; other site
31964005393	active site
31964005394	motif 2; other site
31964005395	motif 3; other site
31964005396	HMMPfam hit to PF02912, Aminoacyl tRNA synthetase,class II, N-terminal, score 8.2e-15
31964005397	Predicted helix-turn-helix motif with score 1334.000, SD 3.73 at aa 58-79, sequence EQRKDAGKLVGQSRARVTQAFQ
31964005398	HMMPfam hit to PF01409, Phenylalanyl-tRNA synthetase, class IIc, score 2.1e-119
31964005399	PS00179 Aminoacyl-transfer RNA synthetases class-II signature 1.
31964005400	phenylalanyl-tRNA synthetase subunit beta; Reviewed; Region: pheT; PRK00629
31964005401	tRNA-binding-domain-containing prokaryotic phenylalanly tRNA synthetase (PheRS) beta chain.  PheRS aminoacylate phenylalanine transfer RNAs (tRNAphe). PheRSs belong structurally to class II aminoacyl tRNA synthetases (aaRSs) but, as they aminoacylate...; Region: tRNA_bind_bactPheRS; cd02796
31964005402	putative tRNA-binding site [nucleotide binding]; other site
31964005403	B3/4 domain; Region: B3_4; pfam03483
31964005404	tRNA synthetase B5 domain; Region: B5; smart00874
31964005405	Phenylalanyl-tRNA synthetase (PheRS) beta chain core domain. PheRS belongs to class II aminoacyl-tRNA synthetases (aaRS) based upon its structure. While class II aaRSs generally aminoacylate the 3'-OH ribose of the appropriate tRNA,  PheRS is an...; Region: PheRS_beta_core; cd00769
31964005406	dimer interface [polypeptide binding]; other site
31964005407	motif 1; other site
31964005408	motif 3; other site
31964005409	motif 2; other site
31964005410	Ferredoxin-fold anticodon binding domain; Region: FDX-ACB; pfam03147
31964005411	HMMPfam hit to PF01588, t-RNA-binding region, score 2.5e-05
31964005412	HMMPfam hit to PF03483, B3/4, score 8.4e-94
31964005413	HMMPfam hit to PF03484, tRNA synthetase, B5, score 7.3e-21
31964005414	HMMPfam hit to PF03147, Ferredoxin-fold anticodon-binding, score 1.9e-29
31964005415	N-acetyl-gamma-glutamyl-phosphate reductase; Validated; Region: argC; PRK00436
31964005416	Semialdehyde dehydrogenase, NAD binding domain; Region: Semialdhyde_dh; smart00859
31964005417	HMMPfam hit to PF01118, Semialdehyde dehydrogenase,score 1e-30
31964005418	HMMPfam hit to PF02774, Semialdehyde dehydrogenase,score 4.9e-38
31964005419	Ornithine acetyltransferase (OAT) family; also referred to as ArgJ. OAT catalyzes the first and fifth steps in arginine biosynthesis, coupling acetylation of glutamate with deacetylation of N-acetylornithine, which allows recycling of the acetyl group in...; Region: OAT; cd02152
31964005420	heterotetramer interface [polypeptide binding]; other site
31964005421	active site pocket [active]
31964005422	cleavage site
31964005423	HMMPfam hit to PF01960, Arginine biosynthesis protein ArgJ, score 1.8e-157
31964005424	AAK_NAGK-C: N-Acetyl-L-glutamate kinase - cyclic (NAGK-C) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of arginine biosynthesis found in some bacteria and photosynthetic organisms using the...; Region: AAK_NAGK-C; cd04250
31964005425	feedback inhibition sensing region; other site
31964005426	homohexameric interface [polypeptide binding]; other site
31964005427	nucleotide binding site [chemical binding]; other site
31964005428	N-acetyl-L-glutamate binding site [chemical binding]; other site
31964005429	HMMPfam hit to PF00696,Aspartate/glutamate/uridylate kinase, score 2e-53
31964005430	acetylornithine aminotransferase; Provisional; Region: argD; PRK03244
31964005431	Acetyl ornithine aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD correspond to ornithine aminotransferase, acetylornithine aminotransferase; Region: OAT_like; cd00610
31964005432	inhibitor-cofactor binding pocket; inhibition site
31964005433	pyridoxal 5'-phosphate binding site [chemical binding]; other site
31964005434	catalytic residue [active]
31964005435	HMMPfam hit to PF00202, Aminotransferase class-III,score 1.4e-136
31964005436	ornithine carbamoyltransferase; Provisional; Region: PRK00779
31964005437	Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain; Region: OTCace_N; pfam02729
31964005438	Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain; Region: OTCace; pfam00185
31964005439	HMMPfam hit to PF02729, Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain, score 7.7e-59
31964005440	PS00097 Aspartate and ornithine carbamoyltransferases signature.
31964005441	HMMPfam hit to PF00185, Aspartate/ornithine carbamoyltransferase, Asp/Orn-binding region, score 6.4e-66
31964005442	argininosuccinate synthase; Provisional; Region: PRK13820
31964005443	Argininosuccinate synthase. The Argininosuccinate synthase is a urea cycle enzyme that catalyzes the penultimate step in arginine biosynthesis: the ATP-dependent ligation of citrulline to aspartate to form argininosuccinate, AMP and pyrophosphate .  In...; Region: Argininosuccinate_Synthase; cd01999
31964005444	ANP binding site [chemical binding]; other site
31964005445	Substrate Binding Site II [chemical binding]; other site
31964005446	Substrate Binding Site I [chemical binding]; other site
31964005447	HMMPfam hit to PF00764, Argininosuccinate synthase,score 5.8e-236
31964005448	PS00564 Argininosuccinate synthase signature 1.
31964005449	PS00565 Argininosuccinate synthase signature 2.
31964005450	argininosuccinate lyase; Provisional; Region: PRK00855
31964005451	Argininosuccinate lyase (argininosuccinase, ASAL); Region: Argininosuccinate_lyase; cd01359
31964005452	active sites [active]
31964005453	tetramer interface [polypeptide binding]; other site
31964005454	HMMPfam hit to PF00206, Fumarate lyase, score 2.1e-62
31964005455	PS00163 Fumarate lyases signature.
31964005456	PS00017 ATP/GTP-binding site motif A (P-loop).
31964005457	1 probable transmembrane helix predicted for CMS1238 by TMHMM2.0 at aa 20-42
31964005458	Alkyladenine DNA glycosylase catalyzes the first step in base excision repair; Region: AAG; cd00540
31964005459	active site
31964005460	DNA binding site [nucleotide binding]
31964005461	HMMPfam hit to PF02245, Methylpurine-DNA glycosylase (MPG), score 1.6e-60
31964005462	5 probable transmembrane helices predicted for CMS1240 by TMHMM2.0 at aa 10-29, 36-58, 68-90, 139-161 and 176-198
31964005463	Predicted helix-turn-helix motif with score 2002.000, SD 6.01 at aa 164-185, sequence GTQREVAAELGVTPQAVSTRLR
31964005464	tyrosyl-tRNA synthetase; Validated; Region: PRK05912
31964005465	catalytic core domain of tyrosinyl-tRNA synthetase; Region: TyrRS_core; cd00805
31964005466	active site
31964005467	HIGH motif; other site
31964005468	dimer interface [polypeptide binding]; other site
31964005469	KMSKS motif; other site
31964005470	HMMPfam hit to PF00579, Aminoacyl-tRNA synthetase,class Ib, score 3.3e-98
31964005471	PS00178 Aminoacyl-transfer RNA synthetases class-I signature.
31964005472	HMMPfam hit to PF01479, RNA-binding S4, score 0.0064
31964005473	Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism]; Region: NagD; COG0647
31964005474	Haloacid dehalogenase-like hydrolases. The haloacid dehalogenase-like (HAD) superfamily includes L-2-haloacid dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, and many others; Region: HAD_like; cd01427
31964005475	active site
31964005476	motif I; other site
31964005477	motif II; other site
31964005478	Haloacid dehalogenase-like hydrolases. The haloacid dehalogenase-like (HAD) superfamily includes L-2-haloacid dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, and many others; Region: HAD_like; cd01427
31964005479	HMMPfam hit to PF00702, Haloacid dehalogenase-like hydrolase, score 3.4e-16
31964005480	Predicted rRNA methylase [Translation, ribosomal structure and biogenesis]; Region: COG1189
31964005481	S4/Hsp/ tRNA synthetase RNA-binding domain; The domain surface is populated by conserved, charged residues that define a likely RNA-binding site;  Found in stress proteins, ribosomal proteins and tRNA synthetases; This may imply a hitherto unrecognized...; Region: S4; cd00165
31964005482	RNA binding surface [nucleotide binding]; other site
31964005483	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
31964005484	S-adenosylmethionine binding site [chemical binding]; other site
31964005485	HMMPfam hit to PF01479, RNA-binding S4, score 3e-10
31964005486	HMMPfam hit to PF01728, Ribosomal RNA methyltransferase RrmJ/FtsJ, score 2.1e-05
31964005487	inorganic polyphosphate/ATP-NAD kinase; Provisional; Region: ppnK; PRK03372
31964005488	ATP-NAD kinase; Region: NAD_kinase; pfam01513
31964005489	HMMPfam hit to PF01513, ATP-NAD/AcoX kinase, score 2e-73
31964005490	ATPase involved in DNA repair [DNA replication, recombination, and repair]; Region: RecN; COG0497
31964005491	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
31964005492	Walker A/P-loop; other site
31964005493	ATP binding site [chemical binding]; other site
31964005494	Q-loop/lid; other site
31964005495	ATP-binding cassette domain of RecN; Region: ABC_RecN; cd03241
31964005496	ABC transporter signature motif; other site
31964005497	Walker B; other site
31964005498	D-loop; other site
31964005499	H-loop/switch region; other site
31964005500	PS00017 ATP/GTP-binding site motif A (P-loop).
31964005501	CTP synthetase; Validated; Region: pyrG; PRK05380
31964005502	CTP synthetase (CTPs) is a two-domain protein, which consists of an N-terminal synthetase domain and C-terminal glutaminase domain. The enzymes hydrolyze the amide bond of glutamine to ammonia and glutamate at the glutaminase domains and transfer nascent...; Region: CTGs; cd03113
31964005503	Catalytic site [active]
31964005504	active site
31964005505	UTP binding site [chemical binding]; other site
31964005506	Type 1 glutamine amidotransferase (GATase1) domain found in Cytidine Triphosphate Synthetase; Region: GATase1_CTP_Synthase; cd01746
31964005507	active site
31964005508	putative oxyanion hole; other site
31964005509	catalytic triad [active]
31964005510	HMMPfam hit to PF06418, CTP synthase, score 2.4e-208
31964005511	HMMPfam hit to PF00117, Glutamine amidotransferase class-I, score 2.9e-54
31964005512	PS00442 Glutamine amidotransferases class-I active site.
31964005513	ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate. Like other members of the Nudix hydrolase superfamily, it requires a divalent cation, such as Mg2+; Region: ADPRase_NUDT5; cd03424
31964005514	dimer interface [polypeptide binding]; other site
31964005515	ADP-ribose binding site [chemical binding]; other site
31964005516	active site
31964005517	nudix motif; other site
31964005518	metal binding site [ion binding]; metal-binding site
31964005519	HMMPfam hit to PF00293, NUDIX hydrolase, score 7.2e-19
31964005520	site-specific tyrosine recombinase XerD; Reviewed; Region: xerD; PRK00283
31964005521	XerD and XerC integrases, DNA breaking-rejoining enzymes, N- and C-terminal domains. XerD-like integrases are involved in the site-specific integration and excision of lysogenic bacteriophage genomes, transposition of conjugative transposons, termination...; Region: INT_XerDC; cd00798
31964005522	active site
31964005523	Int/Topo IB signature motif; other site
31964005524	HMMPfam hit to PF02899, Phage integrase, N-terminal SAM-like, score 1.6e-25
31964005525	HMMPfam hit to PF00589, Phage integrase, score 9.6e-45
31964005526	Predicted helix-turn-helix motif with score 1136.000, SD 3.06 at aa 253-274, sequence LVIKAAAERAGVTEEISPHIFR
31964005527	ATPases involved in chromosome partitioning [Cell division and chromosome partitioning]; Region: Soj; COG1192
31964005528	ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the...; Region: ParA; cd02042
31964005529	P-loop; other site
31964005530	Magnesium ion binding site [ion binding]; other site
31964005531	ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the...; Region: ParA; cd02042
31964005532	Magnesium ion binding site [ion binding]; other site
31964005533	HMMPfam hit to PF01656, Cobyrinic acid a,c-diamide synthase, score 1.1e-51
31964005534	Rec8/ScpA/Scc1-like protein (kleisin family) [Replication,    recombination, and repair]; Region: scpA; COG1354
31964005535	HMMPfam hit to PF02616, Protein of unknown function DUF173, score 6.9e-28
31964005536	Putative transcriptional regulators (Ypuh-like); Region: DUF387; pfam04079
31964005537	HMMPfam hit to PF04079, Conserved hypothetical protein 281, score 1.1e-52
31964005538	16S rRNA uridine-516 pseudouridylate synthase and related pseudouridylate synthases [Translation, ribosomal structure and biogenesis]; Region: RsuA; COG1187
31964005539	S4/Hsp/ tRNA synthetase RNA-binding domain; The domain surface is populated by conserved, charged residues that define a likely RNA-binding site;  Found in stress proteins, ribosomal proteins and tRNA synthetases; This may imply a hitherto unrecognized...; Region: S4; cd00165
31964005540	RNA binding surface [nucleotide binding]; other site
31964005541	Pseudouridine synthases, RsuA subfamily; Region: PseudoU_synth_RsuA_like; cd02870
31964005542	active site
31964005543	HMMPfam hit to PF01479, RNA-binding S4, score 1.8e-11
31964005544	HMMPfam hit to PF00849, Pseudouridine synthase,score 1e-19
31964005545	PS01149 Rsu family of pseudouridine synthase signature.
31964005546	prephenate dehydrogenase; Validated; Region: PRK06545
31964005547	prephenate dehydrogenase; Validated; Region: PRK08507
31964005548	ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme; Region: ACT; cl09141
31964005549	HMMPfam hit to PF02153, Prephenate dehydrogenase,score 1.8e-34
31964005550	cytidylate kinase; Provisional; Region: cmk; PRK00023
31964005551	Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor; Region: CMPK; cd02020
31964005552	CMP-binding site; other site
31964005553	The sites determining sugar specificity; other site
31964005554	HMMPfam hit to PF02224, Cytidylate kinase, score 8.8e-27
31964005555	GTP-binding protein Der; Reviewed; Region: PRK03003
31964005556	EngA1 GTPase contains the first domain of EngA; Region: EngA1; cd01894
31964005557	G1 box; other site
31964005558	GTP/Mg2+ binding site [chemical binding]; other site
31964005559	Switch I region; other site
31964005560	G2 box; other site
31964005561	Switch II region; other site
31964005562	G3 box; other site
31964005563	G4 box; other site
31964005564	G5 box; other site
31964005565	EngA2 GTPase contains the second domain of EngA; Region: EngA2; cd01895
31964005566	G1 box; other site
31964005567	GTP/Mg2+ binding site [chemical binding]; other site
31964005568	Switch I region; other site
31964005569	G2 box; other site
31964005570	G3 box; other site
31964005571	Switch II region; other site
31964005572	G4 box; other site
31964005573	G5 box; other site
31964005574	HMMPfam hit to PF01926, GTP-binding protein,HSR1-related, score 1.1e-39
31964005575	PS00017 ATP/GTP-binding site motif A (P-loop).
31964005576	HMMPfam hit to PF01926, GTP-binding protein,HSR1-related, score 1.2e-37
31964005577	PS00017 ATP/GTP-binding site motif A (P-loop).
31964005578	leucine-zipper of insertion element IS481; Region: LZ_Tnp_IS481; pfam13011
31964005579	Winged helix-turn helix; Region: HTH_29; pfam13551
31964005580	Integrase core domain; Region: rve; pfam00665
31964005581	Integrase core domain; Region: rve_3; pfam13683
31964005582	HMMPfam hit to PF00665, Integrase, catalytic region, score 3.5E-36
31964005583	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964005584	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964005585	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964005586	PS00135 Serine proteases, trypsin family, serine active site.
31964005587	sulfur acquisition oxidoreductase, SfnB family; Region: sulfur_SfnB; TIGR04022
31964005588	Acyl-CoA dehydrogenase; Region: ACAD; cl09933
31964005589	active site
31964005590	Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. Alignment contains also inactive enzymes that have substitutions of the catalytic triad...; Region: Tryp_SPc; cl00149
31964005591	PS00135 Serine proteases, trypsin family, serine active site.
31964005592	PS00134 Serine proteases, trypsin family, histidine active site.
31964005593	3 probable transmembrane helices predicted for CMS1263 by TMHMM2.0 at aa 87-109, 119-141 and 154-176
31964005594	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
31964005595	non-specific DNA binding site [nucleotide binding]; other site
31964005596	salt bridge; other site
31964005597	sequence-specific DNA binding site [nucleotide binding]; other site
31964005598	Predicted Zn peptidase [Amino acid transport and metabolism]; Region: COG2856
31964005599	HMMPfam hit to PF01381, Helix-turn-helix motif,score 1.7e-09
31964005600	Predicted helix-turn-helix motif with score 1788.000, SD 5.28 at aa 27-48, sequence MTATALAAEAGTTPPWVSQAER
31964005601	HMMPfam hit to PF06114, Protein of unknown function DUF955, score 5.5e-18
31964005602	Protein of unknown function (DUF2510); Region: DUF2510; pfam10708
31964005603	PASTA domain of bacterial serine/threonine kinase pknB-like proteins. PknB is a member of a group of related transmembrane sensor kinases present in many gram positive bacteria, which has been shown to regulate cell shape in Mycobacterium tubercolosis; Region: PASTA_pknB; cd06577
31964005604	3 probable transmembrane helices predicted for CMS1266 by TMHMM2.0 at aa 165-187, 192-209 and 224-246
31964005605	HMMPfam hit to PF03793, PASTA, score 5.5e-05
31964005606	Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair]; Region: COG1112
31964005607	AAA domain; Region: AAA_12; pfam13087
31964005608	PS00017 ATP/GTP-binding site motif A (P-loop).
31964005609	Acetyltransferase (GNAT) domain; Region: Acetyltransf_10; pfam13673
31964005610	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cd04301
31964005611	Coenzyme A binding pocket [chemical binding]; other site
31964005612	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 6.6e-11
31964005613	ABC-type dipeptide transport system, periplasmic component [Amino acid transport and metabolism]; Region: DdpA; COG0747
31964005614	The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold; Region: PBP2_NikA_DppA_OppA_like_15; cd08492
31964005615	1 probable transmembrane helix predicted for CMS1270 by TMHMM2.0 at aa 7-29
31964005616	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964005617	HMMPfam hit to PF00496, Bacterial extracellular solute-binding protein, family 5, score 6.4e-58
31964005618	ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism]; Region: DppB; COG0601
31964005619	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964005620	dimer interface [polypeptide binding]; other site
31964005621	conserved gate region; other site
31964005622	putative PBP binding loops; other site
31964005623	ABC-ATPase subunit interface; other site
31964005624	5 probable transmembrane helices predicted for CMS1271 by TMHMM2.0 at aa 2-24, 89-111, 124-146, 161-183 and 262-284
31964005625	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 1.2e-33
31964005626	ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism]; Region: DppC; COG1173
31964005627	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964005628	putative PBP binding loops; other site
31964005629	ABC-ATPase subunit interface; other site
31964005630	6 probable transmembrane helices predicted for CMS1272 by TMHMM2.0 at aa 21-43, 88-110, 123-145, 149-166,205-227 and 247-269
31964005631	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 3.2e-34
31964005632	PS00017 ATP/GTP-binding site motif A (P-loop).
31964005633	HMMPfam hit to PF00005, ABC transporter, score 1e-07
31964005634	PS00211 ABC transporters family signature.
31964005635	HMMPfam hit to PF00005, ABC transporter, score 1.2e-53
31964005636	PS00017 ATP/GTP-binding site motif A (P-loop).
31964005637	PS00211 ABC transporters family signature.
31964005638	putative FMN-dependent luciferase-like monooxygenase, KPN_01858 family; Region: LLM_KPN_01858; TIGR04027
31964005639	Flavin-utilizing monoxygenases; Region: Flavin_utilizing_monoxygenases; cl07892
31964005640	HMMPfam hit to PF00296, Bacterial luciferase, score 1.4e-26
31964005641	CMD domain protein, Avi_7170 family; Region: CMD_Avi_7170; TIGR04029
31964005642	alkylhydroperoxidase domain protein, Avi_7169 family; Region: perox_Avi_7169; TIGR04030
31964005643	uncharacterized peroxidase-related enzyme; Region: peroxid_rel; TIGR01926
31964005644	HMMPfam hit to PF02627, Carboxymuconolactone decarboxylase, score 1.7e-10
31964005645	Glyoxalase-like domain; Region: Glyoxalase_3; pfam13468
31964005646	V8-like Glu-specific endopeptidase [Amino acid transport and metabolism]; Region: COG3591
31964005647	PS00343 Gram-positive cocci surface proteins 'anchoring' hexapeptide.
31964005648	1 probable transmembrane helix predicted for CMS1279 by TMHMM2.0 at aa 15-37
31964005649	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
31964005650	metabolite-proton symporter; Region: 2A0106; TIGR00883
31964005651	putative substrate translocation pore; other site
31964005652	12 probable transmembrane helices predicted for CMS1280 by TMHMM2.0 at aa 55-77, 92-114, 127-149, 159-180,192-214, 224-246, 284-306, 316-338, 345-364, 368-385,406-428 and 438-460
31964005653	HMMPfam hit to PF00083, General substrate transporter, score 9e-27
31964005654	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964005655	PS00217 Sugar transport proteins signature 2.
31964005656	nitrilotriacetate monoxygenase oxidizes nitrilotriacetate utilizing reduced flavin mononucleotide (FMNH2) and oxygen. The FMNH2 is provided by an NADH:flavin mononucleotide (FMN) oxidorductase that uses NADH to reduce FMN to FMNH2; Region: Nitrilotriacetate_monoxgenase; cd01095
31964005657	FMN-dependent oxidoreductase, nitrilotriacetate monooxygenase family; Region: FMN_nitrolo; TIGR03860
31964005658	active site
31964005659	non-prolyl cis peptide bond; other site
31964005660	Acyl-CoA dehydrogenase; Region: ACAD; cl09933
31964005661	sulfur acquisition oxidoreductase, SfnB family; Region: sulfur_SfnB; TIGR04022
31964005662	active site
31964005663	Trypsin-like peptidase domain; Region: Trypsin_2; pfam13365
31964005664	Predicted membrane protein [Function unknown]; Region: COG4270
31964005665	4 probable transmembrane helices predicted for CMS1284 by TMHMM2.0 at aa 28-47, 67-86, 91-113 and 128-150
31964005666	2 probable transmembrane helices predicted for CMS1285 by TMHMM2.0 at aa 274-296 and 311-330
31964005667	HMMPfam hit to PF07687, Peptidase dimerisation domain, score 4e-07
31964005668	Peptidase propeptide and YPEB domain; Region: PepSY; pfam03413
31964005669	1 probable transmembrane helix predicted for CMS1287 by TMHMM2.0 at aa 13-35
31964005670	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964005671	Signal transduction histidine kinase [Signal transduction mechanisms]; Region: BaeS; COG0642
31964005672	Histidine kinase, Adenylyl cyclase, Methyl-accepting protein, and Phosphatase (HAMP) domain. HAMP is a signaling domain which occurs in a wide variety of signaling proteins, many of which are bacterial. The HAMP domain consists of two alpha helices...; Region: HAMP; cd06225
31964005673	dimerization interface [polypeptide binding]; other site
31964005674	Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via...; Region: HisKA; cd00082
31964005675	dimer interface [polypeptide binding]; other site
31964005676	phosphorylation site [posttranslational modification]
31964005677	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
31964005678	ATP binding site [chemical binding]; other site
31964005679	G-X-G motif; other site
31964005680	HMMPfam hit to PF02518, ATP-binding region,ATPase-like, score 2e-39
31964005681	HMMPfam hit to PF00512, Histidine kinase A,N-terminal, score 3.3e-15
31964005682	HMMPfam hit to PF00672, Histidine kinase, HAMP region, score 1.1e-13
31964005683	2 probable transmembrane helices predicted for CMS1288 by TMHMM2.0 at aa 15-37 and 147-169
31964005684	HMMPfam hit to PF00486, Transcriptional regulatory protein, C-terminal, score 3.9e-25
31964005685	HMMPfam hit to PF00072, Response regulator receiver, score 8.1e-35
31964005686	Protein of unknown function (DUF1212); Region: DUF1212; pfam06738
31964005687	9 probable transmembrane helices predicted for CMS1290 by TMHMM2.0 at aa 214-236, 248-270, 275-297,314-336, 346-368, 375-394, 399-421, 428-450 and 463-485
31964005688	HMMPfam hit to PF06738, Protein of unknown function DUF1212, score 4.9e-13
31964005689	This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins; Region: Glo_EDI_BRP_like; cl14632
31964005690	The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic...; Region: MutT_pyrophosphohydrolase; cd03425
31964005691	active site
31964005692	8-oxo-dGMP binding site [chemical binding]; other site
31964005693	nudix motif; other site
31964005694	metal binding site [ion binding]; metal-binding site
31964005695	HMMPfam hit to PF00293, NUDIX hydrolase, score 2.2e-25
31964005696	PS00893 mutT domain signature.
31964005697	Transcriptional regulator [Transcription]; Region: LysR; COG0583
31964005698	Bacterial regulatory helix-turn-helix protein, lysR family; Region: HTH_1; pfam00126
31964005699	Predicted helix-turn-helix motif with score 1138.000, SD 3.06 at aa 16-37, sequence LHLPKAADQLGISRAKLASSIR
31964005700	Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only]; Region: MhpC; COG0596
31964005701	Putative lysophospholipase; Region: Hydrolase_4; pfam12146
31964005702	TAP-like protein; Region: Abhydrolase_4; pfam08386
31964005703	HMMPfam hit to PF00561, Alpha/beta hydrolase fold,score 1.4e-32
31964005704	Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases [Lipid metabolism]; Region: Acs; COG0365
31964005705	Adenylate forming domain, Class I; Region: AFD_class_I; cl17068
31964005706	acyl-activating enzyme (AAE) consensus motif; other site
31964005707	AMP binding site [chemical binding]; other site
31964005708	active site
31964005709	CoA binding site [chemical binding]; other site
31964005710	HMMPfam hit to PF00501, AMP-dependent synthetase and ligase, score 6.8e-117
31964005711	PS00455  AMP-binding domain signature.
31964005712	Putative FMN-binding domain; Region: FMN_bind_2; pfam04299
31964005713	HMMPfam hit to PF04299, Negative transcriptional regulator, score 4.3e-16
31964005714	Predicted metal-dependent hydrolase with the TIM-barrel fold [General function prediction only]; Region: COG1574
31964005715	Superfamily of metallo-dependent hydrolases (also called amidohydrolase superfamily) is a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site. The vast majority of the members have a...; Region: metallo-dependent_hydrolases; cl00281
31964005716	active site
31964005717	NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only]; Region: Qor; COG0604
31964005718	Zeta-crystallin with NADP-dependent quinone reductase activity (QOR); Region: zeta_crystallin; cd08253
31964005719	NAD(P) binding site [chemical binding]; other site
31964005720	HMMPfam hit to PF00107, Zinc-containing alcohol dehydrogenase superfamily, score 1.7e-56
31964005721	3 probable transmembrane helices predicted for CMS1301 by TMHMM2.0 at aa 4-21, 28-50 and 60-79
31964005722	YjeF-related protein N-terminus; Region: YjeF_N; cl00318
31964005723	HMMPfam hit to PF03853, YjeF-related protein,N-terminal, score 1.1e-30
31964005724	SGNH_hydrolase subfamily, FeeA, FeeB and similar esterases/lipases. FeeA and FeeB are part of a biosynthetic gene cluster and may participate in the biosynthesis of long-chain N-acyltyrosines by providing saturated and unsaturated fatty acids, which it...; Region: FeeA_FeeB_like; cd01836
31964005725	active site
31964005726	catalytic triad [active]
31964005727	oxyanion hole [active]
31964005728	probable oxidoreductase, LLM family; Region: LLM_2I7G; TIGR03858
31964005729	Coenzyme F420-dependent N5,N10-methylene tetrahydromethanopterin reductase and related flavin-dependent oxidoreductases [Energy production and conversion]; Region: COG2141
31964005730	HMMPfam hit to PF00296, Bacterial luciferase, score 6e-10
31964005731	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
31964005732	Major Facilitator Superfamily; Region: MFS_1; pfam07690
31964005733	putative substrate translocation pore; other site
31964005734	HMMPfam hit to PF00083, General substrate transporter, score 5.6e-05
31964005735	12 probable transmembrane helices predicted for CMS1305 by TMHMM2.0 at aa 31-53, 63-85, 97-119, 179-201,221-243, 248-265, 278-300, 315-337, 350-369, 374-396,416-438 and 453-475
31964005736	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964005737	Gamma-glutamyltransferase [Amino acid transport and metabolism]; Region: Ggt; cl08040
31964005738	Gamma-glutamyltranspeptidase; Region: G_glu_transpept; pfam01019
31964005739	HMMPfam hit to PF01019,Gamma-glutamyltranspeptidase, score 9.2e-162
31964005740	Iron-sulfur cluster scaffold-like proteins; Region: IscU_like; cd06664
31964005741	trimerization site [polypeptide binding]; other site
31964005742	active site
31964005743	3 probable transmembrane helices predicted for CMS1310 by TMHMM2.0 at aa 10-31, 38-60 and 80-102
31964005744	PAP2_like_2 proteins. PAP2 is a super-family of phosphatases and haloperoxidases. This subgroup, which is specific to bacteria, lacks functional characterization and may act as a membrane-associated lipid phosphatase; Region: PAP2_like_2; cd03392
31964005745	active site
31964005746	Membrane-associated phospholipid phosphatase [Lipid metabolism]; Region: PgpB; COG0671
31964005747	6 probable transmembrane helices predicted for CMS1311 by TMHMM2.0 at aa 29-51, 81-103, 110-127, 153-175,182-204 and 208-230
31964005748	HMMPfam hit to PF01569, Phosphoesterase,PA-phosphatase related, score 5.5e-29
31964005749	guanine deaminase; Provisional; Region: PRK09228
31964005750	Superfamily of metallo-dependent hydrolases (also called amidohydrolase superfamily) is a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site. The vast majority of the members have a...; Region: metallo-dependent_hydrolases; cl00281
31964005751	active site
31964005752	HMMPfam hit to PF01979, Amidohydrolase, score 1.5e-33
31964005753	4 probable transmembrane helices predicted for CMS1313 by TMHMM2.0 at aa 23-45, 55-74, 123-145 and 149-168
31964005754	4 probable transmembrane helices predicted for CMS1314 by TMHMM2.0 at aa 13-35, 45-64, 111-133 and 138-155
31964005755	4 probable transmembrane helices predicted for CMS1315 by TMHMM2.0 at aa 23-45, 55-73, 122-139 and 149-171
31964005756	Xanthine and CO dehydrogenases maturation factor, XdhC/CoxF family [Posttranslational modification, protein turnover, chaperones]; Region: XdhC; COG1975
31964005757	XdhC and CoxI family; Region: XdhC_CoxI; pfam02625
31964005758	XdhC Rossmann domain; Region: XdhC_C; pfam13478
31964005759	HMMPfam hit to PF02625, Protein of unknown function DUF182, score 7.8e-20
31964005760	Amino acid transporters [Amino acid transport and metabolism]; Region: PotE; COG0531
31964005761	12 probable transmembrane helices predicted for CMS1317 by TMHMM2.0 at aa 21-43, 48-70, 103-125, 130-152,159-181, 196-215, 236-258, 280-302, 335-352, 356-375,387-404 and 408-426
31964005762	HMMPfam hit to PF00324, Amino acid permease-associated region, score 1.2e-17
31964005763	Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs [Energy production and conversion]; Region: CoxS; COG2080
31964005764	2Fe-2S iron-sulfur cluster binding domain; Region: Fer2; pfam00111
31964005765	[2Fe-2S] binding domain; Region: Fer2_2; pfam01799
31964005766	Aerobic-type carbon monoxide dehydrogenase, large subunit CoxL/CutL homologs [Energy production and conversion]; Region: CoxL; COG1529
31964005767	Aldehyde oxidase and xanthine dehydrogenase, a/b hammerhead domain; Region: Ald_Xan_dh_C; smart01008
31964005768	Molybdopterin-binding domain of aldehyde dehydrogenase; Region: Ald_Xan_dh_C2; pfam02738
31964005769	HMMPfam hit to PF02738, Aldehyde oxidase and xanthine dehydrogenase, molybdopterin binding, score 1.4e-120
31964005770	HMMPfam hit to PF01315, Aldehyde oxidase and xanthine dehydrogenase, a/b hammerhead, score 2.9e-37
31964005771	HMMPfam hit to PF01799, [2Fe-2S]-binding, score 4.8e-23
31964005772	HMMPfam hit to PF00111, Ferredoxin, score 0.0067
31964005773	PS00197 2Fe-2S ferredoxins, iron-sulfur binding region signature.
31964005774	FAD binding domain in molybdopterin dehydrogenase; Region: FAD_binding_5; pfam00941
31964005775	PS00041 Bacterial regulatory proteins, araC family signature.
31964005776	1 probable transmembrane helix predicted for CMS1320 by TMHMM2.0 at aa 21-43
31964005777	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964005778	3 probable transmembrane helices predicted for CMS1321 by TMHMM2.0 at aa 23-45, 60-82 and 89-111
31964005779	Protein of unknown function (DUF3184); Region: DUF3184; pfam11380
31964005780	DnaJ domain or J-domain.  DnaJ/Hsp40 (heat shock protein 40) proteins are highly conserved and play crucial roles in protein translation, folding, unfolding, translocation, and degradation. They act primarily by stimulating the ATPase activity of Hsp70s; Region: DnaJ; cd06257
31964005781	HSP70 interaction site [polypeptide binding]; other site
31964005782	HMMPfam hit to PF00226, Heat shock protein DnaJ,N-terminal, score 1.9e-19
31964005783	Homeodomain-like domain; Region: HTH_23; cl17451
31964005784	Winged helix-turn helix; Region: HTH_29; pfam13551
31964005785	Integrase core domain; Region: rve; pfam00665
31964005786	Integrase core domain; Region: rve_3; pfam13683
31964005787	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964005788	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964005789	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964005790	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.6e-38
31964005791	S4/Hsp/ tRNA synthetase RNA-binding domain; The domain surface is populated by conserved, charged residues that define a likely RNA-binding site;  Found in stress proteins, ribosomal proteins and tRNA synthetases; This may imply a hitherto unrecognized...; Region: S4; cd00165
31964005792	RNA binding surface [nucleotide binding]; other site
31964005793	HMMPfam hit to PF01479, RNA-binding S4, score 0.0044
31964005794	amine oxidase; Region: PLN02976
31964005795	probable polyamine oxidase; Region: PLN02268
31964005796	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964005797	HMMPfam hit to PF01593, Amine oxidase, score 2.6e-08
31964005798	3 probable transmembrane helices predicted for CMS1329 by TMHMM2.0 at aa 5-22, 37-59 and 72-94
31964005799	alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases; Region: MDR_like_2; cd05289
31964005800	NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only]; Region: Qor; COG0604
31964005801	putative NAD(P) binding site [chemical binding]; other site
31964005802	HMMPfam hit to PF00107, Zinc-containing alcohol dehydrogenase superfamily, score 1.8e-41
31964005803	HMMPfam hit to PF01816, Leucine rich repeat variant, score 5.9
31964005804	HMMPfam hit to PF01816, Leucine rich repeat variant, score 0.0027
31964005805	HMMPfam hit to PF01816, Leucine rich repeat variant, score 0.23
31964005806	NUDIX domain; Region: NUDIX; pfam00293
31964005807	nudix motif; other site
31964005808	HMMPfam hit to PF00293, NUDIX hydrolase, score 2.9e-19
31964005809	Homeodomain-like domain; Region: HTH_23; cl17451
31964005810	Winged helix-turn helix; Region: HTH_29; pfam13551
31964005811	Integrase core domain; Region: rve; pfam00665
31964005812	Integrase core domain; Region: rve_3; pfam13683
31964005813	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.6e-38
31964005814	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964005815	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964005816	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964005817	Glycerophosphodiester phosphodiesterase domain as found in prokaryota and eukaryota, and similar proteins; Region: GDPD; cd08556
31964005818	active site
31964005819	catalytic site [active]
31964005820	metal binding site [ion binding]; metal-binding site
31964005821	Inositol-monophosphatase-like domains. This family of phosphatases is dependent on bivalent metal ions such as Mg++, and many members are inhibited by Li+ (which is thought to displace a bivalent ion in the active site). Substrates include fructose-1; Region: IMPase_like; cd01637
31964005822	active site
31964005823	HMMPfam hit to PF00459, Inositol monophosphatase,score 2.3e-46
31964005824	HMMPfam hit to PF03009, Glycerophosphoryl diester phosphodiesterase, score 3e-43
31964005825	ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]; Region: PotA; COG3842
31964005826	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
31964005827	Walker A/P-loop; other site
31964005828	ATP binding site [chemical binding]; other site
31964005829	Q-loop/lid; other site
31964005830	ABC transporter signature motif; other site
31964005831	Walker B; other site
31964005832	D-loop; other site
31964005833	H-loop/switch region; other site
31964005834	HMMPfam hit to PF00005, ABC transporter, score 1.3e-72
31964005835	PS00211 ABC transporters family signature.
31964005836	PS00017 ATP/GTP-binding site motif A (P-loop).
31964005837	ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism]; Region: PotC; COG1177
31964005838	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964005839	dimer interface [polypeptide binding]; other site
31964005840	conserved gate region; other site
31964005841	putative PBP binding loops; other site
31964005842	ABC-ATPase subunit interface; other site
31964005843	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 2.6e-05
31964005844	6 probable transmembrane helices predicted for CMS1336 by TMHMM2.0 at aa 13-35, 71-93, 102-124, 139-161,181-203 and 236-255
31964005845	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964005846	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964005847	putative PBP binding loops; other site
31964005848	dimer interface [polypeptide binding]; other site
31964005849	ABC-ATPase subunit interface; other site
31964005850	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 1.4e-08
31964005851	6 probable transmembrane helices predicted for CMS1337 by TMHMM2.0 at aa 7-29, 59-81, 94-116, 136-158,189-211 and 245-267
31964005852	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964005853	Bacterial extracellular solute-binding protein; Region: SBP_bac_8; pfam13416
31964005854	hypothetical protein; Provisional; Region: PRK11622
31964005855	HMMPfam hit to PF01547, Bacterial extracellular solute-binding protein, family 1, score 7.6e-10
31964005856	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964005857	Protein of unknown function (DUF3097); Region: DUF3097; pfam11296
31964005858	Zinc metalloprotease (elastase) [Amino acid transport and metabolism]; Region: LasB; COG3227
31964005859	Peptidase M4 family includes thermolysin, protealysin, aureolysin and neutral protease; Region: M4_neutral_protease; cd09597
31964005860	active site
31964005861	Zn binding site [ion binding]; other site
31964005862	HMMPfam hit to PF02868, Peptidase M4, thermolysin,score 2e-37
31964005863	HMMPfam hit to PF01447, Peptidase M4, thermolysin,score 1.3e-30
31964005864	PS00142 Neutral zinc metallopeptidases,zinc-binding region signature.
31964005865	Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms]; Region: CitB; COG4565
31964005866	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
31964005867	active site
31964005868	phosphorylation site [posttranslational modification]
31964005869	intermolecular recognition site; other site
31964005870	dimerization interface [polypeptide binding]; other site
31964005871	Predicted helix-turn-helix motif with score 1264.000, SD 3.49 at aa 191-212, sequence VSAAEVSGALDVSRVTARRYLE
31964005872	HMMPfam hit to PF00072, Response regulator receiver, score 2.7e-28
31964005873	Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms]; Region: CitA; COG3290
31964005874	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
31964005875	ATP binding site [chemical binding]; other site
31964005876	G-X-G motif; other site
31964005877	HMMPfam hit to PF02518, ATP-binding region,ATPase-like, score 1.5e-24
31964005878	2 probable transmembrane helices predicted for CMS1345 by TMHMM2.0 at aa 10-32 and 169-191
31964005879	Sodium:dicarboxylate symporter family; Region: SDF; cl00573
31964005880	Na+/H+-dicarboxylate symporters [Energy production and conversion]; Region: GltP; COG1301
31964005881	9 probable transmembrane helices predicted for CMS1346 by TMHMM2.0 at aa 16-35, 50-72, 85-107, 143-165,186-208, 223-245, 258-280, 306-328 and 335-357
31964005882	HMMPfam hit to PF00375, Sodium:dicarboxylate symporter, score 5e-109
31964005883	PS00713 Sodium:dicarboxylate symporter family signature 1.
31964005884	FOG: FHA domain [Signal transduction mechanisms]; Region: COG1716
31964005885	Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins. Putative nuclear signalling domain. FHA domains may bind phosphothreonine, phosphoserine and sometimes phosphotyrosine. In eukaryotes, many FHA domain-containing proteins...; Region: FHA; cd00060
31964005886	phosphopeptide binding site; other site
31964005887	HMMPfam hit to PF00498, Forkhead-associated, score 7.9e-17
31964005888	Helix-Turn-Helix DNA binding domain of MerR-like transcription regulators; Region: HTH_MerR-like; cd00592
31964005889	MerR HTH family regulatory protein; Region: MerR_1; pfam13411
31964005890	DNA binding residues [nucleotide binding]
31964005891	HMMPfam hit to PF00376, Bacterial regulatory protein, MerR, score 1.1e-05
31964005892	Helix-Turn-Helix DNA binding domain of transcription regulators from the MerR superfamily; Region: HTH_MerR-SF; cl02600
31964005893	Predicted transcriptional regulators [Transcription]; Region: SoxR; COG0789
31964005894	DNA binding residues [nucleotide binding]
31964005895	ATPases involved in chromosome partitioning [Cell division and chromosome partitioning]; Region: Soj; COG1192
31964005896	ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the...; Region: ParA; cd02042
31964005897	Magnesium ion binding site [ion binding]; other site
31964005898	ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the...; Region: ParA; cd02042
31964005899	Magnesium ion binding site [ion binding]; other site
31964005900	HMMPfam hit to PF01656, Cobyrinic acid a,c-diamide synthase, score 2e-25
31964005901	pyruvate carboxylase; Reviewed; Region: PRK12999
31964005902	Carbamoyl-phosphate synthase L chain, N-terminal domain; Region: CPSase_L_chain; pfam00289
31964005903	ATP-grasp domain; Region: ATP-grasp_4; cl17255
31964005904	Biotin carboxylase C-terminal domain; Region: Biotin_carb_C; smart00878
31964005905	Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain; Region: DRE_TIM_PC_TC_5S; cd07937
31964005906	active site
31964005907	catalytic residues [active]
31964005908	metal binding site [ion binding]; metal-binding site
31964005909	homodimer binding site [polypeptide binding]; other site
31964005910	The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase; Region: biotinyl_domain; cd06850
31964005911	carboxyltransferase (CT) interaction site; other site
31964005912	biotinylation site [posttranslational modification]; other site
31964005913	HMMPfam hit to PF00289, Carbamoyl-phosphate synthetase large chain, N-terminal, score 6.9e-36
31964005914	HMMPfam hit to PF02786, Carbamoyl-phosphate synthase L chain, ATP-binding, score 2e-88
31964005915	PS00867 Carbamoyl-phosphate synthase subdomain signature 2.
31964005916	HMMPfam hit to PF02785, Biotin carboxylase,C-terminal, score 1.9e-63
31964005917	HMMPfam hit to PF00682, HMG-CoA lyase-like, score 7.6e-19
31964005918	HMMPfam hit to PF02436, Conserved carboxylase region, score 1.4e-67
31964005919	HMMPfam hit to PF00364, Biotin/lipoyl attachment,score 9.7e-15
31964005920	PS00188 Biotin-requiring enzymes attachment site.
31964005921	mycothione reductase; Reviewed; Region: PRK07846
31964005922	Pyridine nucleotide-disulphide oxidoreductase; Region: Pyr_redox; pfam00070
31964005923	Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain; Region: Pyr_redox_dim; pfam02852
31964005924	HMMPfam hit to PF00070, FAD-dependent pyridine nucleotide-disulphide oxidoreductase, score 2.2e-56
31964005925	PS00076 Pyridine nucleotide-disulphide oxidoreductases class-I active site.
31964005926	HMMPfam hit to PF02852, Pyridine nucleotide-disulphide oxidoreductase dimerisation region,score 1.8e-23
31964005927	Polypeptide or peptide deformylase; a family of metalloenzymes that catalyzes the removal of the N-terminal formyl group in a growing polypeptide chain following translation initiation during protein synthesis in prokaryotes. These enzymes utilize Fe(II)...; Region: Pep_deformylase; cd00487
31964005928	active site
31964005929	catalytic residues [active]
31964005930	metal binding site [ion binding]; metal-binding site
31964005931	HMMPfam hit to PF01327, Formylmethionine deformylase, score 1.1e-36
31964005932	Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism]; Region: FAA1; COG1022
31964005933	Long-chain fatty acid CoA synthetases and Bubblegum-like very long-chain fatty acid CoA synthetases; Region: VL_LC_FACS_like; cd05907
31964005934	acyl-activating enzyme (AAE) consensus motif; other site
31964005935	putative AMP binding site [chemical binding]; other site
31964005936	putative active site [active]
31964005937	putative CoA binding site [chemical binding]; other site
31964005938	HMMPfam hit to PF00501, AMP-dependent synthetase and ligase, score 1.3e-81
31964005939	PS00455  AMP-binding domain signature.
31964005940	ROK family protein (putative glucokinase); Region: ROK_glcA_fam; TIGR00744
31964005941	Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily; Region: NBD_sugar-kinase_HSP70_actin; cd00012
31964005942	nucleotide binding site [chemical binding]; other site
31964005943	HMMPfam hit to PF00480, ROK, score 2.8e-64
31964005944	PS01125 ROK family signature.
31964005945	1-acyl-sn-glycerol-3-phosphate acyltransferase [Lipid metabolism]; Region: PlsC; COG0204
31964005946	Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: AGPAT-like; Region: LPLAT_AGPAT-like; cd07989
31964005947	putative acyl-acceptor binding pocket; other site
31964005948	HMMPfam hit to PF01553, Phospholipid/glycerol acyltransferase, score 1e-32
31964005949	Class-II DAHP synthetase family; Region: DAHP_synth_2; pfam01474
31964005950	HMMPfam hit to PF01474, DAHP synthetase, class II,score 7.3e-246
31964005951	Helix-turn-helix domain; Region: HTH_38; pfam13936
31964005952	Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair]; Region: Tra8; COG2826
31964005953	Integrase core domain; Region: rve; pfam00665
31964005954	PS00017 ATP/GTP-binding site motif A (P-loop).
31964005955	Predicted helix-turn-helix motif with score 1119.000, SD 3.00 at aa 43-64, sequence MSRRVAASRVGVHERTAQDWDR
31964005956	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.8e-28
31964005957	PS01043 Transposases, IS30 family, signature.
31964005958	Serine/Threonine protein kinases, catalytic domain; Region: S_TKc; smart00220
31964005959	Catalytic domain of Protein Kinases; Region: PKc; cd00180
31964005960	active site
31964005961	ATP binding site [chemical binding]; other site
31964005962	substrate binding site [chemical binding]; other site
31964005963	activation loop (A-loop); other site
31964005964	PASTA domain of bacterial serine/threonine kinase pknB-like proteins. PknB is a member of a group of related transmembrane sensor kinases present in many gram positive bacteria, which has been shown to regulate cell shape in Mycobacterium tubercolosis; Region: PASTA_pknB; cd06577
31964005965	PASTA domain of bacterial serine/threonine kinase pknB-like proteins. PknB is a member of a group of related transmembrane sensor kinases present in many gram positive bacteria, which has been shown to regulate cell shape in Mycobacterium tubercolosis; Region: PASTA_pknB; cd06577
31964005966	PASTA domain of bacterial serine/threonine kinase pknB-like proteins. PknB is a member of a group of related transmembrane sensor kinases present in many gram positive bacteria, which has been shown to regulate cell shape in Mycobacterium tubercolosis; Region: PASTA_pknB; cd06577
31964005967	PASTA domain of bacterial serine/threonine kinase pknB-like proteins. PknB is a member of a group of related transmembrane sensor kinases present in many gram positive bacteria, which has been shown to regulate cell shape in Mycobacterium tubercolosis; Region: PASTA_pknB; cd06577
31964005968	HMMPfam hit to PF03793, PASTA, score 0.032
31964005969	HMMPfam hit to PF03793, PASTA, score 0.027
31964005970	HMMPfam hit to PF03793, PASTA, score 1.6e-08
31964005971	1 probable transmembrane helix predicted for CMS1359 by TMHMM2.0 at aa 338-360
31964005972	HMMPfam hit to PF00069, Protein kinase, score 5e-56
31964005973	PS00108 Serine/Threonine protein kinases active-site signature.
31964005974	Lysine Motif is a small domain involved in binding peptidoglycan; Region: LysM; cd00118
31964005975	Lysine Motif is a small domain involved in binding peptidoglycan; Region: LysM; cd00118
31964005976	Lysine Motif is a small domain involved in binding peptidoglycan; Region: LysM; cd00118
31964005977	HMMPfam hit to PF01476, Peptidoglycan-binding LysM,score 8.6e-13
31964005978	HMMPfam hit to PF01476, Peptidoglycan-binding LysM,score 2.7e-13
31964005979	HMMPfam hit to PF01476, Peptidoglycan-binding LysM,score 1.1e-09
31964005980	1 probable transmembrane helix predicted for CMS1360 by TMHMM2.0 at aa 30-52
31964005981	Helix-turn-helix domain; Region: HTH_17; cl17695
31964005982	Predicted helix-turn-helix motif with score 1421.000, SD 4.03 at aa 1-22, sequence MTVPDLVDLLGLTVSRVRRLIE
31964005983	Isoprenoid Biosynthesis enzymes, Class 1; Region: Isoprenoid_Biosyn_C1; cl00210
31964005984	substrate binding pocket [chemical binding]; other site
31964005985	aspartate-rich region 1; other site
31964005986	Isoprenoid Biosynthesis enzymes, Class 1; Region: Isoprenoid_Biosyn_C1; cl00210
31964005987	substrate binding pocket [chemical binding]; other site
31964005988	aspartate-rich region 2; other site
31964005989	substrate-Mg2+ binding site; other site
31964005990	HMMPfam hit to PF00348, Polyprenyl synthetase,score 3.9e-24
31964005991	PS00444 Polyprenyl synthetases signature 2.
31964005992	PS00723 Polyprenyl synthetases signature 1.
31964005993	2 probable transmembrane helices predicted for CMS1363 by TMHMM2.0 at aa 39-61 and 65-84
31964005994	cell division protein MraZ; Reviewed; Region: PRK00326
31964005995	MraZ protein; Region: MraZ; pfam02381
31964005996	MraZ protein; Region: MraZ; pfam02381
31964005997	HMMPfam hit to PF02381, Protein of unknown function UPF0040, score 2.6e-20
31964005998	HMMPfam hit to PF02381, Protein of unknown function UPF0040, score 6.2e-14
31964005999	MraW methylase family; Region: Methyltransf_5; cl17771
31964006000	16S rRNA m(4)C1402 methyltranserfase; Provisional; Region: PRK00050
31964006001	HMMPfam hit to PF01795, Bacterial methyltransferase, score 2.1e-137
31964006002	1 probable transmembrane helix predicted for CMS1366 by TMHMM2.0 at aa 40-62
31964006003	Cell division protein FtsI/penicillin-binding protein 2 [Cell envelope biogenesis, outer membrane]; Region: FtsI; COG0768
31964006004	Penicillin-binding Protein dimerisation domain; Region: PBP_dimer; pfam03717
31964006005	Penicillin binding protein transpeptidase domain; Region: Transpeptidase; pfam00905
31964006006	HMMPfam hit to PF03717, Penicillin-binding protein,dimerisation domain, score 2.2e-30
31964006007	HMMPfam hit to PF00905, Penicillin-binding protein,transpeptidase, score 6.2e-80
31964006008	UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase; Provisional; Region: murE; PRK00139
31964006009	Mur ligase family, catalytic domain; Region: Mur_ligase; pfam01225
31964006010	Mur ligase middle domain; Region: Mur_ligase_M; pfam08245
31964006011	Mur ligase family, glutamate ligase domain; Region: Mur_ligase_C; pfam02875
31964006012	HMMPfam hit to PF01225, Cytoplasmic peptidoglycan synthetase, N-terminal, score 3.7e-43
31964006013	HMMPfam hit to PF02875, Cytoplasmic peptidoglycan synthetases, C-terminal, score 2.8e-28
31964006014	UDP-N-acetylmuramyl pentapeptide synthase [Cell envelope biogenesis, outer membrane]; Region: MurF; COG0770
31964006015	Mur ligase family, catalytic domain; Region: Mur_ligase; pfam01225
31964006016	Mur ligase middle domain; Region: Mur_ligase_M; pfam08245
31964006017	Mur ligase family, glutamate ligase domain; Region: Mur_ligase_C; pfam02875
31964006018	HMMPfam hit to PF01225, Cytoplasmic peptidoglycan synthetase, N-terminal, score 2.8e-53
31964006019	HMMPfam hit to PF02875, Cytoplasmic peptidoglycan synthetases, C-terminal, score 1.1e-14
31964006020	phospho-N-acetylmuramoyl-pentapeptide-transferase; Provisional; Region: mraY; PRK00108
31964006021	Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY) is an enzyme responsible for the formation of the first lipid intermediate in the synthesis of bacterial cell wall peptidoglycan. It catalyzes the formation of...; Region: GT_MraY; cd06852
31964006022	Mg++ binding site [ion binding]; other site
31964006023	putative catalytic motif [active]
31964006024	putative substrate binding site [chemical binding]; other site
31964006025	10 probable transmembrane helices predicted for CMS1370 by TMHMM2.0 at aa 4-26, 50-72, 82-101, 114-136,162-184, 197-218, 238-260, 267-289, 293-315 and 345-367
31964006026	HMMPfam hit to PF00953, Glycosyl transferase,family 4, score 1.4e-38
31964006027	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional; Region: murD; PRK01438
31964006028	TrkA-N domain; Region: TrkA_N; pfam02254
31964006029	Mur ligase middle domain; Region: Mur_ligase_M; pfam08245
31964006030	Mur ligase family, glutamate ligase domain; Region: Mur_ligase_C; pfam02875
31964006031	HMMPfam hit to PF01225, Cytoplasmic peptidoglycan synthetase, N-terminal, score 4.6e-37
31964006032	HMMPfam hit to PF02875, Cytoplasmic peptidoglycan synthetases, C-terminal, score 5.5e-11
31964006033	Cell cycle protein; Region: FTSW_RODA_SPOVE; cl00511
31964006034	10 probable transmembrane helices predicted for CMS1372 by TMHMM2.0 at aa 57-79, 94-116, 123-142, 157-179,191-213, 228-250, 271-293, 321-343, 355-377 and 387-409
31964006035	HMMPfam hit to PF01098, Cell cycle protein, score 9.9e-85
31964006036	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional; Region: murG; PRK00726
31964006037	MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide...; Region: GT1_MurG; cd03785
31964006038	active site
31964006039	homodimer interface [polypeptide binding]; other site
31964006040	HMMPfam hit to PF03033, Glycosyl transferase,family 28, score 6.4e-33
31964006041	HMMPfam hit to PF04101, Glycosyltransferase 28,C-terminal, score 4.5e-40
31964006042	UDP-N-acetylmuramate--L-alanine ligase; Provisional; Region: murC; PRK00421
31964006043	Mur ligase family, catalytic domain; Region: Mur_ligase; pfam01225
31964006044	Mur ligase middle domain; Region: Mur_ligase_M; pfam08245
31964006045	Mur ligase family, glutamate ligase domain; Region: Mur_ligase_C; pfam02875
31964006046	HMMPfam hit to PF01225, Cytoplasmic peptidoglycan synthetase, N-terminal, score 1.1e-46
31964006047	HMMPfam hit to PF02875, Cytoplasmic peptidoglycan synthetases, C-terminal, score 2e-23
31964006048	cell division protein FtsQ; Provisional; Region: PRK05529
31964006049	POTRA domain, FtsQ-type; Region: POTRA_1; pfam08478
31964006050	Cell division protein FtsQ; Region: FtsQ; pfam03799
31964006051	HMMPfam hit to PF03799, Cell division protein FtsQ,score 3.5e-19
31964006052	1 probable transmembrane helix predicted for CMS1375 by TMHMM2.0 at aa 157-179
31964006053	cell division protein FtsZ; Validated; Region: PRK09330
31964006054	FtsZ is a GTPase that is similar to the eukaryotic tubulins and is essential for cell division in prokaryotes.  FtsZ is capable of polymerizing in a GTP-driven process into structures similar to those formed by tubulin. FtsZ forms a ring-shaped septum at...; Region: FtsZ_type1; cd02201
31964006055	nucleotide binding site [chemical binding]; other site
31964006056	SulA interaction site; other site
31964006057	HMMPfam hit to PF00091, Tubulin/FtsZ, GTPase, score 5.8e-88
31964006058	PS01134 FtsZ protein signature 1.
31964006059	PS01135 FtsZ protein signature 2.
31964006060	HMMPfam hit to PF03953, Tubulin/FtsZ, C-terminal,score 2.3e-30
31964006061	Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes; Region: PLPDE_III; cl00261
31964006062	pyridoxal 5'-phosphate (PLP) binding site [chemical binding]; other site
31964006063	catalytic residue [active]
31964006064	HMMPfam hit to PF01168, Alanine racemase,N-terminal, score 7.9e-15
31964006065	PS01211 Uncharacterized protein family UPF0001 signature.
31964006066	Protein of unknown function (DUF552); Region: DUF552; pfam04472
31964006067	HMMPfam hit to PF04472, Protein of unknown function DUF552, score 7.1e-36
31964006068	2 probable transmembrane helices predicted for CMS1379 by TMHMM2.0 at aa 2-24 and 76-98
31964006069	HMMPfam hit to PF05103, DivIVA, score 7.1e-13
31964006070	Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis]; Region: RluA; COG0564
31964006071	Pseudouridine synthase, RsuA/RluD family; Region: PseudoU_synth_RluCD_like; cd02869
31964006072	active site
31964006073	HMMPfam hit to PF01479, RNA-binding S4, score 0.0061
31964006074	HMMPfam hit to PF00849, Pseudouridine synthase,score 1.5e-67
31964006075	PS01129 Rlu family of pseudouridine synthase signature.
31964006076	DNA polymerase III subunit alpha; Validated; Region: dnaE; PRK05673
31964006077	Polymerase and Histidinol Phosphatase domain of alpha-subunit of bacterial polymerase III DnaE3; Region: PHP_PolIIIA_DnaE3; cd12113
31964006078	active site
31964006079	PHP Thumb interface [polypeptide binding]; other site
31964006080	metal binding site [ion binding]; metal-binding site
31964006081	DnaE_OBF: A subfamily of OB folds corresponding to the C-terminal OB-fold nucleic acid binding domain of Thermus aquaticus and Escherichia coli type C replicative DNA polymerase III alpha subunit (DnaE). The DNA polymerase holoenzyme of E. coli contains...; Region: DnaE_OBF; cd04485
31964006082	generic binding surface II; other site
31964006083	generic binding surface I; other site
31964006084	HMMPfam hit to PF02231, Phosphoesterase PHP,N-terminal, score 2e-34
31964006085	HMMPfam hit to PF02811, PHP, C-terminal, score 1.9e-34
31964006086	HMMPfam hit to PF07733, Bacterial DNA polymerase III alpha subunit, score 3.2e-283
31964006087	HMMPfam hit to PF01336, OB-fold nucleic acid binding, score 2.9e-12
31964006088	Flavin reductase like domain; Region: Flavin_Reduct; smart00903
31964006089	HMMPfam hit to PF01613, Flavin reductase-like,score 1.9e-36
31964006090	Histidinol dehydrogenase, HisD, E.C 1.1.1.23. Histidinol dehydrogenase catalyzes the last two steps in the L-histidine biosynthesis pathway, which is conserved in bacteria, archaea, fungi, and plants. These last two steps are (i) the NAD-dependent...; Region: Histidinol_dh; cd06572
31964006091	histidinol dehydrogenase; Region: hisD; TIGR00069
31964006092	NAD binding site [chemical binding]; other site
31964006093	dimerization interface [polypeptide binding]; other site
31964006094	product binding site; other site
31964006095	substrate binding site [chemical binding]; other site
31964006096	zinc binding site [ion binding]; other site
31964006097	catalytic residues [active]
31964006098	HMMPfam hit to PF00815, Histidinol dehydrogenase,score 5.6e-168
31964006099	transcriptional regulator NrdR; Validated; Region: nrdR; PRK00464
31964006100	ATP cone domain; Region: ATP-cone; pfam03477
31964006101	HMMPfam hit to PF03477, ATP-cone, score 3.7e-20
31964006102	dihydroorotate dehydrogenase 2; Reviewed; Region: PRK05286
31964006103	Dihydroorotate dehydrogenase (DHOD) class 2. DHOD catalyzes the oxidation of (S)-dihydroorotate to orotate. This is the fourth step and the only redox reaction in the de novo biosynthesis of UMP, the precursor of all pyrimidine nucleotides. DHOD requires...; Region: DHOD_2_like; cd04738
31964006104	quinone interaction residues [chemical binding]; other site
31964006105	active site
31964006106	catalytic residues [active]
31964006107	FMN binding site [chemical binding]; other site
31964006108	substrate binding site [chemical binding]; other site
31964006109	HMMPfam hit to PF01180, Dihydroorotate dehydrogenase, score 6e-122
31964006110	PS00911 Dihydroorotate dehydrogenase signature 1.
31964006111	PS00912 Dihydroorotate dehydrogenase signature 2.
31964006112	Protein of unknown function (DUF3043); Region: DUF3043; pfam11241
31964006113	2 probable transmembrane helices predicted for CMS1387 by TMHMM2.0 at aa 99-121 and 125-147
31964006114	hypothetical protein; Provisional; Region: PRK07907
31964006115	M20 Dipeptidases; Region: M20_Dipept_like; cd03893
31964006116	active site
31964006117	metal binding site [ion binding]; metal-binding site
31964006118	dimer interface [polypeptide binding]; other site
31964006119	HMMPfam hit to PF01546, Peptidase M20, score 4.8e-17
31964006120	HMMPfam hit to PF07687, Peptidase dimerisation domain, score 1.2e-15
31964006121	Fe-S cluster assembly scaffold protein [Posttranslational modification, protein turnover, chaperones]; Region: sufA; COG0316
31964006122	Predicted helix-turn-helix motif with score 1065.000, SD 2.81 at aa 29-50, sequence TETAEAAHRVGLTDTAASKVKS
31964006123	HMMPfam hit to PF01521, HesB/YadR/YfhF, score 7.7e-47
31964006124	PS01152 Hypothetical hesB/yadR/yfhF family signature.
31964006125	Predicted small integral membrane protein (DUF2160); Region: DUF2160; cl02294
31964006126	cytochrome c oxidase, subunit II; Region: CoxB; TIGR02866
31964006127	Cytochrome C oxidase subunit II, periplasmic domain; Region: COX2; pfam00116
31964006128	3 probable transmembrane helices predicted for CMS1390 by TMHMM2.0 at aa 21-43, 63-85 and 106-128
31964006129	HMMPfam hit to PF00116, Cytochrome c oxidase,subunit II, score 8.5e-15
31964006130	Heme/copper-type cytochrome/quinol oxidases, subunit 1 [Energy production and conversion]; Region: CyoB; COG0843
31964006131	Ubiquinol oxidase subunit I.  Ubiquinol oxidase, the terminal oxidase in the respiratory chains of aerobic bacteria, is a multi-chain transmembrane protein located in the cell membrane.  It catalyzes the reduction of O2 and simultaneously pumps protons...; Region: Ubiquinol_Oxidase_I; cd01662
31964006132	D-pathway; other site
31964006133	Putative ubiquinol binding site [chemical binding]; other site
31964006134	Low-spin heme (heme b) binding site [chemical binding]; other site
31964006135	Putative water exit pathway; other site
31964006136	Binuclear center (heme o3/CuB) [ion binding]; other site
31964006137	K-pathway; other site
31964006138	Putative proton exit pathway; other site
31964006139	HMMPfam hit to PF00115, Cytochrome c oxidase,subunit I, score 1.3e-229
31964006140	12 probable transmembrane helices predicted for CMS1391 by TMHMM2.0 at aa 44-66, 86-108, 129-160, 175-197,218-240, 260-282, 295-317, 327-349, 362-384, 399-421,438-460 and 480-502
31964006141	PS00077 Heme-copper oxidase catalytic subunit,copper B binding region signature.
31964006142	Cytochrome c oxidase subunit IV; Region: Cyt_c_ox_IV; pfam12270
31964006143	4 probable transmembrane helices predicted for CMS1392 by TMHMM2.0 at aa 7-29, 39-61, 82-104 and 109-131
31964006144	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cd04301
31964006145	Coenzyme A binding pocket [chemical binding]; other site
31964006146	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 3.1e-11
31964006147	Homeodomain-like domain; Region: HTH_23; cl17451
31964006148	Winged helix-turn helix; Region: HTH_29; pfam13551
31964006149	Integrase core domain; Region: rve; pfam00665
31964006150	Integrase core domain; Region: rve_3; pfam13683
31964006151	Predicted helix-turn-helix motif with score 1316.000, SD 3.67 at aa 25-46, sequence WPVRRAAERFQCSPATASRWAR
31964006152	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.3e-41
31964006153	1 probable transmembrane helix predicted for CMS1396 by TMHMM2.0 at aa 33-52
31964006154	Anion permease ArsB/NhaD.  These permeases have been shown to translocate sodium, arsenate, antimonite, sulfate and organic anions across biological membranes in all three kingdoms of life.  A typical anion permease contains 8-13 transmembrane helices...; Region: ArsB_NhaD_permease; cl17221
31964006155	Na+/H+ antiporter NhaD and related arsenite permeases [Inorganic ion transport and metabolism]; Region: ArsB; COG1055
31964006156	Anion permease ArsB/NhaD.  These permeases have been shown to translocate sodium, arsenate, antimonite, sulfate and organic anions across biological membranes in all three kingdoms of life.  A typical anion permease contains 8-13 transmembrane helices...; Region: ArsB_NhaD_permease; cl17221
31964006157	HMMPfam hit to PF02040, Arsenical pump membrane protein, score 9.2e-10
31964006158	8 probable transmembrane helices predicted for CMS1397 by TMHMM2.0 at aa 31-53, 66-85, 147-169, 190-207,212-229, 236-258, 315-337 and 350-372
31964006159	Transcriptional regulator [Transcription]; Region: AcrR; COG1309
31964006160	Bacterial regulatory proteins, tetR family; Region: TetR_N; pfam00440
31964006161	HMMPfam hit to PF00440, Bacterial regulatory protein, TetR, score 2.9e-14
31964006162	Predicted helix-turn-helix motif with score 1658.000, SD 4.83 at aa 29-50, sequence TSLQQIADEAGYSKSSVLYHFA
31964006163	MMPL family; Region: MMPL; pfam03176
31964006164	Mn2+ and Fe2+ transporters of the NRAMP family [Inorganic ion transport and metabolism]; Region: MntH; cl15845
31964006165	12 probable transmembrane helices predicted for CMS1399 by TMHMM2.0 at aa 20-39, 172-194, 199-221,231-253, 273-295, 310-332, 365-387, 528-550, 557-579,594-616, 637-656 and 660-682
31964006166	PS00017 ATP/GTP-binding site motif A (P-loop).
31964006167	HMMPfam hit to PF03176, MMPL, score 2.5e-08
31964006168	YhgE/Pip N-terminal domain; Region: pip_yhgE_Nterm; TIGR03061
31964006169	YhgE/Pip C-terminal domain; Region: pip_yhgE_Cterm; TIGR03062
31964006170	6 probable transmembrane helices predicted for CMS1400 by TMHMM2.0 at aa 12-34, 428-450, 470-489,499-521, 528-550 and 584-606
31964006171	Antibiotic biosynthesis monooxygenase; Region: ABM; pfam03992
31964006172	HMMPfam hit to PF03992, Antibiotic biosynthesis monooxygenase, score 1.6e-07
31964006173	Xylose isomerase-like TIM barrel; Region: AP_endonuc_2; pfam01261
31964006174	HMMPfam hit to PF01261, AP endonuclease, family 2,score 2.3e-28
31964006175	Fructosamine kinase; Region: Fructosamin_kin; cl17579
31964006176	HMMPfam hit to PF03881, Fructosamine kinase, score 1.8e-05
31964006177	Trehalose-6-Phosphate Synthase (TPS) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a...; Region: GT1_TPS; cd03788
31964006178	alpha,alpha-trehalose-phosphate synthase [UDP-forming]; Region: trehalose_OtsA; TIGR02400
31964006179	active site
31964006180	homotetramer interface [polypeptide binding]; other site
31964006181	HMMPfam hit to PF00982, Glycosyl transferase,family 20, score 1.4e-186
31964006182	Trehalose-6-phosphatase [Carbohydrate transport and metabolism]; Region: OtsB; COG1877
31964006183	trehalose-6-phosphate phosphatase; Provisional; Region: PRK10187; cl17105
31964006184	HMMPfam hit to PF02358, Trehalose-phosphatase,score 2.5e-22
31964006185	putative monovalent cation/H+ antiporter subunit A; Reviewed; Region: PRK12644
31964006186	NADH-Ubiquinone/plastoquinone (complex I), various chains; Region: Oxidored_q1; pfam00361
31964006187	Multisubunit Na+/H+ antiporter, MnhB subunit [Inorganic ion transport and metabolism]; Region: MnhB; COG2111
31964006188	Domain of unknown function (DUF4040); Region: DUF4040; cl00676
31964006189	24 probable transmembrane helices predicted for CMS1407 by TMHMM2.0 at aa 12-34, 68-87, 99-118, 122-144,157-179, 194-216, 229-248, 258-280, 287-309, 314-336,356-378, 398-420, 441-463, 492-514, 561-583, 598-617,622-641, 645-664, 685-707, 741-760, 837-859, 864-886,899-921 and 936-958
31964006190	HMMPfam hit to PF00361,NADH/Ubiquinone/plastoquinone (complex I), score 4.2e-75
31964006191	HMMPfam hit to PF04039, Na+/H+ antiporter MnhB subunit-related protein, score 1.6e-17
31964006192	putative monovalent cation/H+ antiporter subunit C; Reviewed; Region: PRK07946
31964006193	3 probable transmembrane helices predicted for CMS1408 by TMHMM2.0 at aa 4-23, 30-52 and 72-94
31964006194	HMMPfam hit to PF00420, NADH-ubiquinone oxidoreductase, chain 4L, score 7.4e-10
31964006195	putative monovalent cation/H+ antiporter subunit D; Reviewed; Region: PRK12665
31964006196	NADH-Ubiquinone/plastoquinone (complex I), various chains; Region: Oxidored_q1; pfam00361
31964006197	14 probable transmembrane helices predicted for CMS1409 by TMHMM2.0 at aa 4-26, 33-55, 79-101, 113-132,136-158, 165-187, 213-235, 242-264, 274-296, 303-325,329-351, 372-394, 409-431 and 476-498
31964006198	HMMPfam hit to PF00361,NADH/Ubiquinone/plastoquinone (complex I), score 1.8e-62
31964006199	putative monovalent cation/H+ antiporter subunit E; Reviewed; Region: PRK08965
31964006200	3 probable transmembrane helices predicted for CMS1410 by TMHMM2.0 at aa 13-32, 36-57 and 70-92
31964006201	Multiple resistance and pH regulation protein F (MrpF / PhaF); Region: MrpF_PhaF; cl09154
31964006202	3 probable transmembrane helices predicted for CMS1411 by TMHMM2.0 at aa 7-27, 37-59 and 66-85
31964006203	HMMPfam hit to PF04066, Multiple resistance and pH regulation protein F, score 0.00059
31964006204	putative monovalent cation/H+ antiporter subunit G; Reviewed; Region: PRK12674
31964006205	HMMPfam hit to PF03334, Na+/H+ antiporter subunit,score 1.9e-21
31964006206	2 probable transmembrane helices predicted for CMS1412 by TMHMM2.0 at aa 15-37 and 58-80
31964006207	dihydroxy-acid dehydratase; Provisional; Region: PRK00911
31964006208	HMMPfam hit to PF00920, Dihydroxy-acid and 6-phosphogluconate dehydratase, score 0
31964006209	PS00886 Dihydroxy-acid and 6-phosphogluconate dehydratases signature 1.
31964006210	acetolactate synthase 1 catalytic subunit; Validated; Region: PRK07789
31964006211	Pyrimidine (PYR) binding domain of POX and related proteins; Region: TPP_PYR_POX_like; cd07035
31964006212	PYR/PP interface [polypeptide binding]; other site
31964006213	dimer interface [polypeptide binding]; other site
31964006214	TPP binding site [chemical binding]; other site
31964006215	Thiamine pyrophosphate enzyme, central domain; Region: TPP_enzyme_M; pfam00205
31964006216	Thiamine pyrophosphate (TPP) family, Acetohydroxyacid synthase (AHAS) subfamily, TPP-binding module; composed of proteins similar to the large catalytic subunit of AHAS. AHAS catalyzes the condensation of two molecules of pyruvate to give the...; Region: TPP_AHAS; cd02015
31964006217	TPP-binding site [chemical binding]; other site
31964006218	dimer interface [polypeptide binding]; other site
31964006219	HMMPfam hit to PF02776, Pyruvate decarboxylase,score 1.8e-95
31964006220	HMMPfam hit to PF00205, Pyruvate decarboxylase,score 7.5e-74
31964006221	PS00187 Thiamine pyrophosphate enzymes signature.
31964006222	acetolactate synthase 3 regulatory subunit; Reviewed; Region: ilvH; PRK11895
31964006223	N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS); Region: ACT_AHAS; cd04878
31964006224	putative valine binding site [chemical binding]; other site
31964006225	dimer interface [polypeptide binding]; other site
31964006226	Small subunit of acetolactate synthase; Region: ALS_ss_C; pfam10369
31964006227	HMMPfam hit to PF01842, Amino acid-binding ACT,score 1.1e-19
31964006228	ketol-acid reductoisomerase; Provisional; Region: PRK05479
31964006229	Acetohydroxy acid isomeroreductase, catalytic domain; Region: IlvN; pfam07991
31964006230	Acetohydroxy acid isomeroreductase, catalytic domain; Region: IlvC; pfam01450
31964006231	HMMPfam hit to PF01450, Acetohydroxy acid isomeroreductase, score 1.2e-74
31964006232	3 probable transmembrane helices predicted for CMS1417 by TMHMM2.0 at aa 59-81, 96-118 and 127-144
31964006233	3 probable transmembrane helices predicted for CMS1418 by TMHMM2.0 at aa 26-45, 65-87 and 94-116
31964006234	Predicted membrane protein [Function unknown]; Region: COG4270
31964006235	4 probable transmembrane helices predicted for CMS1419 by TMHMM2.0 at aa 4-26, 54-73, 77-99 and 112-131
31964006236	PS00044 Bacterial regulatory proteins, lysR family signature.
31964006237	D-3-phosphoglycerate dehydrogenase; Provisional; Region: PRK13581
31964006238	Phosphoglycerate dehydrogenases, NAD-binding and catalytic domains; Region: PGDH_4; cd12173
31964006239	ligand binding site [chemical binding]; other site
31964006240	NAD binding site [chemical binding]; other site
31964006241	dimerization interface [polypeptide binding]; other site
31964006242	catalytic site [active]
31964006243	C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH); Region: ACT_3PGDH-xct; cd04902
31964006244	putative L-serine binding site [chemical binding]; other site
31964006245	HMMPfam hit to PF00389, D-isomer specific 2-hydroxyacid dehydrogenase, catalytic region, score 1.2e-21
31964006246	HMMPfam hit to PF02826, D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding, score 2.2e-60
31964006247	PS00065 D-isomer specific 2-hydroxyacid dehydrogenases NAD-binding signature.
31964006248	PS00671 D-isomer specific 2-hydroxyacid dehydrogenases signature 3.
31964006249	HMMPfam hit to PF01842, Amino acid-binding ACT,score 3.5e-08
31964006250	Transcriptional regulator [Transcription]; Region: AcrR; COG1309
31964006251	Bacterial regulatory proteins, tetR family; Region: TetR_N; pfam00440
31964006252	HMMPfam hit to PF00440, Bacterial regulatory protein, TetR, score 4.3e-14
31964006253	Predicted helix-turn-helix motif with score 1164.000, SD 3.15 at aa 49-70, sequence TTLESVAAAAGVSKGGLLYHFG
31964006254	methyl viologen resistance protein SmvA; Provisional; Region: PRK14995
31964006255	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
31964006256	putative substrate translocation pore; other site
31964006257	14 probable transmembrane helices predicted for CMS1422 by TMHMM2.0 at aa 25-47, 57-79, 91-110, 115-137,150-172, 177-199, 206-228, 238-257, 278-300, 315-337,344-361, 365-384, 415-437 and 484-506
31964006258	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964006259	hydrogenase membrane subunit; Validated; Region: PRK08667
31964006260	2 probable transmembrane helices predicted for CMS1423 by TMHMM2.0 at aa 13-32 and 42-64
31964006261	3-isopropylmalate dehydrogenase; Provisional; Region: PRK03437
31964006262	tartrate dehydrogenase; Region: TTC; TIGR02089
31964006263	HMMPfam hit to PF00180, Isocitrate/isopropylmalate dehydrogenase, score 1e-97
31964006264	PS00470 Isocitrate and isopropylmalate dehydrogenases signature.
31964006265	branched-chain amino acid aminotransferase; Provisional; Region: PRK13357
31964006266	BCAT_beta_family: Branched-chain aminotransferase catalyses the transamination of the branched-chain amino acids  leusine, isoleucine and valine to their respective alpha-keto acids, alpha-ketoisocaproate, alpha-keto-beta-methylvalerate and...; Region: BCAT_beta_family; cd01557
31964006267	homodimer interface [polypeptide binding]; other site
31964006268	substrate-cofactor binding pocket; other site
31964006269	catalytic residue [active]
31964006270	HMMPfam hit to PF01063, Aminotransferase, class IV,score 7.8e-116
31964006271	Domain of unknown function (DUF2437); Region: DUF2437; pfam10370
31964006272	2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway) [Secondary metabolites biosynthesis, transport, and catabolism]; Region: MhpD; COG0179
31964006273	Fumarylacetoacetate (FAA) hydrolase family; Region: FAA_hydrolase; pfam01557
31964006274	HMMPfam hit to PF01557, Fumarylacetoacetate (FAA) hydrolase, score 1.3e-75
31964006275	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964006276	glutamyl-tRNA synthetase; Reviewed; Region: gltX; PRK01406
31964006277	catalytic core domain of discriminating glutamyl-tRNA synthetase; Region: GluRS_core; cd00808
31964006278	HIGH motif; other site
31964006279	catalytic core domain of discriminating glutamyl-tRNA synthetase; Region: GluRS_core; cd00808
31964006280	active site
31964006281	KMSKS motif; other site
31964006282	HMMPfam hit to PF00749, Glutamyl-tRNA synthetase,class Ic, score 8.5e-100
31964006283	putative FAD-binding dehydrogenase; Reviewed; Region: PRK12834
31964006284	thioredoxin-disulfide reductase; Region: TRX_reduct; TIGR01292
31964006285	HMMPfam hit to PF00070, FAD-dependent pyridine nucleotide-disulphide oxidoreductase, score 1.5e-07
31964006286	submitted with no further information
31964006287	6 probable transmembrane helices predicted for CMS1431 by TMHMM2.0 at aa 12-34, 44-66, 94-116, 126-148,161-183 and 187-209
31964006288	PS00017 ATP/GTP-binding site motif A (P-loop).
31964006289	Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols. AKRs are present in all phyla and are of importance to both health and industrial...; Region: Aldo_ket_red; cd06660
31964006290	Aldo/keto reductase family; Region: Aldo_ket_red; pfam00248
31964006291	active site
31964006292	catalytic tetrad [active]
31964006293	HMMPfam hit to PF00248, Aldo/keto reductase, score 2.3e-76
31964006294	Transcriptional regulator [Transcription]; Region: AcrR; COG1309
31964006295	HMMPfam hit to PF00440, Bacterial regulatory protein, TetR, score 6.5e-07
31964006296	3-ketoacyl-(acyl-carrier-protein) reductase; Validated; Region: fabG; PRK05653
31964006297	classical (c) SDRs; Region: SDR_c; cd05233
31964006298	NAD(P) binding site [chemical binding]; other site
31964006299	active site
31964006300	HMMPfam hit to PF00106, Short-chain dehydrogenase/reductase SDR, score 5.3e-61
31964006301	PS00061 Short-chain dehydrogenases/reductases family signature.
31964006302	integral membrane protein, TerC family; Region: R_switched_Alx; TIGR03718
31964006303	9 probable transmembrane helices predicted for CMS1435 by TMHMM2.0 at aa 5-27, 40-62, 77-96, 103-125,129-145, 189-207, 222-244, 251-273 and 293-315
31964006304	HMMPfam hit to PF03741, Integral membrane protein TerC, score 1e-81
31964006305	2 probable transmembrane helices predicted for CMS1436 by TMHMM2.0 at aa 10-32 and 119-141
31964006306	Predicted Zn-dependent hydrolases of the beta-lactamase fold [General function prediction only]; Region: COG2220
31964006307	Beta-lactamase superfamily domain; Region: Lactamase_B_3; pfam13483
31964006308	HMMPfam hit to PF00753, Beta-lactamase-like, score 3.1e-05
31964006309	Type 1 glutamine amidotransferase (GATase1)-like domain found in cyanophycinase; Region: GAT1_cyanophycinase; cd03145
31964006310	proposed catalytic triad [active]
31964006311	active site nucleophile [active]
31964006312	Family 1 of Uracil-DNA glycosylase (UDG) enzymes; Region: UDG_F1; cd10027
31964006313	ligand binding site [chemical binding]; other site
31964006314	active site
31964006315	UGI interface [polypeptide binding]; other site
31964006316	catalytic site [active]
31964006317	HMMPfam hit to PF03167, Uracil-DNA glycosylase superfamily, score 2.3e-52
31964006318	PS00130 Uracil-DNA glycosylase signature.
31964006319	Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane]; Region: COG1247
31964006320	Acetyltransferase (GNAT) family; Region: Acetyltransf_1; pfam00583
31964006321	Coenzyme A binding pocket [chemical binding]; other site
31964006322	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 6.7e-12
31964006323	CAAX protease self-immunity; Region: Abi; pfam02517
31964006324	submitted with no further information
31964006325	9 probable transmembrane helices predicted for CMS1441 by TMHMM2.0 at aa 4-26, 137-159, 179-201, 224-246,256-275, 296-315, 320-338, 345-367 and 377-399
31964006326	HMMPfam hit to PF02517, Abortive infection protein,score 1.8e-16
31964006327	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
31964006328	NADH(P)-binding; Region: NAD_binding_10; pfam13460
31964006329	NAD(P) binding site [chemical binding]; other site
31964006330	active site
31964006331	TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure. Specific for this family is the conserved phosphate binding site at the edges of strands 7 and 8. The phosphate...; Region: TIM_phosphate_binding; cl17186
31964006332	phosphate binding site [ion binding]; other site
31964006333	HMMPfam hit to PF00215, Orotidine 5'-phosphate decarboxylase, score 9.3e-51
31964006334	Transcriptional regulators [Transcription]; Region: RpiR; COG1737
31964006335	Hexulose-6-phosphate isomerase (PHI). PHI is a member of the SIS (Sugar ISomerase domain) superfamily. In the ribulose monophosphate pathway of formaldehyde fixation, hexulose-6-phosphate synthase catalyzes the condensation of ribulose-5-phosphate with...; Region: SIS_PHI; cd05005
31964006336	tetramer interface [polypeptide binding]; other site
31964006337	active site
31964006338	HMMPfam hit to PF01380, Sugar isomerase (SIS),score 1.4e-10
31964006339	Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription]; Region: CitB; COG2197
31964006340	C-terminal DNA-binding domain of LuxR-like proteins. This domain contains a helix-turn-helix motif and binds DNA. Proteins belonging to this group are response regulators; some act as transcriptional activators, others as transcriptional repressors. Many...; Region: LuxR_C_like; cd06170
31964006341	DNA binding residues [nucleotide binding]
31964006342	dimerization interface [polypeptide binding]; other site
31964006343	HMMPfam hit to PF02518, ATP-binding region,ATPase-like, score 0.00079
31964006344	HMMPfam hit to PF00196, Bacterial regulatory protein, LuxR, score 9.4e-21
31964006345	PS00622 Bacterial regulatory proteins, luxR family signature.
31964006346	Predicted helix-turn-helix motif with score 1118.000, SD 2.99 at aa 419-440, sequence SRNRAIATSLGISENTVKFHVA
31964006347	5'-nucleotidase/2',3'-cyclic phosphodiesterase and related esterases [Nucleotide transport and metabolism]; Region: UshA; COG0737
31964006348	metallophosphatase superfamily, metallophosphatase domain; Region: MPP_superfamily; cl13995
31964006349	active site
31964006350	metal binding site [ion binding]; metal-binding site
31964006351	5'-nucleotidase, C-terminal domain; Region: 5_nucleotid_C; pfam02872
31964006352	HMMPfam hit to PF00149, Metallophosphoesterase,score 8.7e-12
31964006353	HMMPfam hit to PF02872, 5'-Nucleotidase,C-terminal, score 1.4e-36
31964006354	PS00343 Gram-positive cocci surface proteins 'anchoring' hexapeptide.
31964006355	LXXTG
31964006356	1 probable transmembrane helix predicted for CMS1446 by TMHMM2.0 at aa 668-685
31964006357	Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases [Translation, ribosomal structure and biogenesis]; Region: GatA; COG0154
31964006358	Amidase; Region: Amidase; cl11426
31964006359	HMMPfam hit to PF01425, Amidase, score 1.4e-87
31964006360	PS00017 ATP/GTP-binding site motif A (P-loop).
31964006361	PS00571 Amidases signature.
31964006362	8 probable transmembrane helices predicted for CMS1448 by TMHMM2.0 at aa 12-29, 33-52, 59-81, 85-104,116-138, 153-175, 182-204 and 214-236
31964006363	HMMPfam hit to PF01925, Protein of unknown function DUF81, score 2.1e-05
31964006364	Siderophore-interacting protein [Inorganic ion transport and metabolism]; Region: ViuB; COG2375
31964006365	Siderophore interacting proteins share the domain structure of the ferredoxin reductase like family. Siderophores are produced in various bacteria (and some plants) to extract iron from hosts. Binding constants are high, so iron can be pilfered from...; Region: siderophore_interacting; cd06193
31964006366	FAD binding pocket [chemical binding]; other site
31964006367	FAD binding motif [chemical binding]; other site
31964006368	phosphate binding motif [ion binding]; other site
31964006369	NAD binding pocket [chemical binding]; other site
31964006370	HMMPfam hit to PF04954, Siderophore-interacting protein, score 2.6e-47
31964006371	Siderophore-interacting protein; Region: SIP; pfam04954
31964006372	short chain dehydrogenase; Provisional; Region: PRK06197
31964006373	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
31964006374	NAD(P) binding site [chemical binding]; other site
31964006375	active site
31964006376	HMMPfam hit to PF00106, Short-chain dehydrogenase/reductase SDR, score 1.4e-23
31964006377	Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion]; Region: Lpd; COG1249
31964006378	Pyridine nucleotide-disulphide oxidoreductase; Region: Pyr_redox; pfam00070
31964006379	Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain; Region: Pyr_redox_dim; pfam02852
31964006380	HMMPfam hit to PF02852, Pyridine nucleotide-disulphide oxidoreductase dimerisation region,score 6.2e-24
31964006381	HMMPfam hit to PF00070, FAD-dependent pyridine nucleotide-disulphide oxidoreductase, score 1.2e-40
31964006382	enoyl-CoA hydratase; Provisional; Region: PRK06563
31964006383	Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily. This superfamily contains a diverse set of enzymes including enoyl-CoA hydratase, napthoate synthase, methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA dehydratase, and dienoyl-CoA isomerase; Region: crotonase-like; cd06558
31964006384	substrate binding site [chemical binding]; other site
31964006385	oxyanion hole (OAH) forming residues; other site
31964006386	trimer interface [polypeptide binding]; other site
31964006387	HMMPfam hit to PF00378, Enoyl-CoA hydratase/isomerase, score 4.4e-19
31964006388	Arginase-like amidino hydrolase family; Region: Arginase-like_1; cd09999
31964006389	active site
31964006390	Mn binding site [ion binding]; other site
31964006391	HMMPfam hit to PF00491,Arginase/agmatinase/formiminoglutamase, score 6.5e-09
31964006392	PS00148 Arginase family signature 2.
31964006393	NADP oxidoreductase coenzyme F420-dependent; Region: F420_oxidored; cl17232
31964006394	NADP oxidoreductase coenzyme F420-dependent; Region: F420_oxidored; cl17232
31964006395	HMMPfam hit to PF03807, NADP oxidoreductase,coenzyme F420-dependent, score 7.1e-06
31964006396	Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms]; Region: PspA; COG1842
31964006397	HMMPfam hit to PF04012, PspA/IM30, score 4.2e-11
31964006398	chromosome segregation protein SMC, common bacterial type; Region: SMC_prok_B; TIGR02168
31964006399	4 probable transmembrane helices predicted for CMS1458 by TMHMM2.0 at aa 7-26, 176-198, 621-643 and 658-680
31964006400	HMMPfam hit to PF04536, Protein of unknown function DUF477, score 1.2e-06
31964006401	2'-5' RNA ligase superfamily; Region: 2_5_RNA_ligase2; pfam13563
31964006402	MT0933-like antitoxin protein; Region: MT0933_antitox; pfam14013
31964006403	low GC region containing PASTA domain protein
31964006404	Domain of unknown function (DUF4177); Region: DUF4177; pfam13783
31964006405	PS00343 Gram-positive cocci surface proteins 'anchoring' hexapeptide.
31964006406	PASTA domain of bacterial serine/threonine kinase pknB-like proteins. PknB is a member of a group of related transmembrane sensor kinases present in many gram positive bacteria, which has been shown to regulate cell shape in Mycobacterium tubercolosis; Region: PASTA_pknB; cd06577
31964006407	HMMPfam hit to PF03793, PASTA, score 1.2e-09
31964006408	pyridoxamine-phosphate oxidase; Region: pdxH; TIGR00558
31964006409	Pyridoxamine 5'-phosphate oxidase; Region: Pyridox_oxidase; pfam01243
31964006410	Pyridoxine 5'-phosphate oxidase C-terminal dimerisation region; Region: PNPOx_C; pfam10590
31964006411	HMMPfam hit to PF01243, Pyridoxamine 5'-phosphate oxidase-related, score 3.1e-17
31964006412	Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain; Region: GATase1_2; cd01745
31964006413	catalytic triad [active]
31964006414	HMMPfam hit to PF07722, Peptidase C26, score 1.7e-44
31964006415	HMMPfam hit to PF00117, Glutamine amidotransferase class-I, score 3.6e-05
31964006416	3-ketoacyl-(acyl-carrier-protein) reductase; Validated; Region: fabG; PRK05653
31964006417	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
31964006418	NAD(P) binding site [chemical binding]; other site
31964006419	active site
31964006420	HMMPfam hit to PF00106, Short-chain dehydrogenase/reductase SDR, score 2.8e-72
31964006421	PS00061 Short-chain dehydrogenases/reductases family signature.
31964006422	1 probable transmembrane helix predicted for CMS1466 by TMHMM2.0 at aa 13-35
31964006423	3-ketoacyl-(acyl-carrier-protein) reductase; Validated; Region: fabG; PRK05653
31964006424	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
31964006425	NAD(P) binding site [chemical binding]; other site
31964006426	active site
31964006427	HMMPfam hit to PF00106, Short-chain dehydrogenase/reductase SDR, score 1.1e-63
31964006428	benzoate transport; Region: 2A0115; TIGR00895
31964006429	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
31964006430	putative substrate translocation pore; other site
31964006431	HMMPfam hit to PF00083, General substrate transporter, score 2.3e-08
31964006432	10 probable transmembrane helices predicted for CMS1468 by TMHMM2.0 at aa 43-65, 80-97, 171-193, 203-225,277-299, 314-336, 343-362, 368-390, 403-425 and 435-454
31964006433	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964006434	PS00216 Sugar transport proteins signature 1.
31964006435	Catalytic domain of Helicobacter pylori peptidoglycan deacetylase (HpPgdA) and similar proteins; Region: CE4_HpPgdA_like; cd10938
31964006436	active site
31964006437	catalytic site [active]
31964006438	Zn binding site [ion binding]; other site
31964006439	tetramer interface [polypeptide binding]; other site
31964006440	Predicted xylanase/chitin deacetylase [Carbohydrate transport and metabolism]; Region: CDA1; COG0726
31964006441	HMMPfam hit to PF01522, Polysaccharide deacetylase,score 1.4e-22
31964006442	Type II (periplasmic) bacterial L-asparaginase; Region: L-asparaginase_II; cd08964
31964006443	active site
31964006444	homotetramer interface [polypeptide binding]; other site
31964006445	homodimer interface [polypeptide binding]; other site
31964006446	HMMPfam hit to PF00710, Asparaginase/glutaminase,score 3.2e-64
31964006447	PS00917 Asparaginase / glutaminase active site signature 2.
31964006448	PS00144 Asparaginase / glutaminase active site signature 1.
31964006449	Helix-turn-helix (HTH) DNA binding domain of the LacI family of transcriptional regulators; Region: HTH_LacI; cd01392
31964006450	DNA binding site [nucleotide binding]
31964006451	Transcriptional regulators [Transcription]; Region: PurR; COG1609
31964006452	domain linker motif; other site
31964006453	Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors; Region: PBP1_LacI_like_7; cd06285
31964006454	putative dimerization interface [polypeptide binding]; other site
31964006455	putative ligand binding site [chemical binding]; other site
31964006456	HMMPfam hit to PF00356, Bacterial regulatory protein, LacI, score 1.3e-06
31964006457	Predicted helix-turn-helix motif with score 2078.000, SD 6.26 at aa 9-30, sequence TTQRMIAELAGVSITTVSRVLN
31964006458	HMMPfam hit to PF00532, Periplasmic binding protein/LacI transcriptional regulator, score 8e-23
31964006459	Transglutaminase-like enzymes, putative cysteine proteases [Amino acid transport and metabolism]; Region: COG1305
31964006460	Transglutaminase-like superfamily; Region: Transglut_core; pfam01841
31964006461	HMMPfam hit to PF01841, Transglutaminase-like,score 3.1e-12
31964006462	arginyl-tRNA synthetase; Reviewed; Region: argS; PRK01611
31964006463	Arginyl tRNA synthetase N terminal dom; Region: Arg_tRNA_synt_N; smart01016
31964006464	catalytic core domain of arginyl-tRNA synthetases; Region: ArgRS_core; cd00671
31964006465	active site
31964006466	HIGH motif; other site
31964006467	KMSK motif region; other site
31964006468	tRNA binding surface [nucleotide binding]; other site
31964006469	DALR anticodon binding domain; Region: DALR_1; smart00836
31964006470	anticodon binding site; other site
31964006471	HMMPfam hit to PF03485, Arginyl tRNA synthetase,N-terminal, score 1.7e-21
31964006472	HMMPfam hit to PF00750, Arginyl-tRNA synthetase,class Ic, score 4.1e-124
31964006473	PS00178 Aminoacyl-transfer RNA synthetases class-I signature.
31964006474	HMMPfam hit to PF05746, Arginyl tRNA synthetase anticodon binding, score 2.8e-43
31964006475	Protein of unknown function (DUF2993); Region: DUF2993; pfam11209
31964006476	1 probable transmembrane helix predicted for CMS1475 by TMHMM2.0 at aa 33-55
31964006477	diaminopimelate decarboxylase; Region: lysA; TIGR01048
31964006478	Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Diaminopimelate Decarboxylase; Region: PLPDE_III_DapDC; cd06828
31964006479	active site
31964006480	pyridoxal 5'-phosphate (PLP) binding site [chemical binding]; other site
31964006481	substrate binding site [chemical binding]; other site
31964006482	catalytic residues [active]
31964006483	dimer interface [polypeptide binding]; other site
31964006484	HMMPfam hit to PF02784, Orn/DAP/Arg decarboxylase 2, score 7.3e-68
31964006485	PS00878 Orn/DAP/Arg decarboxylases family 2 pyridoxal-P attachment site.
31964006486	HMMPfam hit to PF00278, Orn/DAP/Arg decarboxylase 2, score 3.6e-31
31964006487	homoserine dehydrogenase; Provisional; Region: PRK06349
31964006488	Homoserine dehydrogenase, NAD binding domain; Region: NAD_binding_3; pfam03447
31964006489	Homoserine dehydrogenase; Region: Homoserine_dh; pfam00742
31964006490	ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains; Region: ACT_HSDH-Hom; cd04881
31964006491	HMMPfam hit to PF03447, Homoserine dehydrogenase,NAD-binding, score 4.8e-41
31964006492	HMMPfam hit to PF00742, Homoserine dehydrogenase,score 9.2e-87
31964006493	PS01042 Homoserine dehydrogenase signature.
31964006494	HMMPfam hit to PF01842, Amino acid-binding ACT,score 5e-08
31964006495	threonine synthase; Reviewed; Region: PRK06721
31964006496	Threonine synthase is a pyridoxal phosphate (PLP) dependent enzyme that catalyses the last reaction in the synthesis of  threonine from aspartate. It proceeds by converting O-phospho-L-homoserine (OPH) into threonine and inorganic phosphate. In plants; Region: Thr-synth_1; cd01563
31964006497	homodimer interface [polypeptide binding]; other site
31964006498	pyridoxal 5'-phosphate binding site [chemical binding]; other site
31964006499	catalytic residue [active]
31964006500	HMMPfam hit to PF00291,Pyridoxal-5'-phosphate-dependent enzyme, beta subunit,score 7.5e-81
31964006501	PS00165 Serine/threonine dehydratases pyridoxal-phosphate attachment site.
31964006502	homoserine kinase; Provisional; Region: PRK01212
31964006503	GHMP kinases N terminal domain; Region: GHMP_kinases_N; pfam00288
31964006504	HMMPfam hit to PF00288, GHMP kinase, score 9.2e-28
31964006505	PS00627 GHMP kinases  ATP-binding domain.
31964006506	Homeodomain-like domain; Region: HTH_23; cl17451
31964006507	Winged helix-turn helix; Region: HTH_29; pfam13551
31964006508	Integrase core domain; Region: rve; pfam00665
31964006509	Integrase core domain; Region: rve_3; pfam13683
31964006510	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.6e-38
31964006511	Rho termination factor, N-terminal domain; Region: Rho_N; smart00959
31964006512	transcription termination factor Rho; Provisional; Region: PRK12608
31964006513	S1_like: Ribosomal protein S1-like RNA-binding domain. Found in a wide variety of RNA-associated proteins. Originally identified in S1 ribosomal protein. This superfamily also contains the Cold Shock Domain (CSD), which is a homolog of the S1 domain; Region: S1_like; cl09927
31964006514	RNA binding site [nucleotide binding]; other site
31964006515	Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase. It is a homohexamer. Each monomer consists of an N-terminal domain of the OB fold, which is responsible for binding to cysteine rich nucleotides. This alignment is of the...; Region: rho_factor; cd01128
31964006516	multimer interface [polypeptide binding]; other site
31964006517	Walker A motif; other site
31964006518	ATP binding site [chemical binding]; other site
31964006519	Walker B motif; other site
31964006520	HMMPfam hit to PF07498, Rho termination factor,N-terminal, score 4.3e-09
31964006521	HMMPfam hit to PF07497, Rho termination factor,RNA-binding, score 1.7e-20
31964006522	HMMPfam hit to PF00006, H+-transporting two-sector ATPase, alpha/beta subunit, central region, score 1.2e-67
31964006523	peptide chain release factor 1; Validated; Region: prfA; PRK00591
31964006524	This domain is found in peptide chain release factors; Region: PCRF; smart00937
31964006525	RF-1 domain; Region: RF-1; pfam00472
31964006526	HMMPfam hit to PF03462, PCRF, score 1.2e-47
31964006527	HMMPfam hit to PF00472, Class I peptide chain release factor, score 6.8e-65
31964006528	PS00745 Prokaryotic-type class I peptide chain release factors signature.
31964006529	N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional; Region: PRK09328
31964006530	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
31964006531	PS00092 N-6 Adenine-specific DNA methylases signature.
31964006532	Haloacid dehalogenase-like hydrolase; Region: HAD_2; pfam13419
31964006533	Haloacid dehalogenase-like hydrolases. The haloacid dehalogenase-like (HAD) superfamily includes L-2-haloacid dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, and many others; Region: HAD_like; cd01427
31964006534	motif II; other site
31964006535	HMMPfam hit to PF00702, Haloacid dehalogenase-like hydrolase, score 7.8e-09
31964006536	Putative translation factor (SUA5) [Translation, ribosomal structure and biogenesis]; Region: SUA5; COG0009
31964006537	HMMPfam hit to PF01300, SUA5/yciO/yrdC, N-terminal,score 4.3e-41
31964006538	UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N- acetylglucosamine-1-phosphate transferase [Cell envelope biogenesis, outer membrane]; Region: Rfe; COG0472
31964006539	This subfamily contains Escherichia coli WecA, Bacillus subtilis TagO and related proteins. WecA is an UDP-N-acetylglucosamine (GlcNAc):undecaprenyl-phosphate (Und-P) GlcNAc-1-phosphate transferase that catalyzes the formation of a phosphodiester bond...; Region: GT_WecA_like; cd06853
31964006540	Mg++ binding site [ion binding]; other site
31964006541	putative catalytic motif [active]
31964006542	substrate binding site [chemical binding]; other site
31964006543	11 probable transmembrane helices predicted for CMS1486 by TMHMM2.0 at aa 5-27, 48-70, 80-96, 108-130,140-159, 166-185, 195-217, 230-247, 262-284, 314-336 and 341-363
31964006544	HMMPfam hit to PF00953, Glycosyl transferase,family 4, score 8.2e-36
31964006545	4 probable transmembrane helices predicted for CMS1487 by TMHMM2.0 at aa 23-45, 52-74, 84-106 and 118-140
31964006546	leucine-zipper of insertion element IS481; Region: LZ_Tnp_IS481; pfam13011
31964006547	Winged helix-turn helix; Region: HTH_29; pfam13551
31964006548	Integrase core domain; Region: rve; pfam00665
31964006549	Integrase core domain; Region: rve_3; pfam13683
31964006550	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964006551	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964006552	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964006553	HMMPfam hit to PF00665, Integrase, catalytic region, score 3.5E-36
31964006554	Truncated hemoglobins (trHbs) are a family of oxygen-binding heme proteins found in cyanobacteria, eubacteria, unicellular eukaryotes, and plants. The truncated hemoglobins have a characteristic two-over-two alpha helical folding pattern that is distinct...; Region: Trunc_globin; cd00454
31964006555	apolar tunnel; other site
31964006556	heme binding site [chemical binding]; other site
31964006557	dimerization interface [polypeptide binding]; other site
31964006558	HMMPfam hit to PF01152, Protozoan/cyanobacterial globin, score 7.3e-41
31964006559	Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane]; Region: MscS; COG0668
31964006560	Mechanosensitive ion channel; Region: MS_channel; pfam00924
31964006561	HMMPfam hit to PF00924, MscS Mechanosensitive ion channel, score 1.5e-34
31964006562	3 probable transmembrane helices predicted for CMS1490 by TMHMM2.0 at aa 15-37, 83-105 and 110-132
31964006563	aminopeptidase N, Streptomyces lividans type; Region: pepN_strep_liv; TIGR02412
31964006564	Peptidase M1 family containing Aminopeptidase N; Region: M1_APN_3; cd09602
31964006565	Zn binding site [ion binding]; other site
31964006566	HMMPfam hit to PF01433, Peptidase M1, membrane alanine aminopeptidase, score 3.6e-68
31964006567	PS00142 Neutral zinc metallopeptidases,zinc-binding region signature.
31964006568	Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold; Region: Thioredoxin_like; cl00388
31964006569	HMMPfam hit to PF01323, DSBA oxidoreductase, score 0.00016
31964006570	ribose-5-phosphate isomerase B; Provisional; Region: PRK05571
31964006571	HMMPfam hit to PF02502, Ribose/galactose isomerase,score 1.1e-20
31964006572	N-terminal domain of the actinomycetal Nei1 and related DNA glycosylases; Region: AcNei1_N; cd08970
31964006573	putative DNA binding site [nucleotide binding]; other site
31964006574	catalytic residue [active]
31964006575	putative H2TH interface [polypeptide binding]; other site
31964006576	putative catalytic residues [active]
31964006577	N-terminal domain of Fpg (formamidopyrimidine-DNA glycosylase, MutM)_Nei (endonuclease VIII) base-excision repair DNA glycosylases; Region: FpgNei_N; cl03119
31964006578	Formamidopyrimidine-DNA glycosylase H2TH domain; Region: H2TH; pfam06831
31964006579	Zinc finger found in FPG and IleRS; Region: zf-FPG_IleRS; pfam06827
31964006580	HMMPfam hit to PF01149, Formamidopyrimidine-DNA glycolase, score 1.8e-08
31964006581	HMMPfam hit to PF06831, Formamidopyrimidine-DNA glycolase, score 3.1e-20
31964006582	DPS protein, ferritin-like diiron-binding domain; Region: DPS; cd01043
31964006583	Ferritin-like domain; Region: Ferritin; pfam00210
31964006584	dimerization interface [polypeptide binding]; other site
31964006585	DPS ferroxidase diiron center [ion binding]; other site
31964006586	ion pore; other site
31964006587	PS00818 Dps protein family signature 1.
31964006588	48 probable transmembrane helices predicted for CMS1496 by TMHMM2.0 at aa 174-196, 200-222, 229-246,261-283, 290-307, 312-334, 347-369, 373-392, 441-463,468-487, 508-530, 567-586, 595-612, 616-635, 642-664,668-685, 697-719, 734-756, 765-787, 797-819, 850-872,877-899, 906-928, 938-955, 968-985, 995-1014, 1034-1053,1063-1080, 1089-1111, 1126-1143, 1155-1174, 1179-1201,1208-1227, 1232-1254, 1333-1350, 1356-1375, 1396-1415,1425-1447, 1454-1476, 1491-1513, 1563-1585, 1595-1617,1637-1659, 1664-1681, 1688-1707, 1712-1731, 1738-1760 and 1765-1784
31964006589	HMMPfam hit to PF03929, PepSY-associated TM helix,score 16
31964006590	trigger factor; Provisional; Region: tig; PRK01490
31964006591	FKBP-type peptidyl-prolyl cis-trans isomerase; Region: FKBP_C; pfam00254
31964006592	Bacterial trigger factor protein (TF) C-terminus; Region: Trigger_C; pfam05698
31964006593	HMMPfam hit to PF05697, Bacterial trigger factor,N-terminal, score 2.6e-53
31964006594	HMMPfam hit to PF00254, Peptidylprolyl isomerase,FKBP-type, score 0.00029
31964006595	HMMPfam hit to PF05698, Bacterial trigger factor,C-terminal, score 1.1e-29
31964006596	Clp protease; Region: CLP_protease; pfam00574
31964006597	Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease; Region: S14_ClpP_2; cd07017
31964006598	oligomer interface [polypeptide binding]; other site
31964006599	active site residues [active]
31964006600	HMMPfam hit to PF00574, Peptidase S14, ClpP, score 1.7e-96
31964006601	ATP-dependent Clp protease proteolytic subunit; Reviewed; Region: PRK12553
31964006602	Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease; Region: S14_ClpP_2; cd07017
31964006603	oligomer interface [polypeptide binding]; other site
31964006604	active site residues [active]
31964006605	HMMPfam hit to PF00574, Peptidase S14, ClpP, score 3.4e-102
31964006606	PS00381 Endopeptidase Clp serine active site.
31964006607	dimethyl sulfone monooxygenase SfnG; Region: LLM_DMSO2_sfnG; TIGR04021
31964006608	Alkanesulfonate monoxygenase is the monoxygenase of a two-component system that catalyzes the conversion of alkanesulfonates to the corresponding aldehyde and sulfite. Alkanesulfonate monoxygenase (SsuD) has an absolute requirement for reduced flavin...; Region: Alkanesulfonate_monoxygenase; cd01094
31964006609	active site
31964006610	dimer interface [polypeptide binding]; other site
31964006611	non-prolyl cis peptide bond; other site
31964006612	insertion regions; other site
31964006613	HMMPfam hit to PF00296, Bacterial luciferase, score 7.6e-07
31964006614	ATP-dependent protease ATP-binding subunit ClpX; Provisional; Region: clpX; PRK05342
31964006615	ClpX C4-type zinc finger; Region: zf-C4_ClpX; pfam06689
31964006616	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
31964006617	Walker A motif; other site
31964006618	ATP binding site [chemical binding]; other site
31964006619	Walker B motif; other site
31964006620	C-terminal, D2-small domain, of ClpB protein; Region: ClpB_D2-small; smart01086
31964006621	HMMPfam hit to PF06689, ClpX C4-type zinc finger,score 7.6e-24
31964006622	HMMPfam hit to PF07724, ATPase family associated with various cellular activities (AAA), score 4.3e-81
31964006623	HMMPfam hit to PF00004, AAA ATPase, central region,score 1e-29
31964006624	PS00017 ATP/GTP-binding site motif A (P-loop).
31964006625	Zn-dependent oligopeptidases [Amino acid transport and metabolism]; Region: Dcp; COG0339
31964006626	Peptidase family M3 dipeptidyl carboxypeptidase (DCP); Region: M3A_DCP; cd06456
31964006627	active site
31964006628	Zn binding site [ion binding]; other site
31964006629	HMMPfam hit to PF01432, Peptidase M3A and M3B,thimet/oligopeptidase F, score 5.2e-131
31964006630	PS00142 Neutral zinc metallopeptidases,zinc-binding region signature.
31964006631	Methyltransferase domain; Region: Methyltransf_31; pfam13847
31964006632	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
31964006633	S-adenosylmethionine binding site [chemical binding]; other site
31964006634	HMMPfam hit to PF01209, UbiE/COQ5 methyltransferase, score 2.6e-07
31964006635	Acetyltransferase (GNAT) family; Region: Acetyltransf_1; pfam00583
31964006636	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 6.3e-11
31964006637	valyl-tRNA synthetase; Reviewed; Region: valS; PRK13208
31964006638	nucleotidyl transferase superfamily; Region: nt_trans; cl00015
31964006639	active site
31964006640	HIGH motif; other site
31964006641	nucleotide binding site [chemical binding]; other site
31964006642	nucleotidyl transferase superfamily; Region: nt_trans; cl00015
31964006643	active site
31964006644	KMSKS motif; other site
31964006645	Anticodon-binding domain of valyl tRNA synthetases; Region: Anticodon_Ia_Val; cd07962
31964006646	tRNA binding surface [nucleotide binding]; other site
31964006647	anticodon binding site; other site
31964006648	HMMPfam hit to PF00133, Aminoacyl-tRNA synthetase,class Ia, score 7.1e-45
31964006649	PS00178 Aminoacyl-transfer RNA synthetases class-I signature.
31964006650	Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis. It catalyzes the reversible decarboxylation and...; Region: PEPCK_GTP; cd00819
31964006651	active site
31964006652	substrate-binding site [chemical binding]; other site
31964006653	metal-binding site [ion binding]
31964006654	GTP binding site [chemical binding]; other site
31964006655	HMMPfam hit to PF00821, Phosphoenolpyruvate carboxykinase (GTP), score 0
31964006656	PS00505 Phosphoenolpyruvate carboxykinase (GTP) signature.
31964006657	Predicted transcriptional regulators [Transcription]; Region: HipB; COG1396
31964006658	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
31964006659	non-specific DNA binding site [nucleotide binding]; other site
31964006660	salt bridge; other site
31964006661	sequence-specific DNA binding site [nucleotide binding]; other site
31964006662	Domain of unknown function (DUF955); Region: DUF955; pfam06114
31964006663	HMMPfam hit to PF01381, Helix-turn-helix motif,score 4.2e-13
31964006664	Predicted helix-turn-helix motif with score 1586.000, SD 4.59 at aa 31-52, sequence LTLQALGERAGILPSQLSMIEN
31964006665	ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]; Region: COG1123
31964006666	ATP-binding cassette domain of nickel/oligopeptides specific transporters; Region: ABC_NikE_OppD_transporters; cd03257
31964006667	Walker A/P-loop; other site
31964006668	ATP binding site [chemical binding]; other site
31964006669	Q-loop/lid; other site
31964006670	ABC transporter signature motif; other site
31964006671	Walker B; other site
31964006672	D-loop; other site
31964006673	H-loop/switch region; other site
31964006674	Oligopeptide/dipeptide transporter, C-terminal region; Region: oligo_HPY; cl07097
31964006675	ATP-binding cassette domain of nickel/oligopeptides specific transporters; Region: ABC_NikE_OppD_transporters; cd03257
31964006676	Walker A/P-loop; other site
31964006677	ATP binding site [chemical binding]; other site
31964006678	Q-loop/lid; other site
31964006679	ABC transporter signature motif; other site
31964006680	Walker B; other site
31964006681	D-loop; other site
31964006682	H-loop/switch region; other site
31964006683	Oligopeptide/dipeptide transporter, C-terminal region; Region: oligo_HPY; cl07097
31964006684	HMMPfam hit to PF00005, ABC transporter, score 5.6e-58
31964006685	PS00211 ABC transporters family signature.
31964006686	PS00017 ATP/GTP-binding site motif A (P-loop).
31964006687	HMMPfam hit to PF00005, ABC transporter, score 5.2e-50
31964006688	PS00017 ATP/GTP-binding site motif A (P-loop).
31964006689	ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism]; Region: DppC; COG1173
31964006690	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964006691	putative PBP binding loops; other site
31964006692	dimer interface [polypeptide binding]; other site
31964006693	ABC-ATPase subunit interface; other site
31964006694	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 1.5e-29
31964006695	6 probable transmembrane helices predicted for CMS1510 by TMHMM2.0 at aa 21-43, 92-114, 126-145, 150-169,200-222 and 254-276
31964006696	ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism]; Region: DppB; COG0601
31964006697	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964006698	dimer interface [polypeptide binding]; other site
31964006699	conserved gate region; other site
31964006700	putative PBP binding loops; other site
31964006701	ABC-ATPase subunit interface; other site
31964006702	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 5.1e-31
31964006703	6 probable transmembrane helices predicted for CMS1511 by TMHMM2.0 at aa 21-43, 116-138, 151-173,188-207, 249-271 and 291-313
31964006704	ABC-type dipeptide transport system, periplasmic component [Amino acid transport and metabolism]; Region: DdpA; COG0747
31964006705	The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold; Region: PBP2_NikA_DppA_OppA_like_15; cd08492
31964006706	HMMPfam hit to PF00496, Bacterial extracellular solute-binding protein, family 5, score 7.9e-59
31964006707	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964006708	Transcriptional regulator [Transcription]; Region: AcrR; COG1309
31964006709	Bacterial regulatory proteins, tetR family; Region: TetR_N; pfam00440
31964006710	HMMPfam hit to PF00440, Bacterial regulatory protein, TetR, score 1.9e-13
31964006711	Predicted helix-turn-helix motif with score 1899.000, SD 5.65 at aa 57-78, sequence TTIEQIAQRAGVSRATFFNYFS
31964006712	1 probable transmembrane helix predicted for CMS1513 by TMHMM2.0 at aa 174-196
31964006713	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
31964006714	S-adenosylmethionine binding site [chemical binding]; other site
31964006715	Homeodomain-like domain; Region: HTH_23; cl17451
31964006716	Winged helix-turn helix; Region: HTH_29; pfam13551
31964006717	Integrase core domain; Region: rve; pfam00665
31964006718	Integrase core domain; Region: rve_3; pfam13683
31964006719	Predicted helix-turn-helix motif with score 1316.000, SD 3.67 at aa 25-46, sequence WPVRRAAERFQCSPATASRWAR
31964006720	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.4e-41
31964006721	Escherichia coli YfcE and related proteins, metallophosphatase domain; Region: MPP_YfcE; cd00841
31964006722	active site
31964006723	metal binding site [ion binding]; metal-binding site
31964006724	homotetramer interface [polypeptide binding]; other site
31964006725	HMMPfam hit to PF00149, Metallophosphoesterase,score 1.4e-09
31964006726	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cl17182
31964006727	Coenzyme A binding pocket [chemical binding]; other site
31964006728	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 0.00049
31964006729	Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron...; Region: FNR_iron_sulfur_binding_3; cd06217
31964006730	FAD binding pocket [chemical binding]; other site
31964006731	FAD binding motif [chemical binding]; other site
31964006732	phosphate binding motif [ion binding]; other site
31964006733	beta-alpha-beta structure motif; other site
31964006734	NAD binding pocket [chemical binding]; other site
31964006735	HMMPfam hit to PF00970, Oxidoreductase FAD-binding region, score 3.3e-16
31964006736	Protein of unknown function (DUF1697); Region: DUF1697; pfam08002
31964006737	Uncharacterized protein conserved in bacteria (DUF2236); Region: DUF2236; pfam09995
31964006738	DNA polymerase IV; Validated; Region: PRK03858
31964006739	DNA Polymerase IV/Kappa; Region: PolY_Pol_IV_kappa; cd03586
31964006740	active site
31964006741	DNA binding site [nucleotide binding]
31964006742	HMMPfam hit to PF00817, UMUC-like DNA-repair protein, score 4.8e-111
31964006743	PS00017 ATP/GTP-binding site motif A (P-loop).
31964006744	2 probable transmembrane helices predicted for CMS1523 by TMHMM2.0 at aa 5-27 and 47-69
31964006745	Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane]; Region: Ugd; COG1004
31964006746	UDP-glucose/GDP-mannose dehydrogenase family, central domain; Region: UDPG_MGDP_dh; pfam00984
31964006747	UDP binding domain; Region: UDPG_MGDP_dh_C; smart00984
31964006748	HMMPfam hit to PF03720, UDP-glucose/GDP-mannose dehydrogenase, score 1.6e-37
31964006749	HMMPfam hit to PF00984, UDP-glucose/GDP-mannose dehydrogenase, score 3e-53
31964006750	HMMPfam hit to PF03721, UDP-glucose/GDP-mannose dehydrogenase, score 4e-70
31964006751	PS00017 ATP/GTP-binding site motif A (P-loop).
31964006752	malto-oligosyltrehalose trehalohydrolase; Region: trehalose_TreZ; TIGR02402
31964006753	N-terminal Early set domain associated with the catalytic domain of Maltooligosyl trehalose trehalohydrolase (also called Glycosyltrehalose trehalohydrolase) and similar proteins; Region: E_set_MTHase_like_N; cd02853
31964006754	Alpha amylase catalytic domain found in Glycosyltrehalose trehalohydrolase (also called Maltooligosyl trehalose Trehalohydrolase); Region: AmyAc_GTHase; cd11325
31964006755	catalytic site [active]
31964006756	active site
31964006757	Domain of unknown function (DUF3459); Region: DUF3459; pfam11941
31964006758	HMMPfam hit to PF00128, Alpha amylase, catalytic region, score 6.7e-10
31964006759	maltooligosyl trehalose synthase; Provisional; Region: PRK14511
31964006760	Alpha amylase catalytic domain found in maltooligosyl trehalose synthase (MTSase); Region: AmyAc_MTSase; cd11336
31964006761	active site
31964006762	catalytic site [active]
31964006763	HMMPfam hit to PF00128, Alpha amylase, catalytic region, score 1.1e-07
31964006764	PS00678 Trp-Asp (WD) repeats signature.
31964006765	HMMPfam hit to PF00128, Alpha amylase, catalytic region, score 2.8e-08
31964006766	HMMPfam hit to PF02922, Glycoside hydrolase, family 13, N-terminal, score 1.1e-29
31964006767	Sporulation protein YtfJ (Spore_YtfJ); Region: Spore_YtfJ; cl01596
31964006768	1 probable transmembrane helix predicted for CMS1529 by TMHMM2.0 at aa 84-106
31964006769	ABC-type cobalt transport system, permease component; Region: ABC_cobalt; pfam09819
31964006770	6 probable transmembrane helices predicted for CMS1530 by TMHMM2.0 at aa 28-50, 65-87, 92-114, 119-136,143-165 and 170-192
31964006771	First domain of the ATP-binding cassette component of cobalt transport system; Region: ABC_cobalt_CbiO_domain1; cd03225
31964006772	ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism]; Region: CbiO; COG1122
31964006773	Walker A/P-loop; other site
31964006774	ATP binding site [chemical binding]; other site
31964006775	Q-loop/lid; other site
31964006776	ABC transporter signature motif; other site
31964006777	Walker B; other site
31964006778	D-loop; other site
31964006779	H-loop/switch region; other site
31964006780	cobalt transport protein ATP-binding subunit; Region: cbiO; TIGR01166
31964006781	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
31964006782	Q-loop/lid; other site
31964006783	ABC transporter signature motif; other site
31964006784	Walker B; other site
31964006785	D-loop; other site
31964006786	H-loop/switch region; other site
31964006787	HMMPfam hit to PF00005, ABC transporter, score 4.2e-42
31964006788	PS00017 ATP/GTP-binding site motif A (P-loop).
31964006789	PS00211 ABC transporters family signature.
31964006790	HMMPfam hit to PF00005, ABC transporter, score 6.8e-41
31964006791	PS00017 ATP/GTP-binding site motif A (P-loop).
31964006792	PS00211 ABC transporters family signature.
31964006793	Cobalt transport protein; Region: CbiQ; cl00463
31964006794	HMMPfam hit to PF02361, Cobalt transport protein,score 9.8e-10
31964006795	4 probable transmembrane helices predicted for CMS1532 by TMHMM2.0 at aa 36-58, 65-87, 107-129 and 237-259
31964006796	PS00043 Bacterial regulatory proteins, gntR family signature.
31964006797	hypothetical protein; Provisional; Region: PRK06547
31964006798	PS00017 ATP/GTP-binding site motif A (P-loop).
31964006799	Minimal MMP-like domain found in Acidothermus cellulolyticus hypothetical protein ACEL2062 and similar protein; Region: MMP_ACEL2062; cd12952
31964006800	HMMPfam hit to PF06262, Protein of unknown function DUF1025, score 3.3e-41
31964006801	DEDDh 3'-5' exonuclease domain of oligoribonuclease and similar proteins; Region: Orn; cd06135
31964006802	catalytic site [active]
31964006803	putative active site [active]
31964006804	putative substrate binding site [chemical binding]; other site
31964006805	dimer interface [polypeptide binding]; other site
31964006806	HMMPfam hit to PF00929, Exonuclease, score 8.5e-18
31964006807	2 probable transmembrane helices predicted for CMS1537 by TMHMM2.0 at aa 2-24 and 48-70
31964006808	TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains. Group I TRX is a small ancient protein that alter the redox...; Region: TRX_family; cd02947
31964006809	catalytic residues [active]
31964006810	NAD synthase [Coenzyme metabolism]; Region: NadE; COG0171
31964006811	NAD+ synthase is a homodimer, which catalyzes the final step in de novo nicotinamide adenine dinucleotide (NAD+) biosynthesis, an amide transfer from either ammonia or glutamine to nicotinic acid adenine dinucleotide (NaAD). The conversion of NaAD to NAD...; Region: NAD_synthase; cd00553
31964006812	homodimer interface [polypeptide binding]; other site
31964006813	NAD binding pocket [chemical binding]; other site
31964006814	ATP binding pocket [chemical binding]; other site
31964006815	Mg binding site [ion binding]; other site
31964006816	active-site loop [active]
31964006817	HMMPfam hit to PF02540, NAD+ synthase, score 4e-63
31964006818	1 probable transmembrane helix predicted for CMS1540 by TMHMM2.0 at aa 19-41
31964006819	methionine sulfoxide reductase A; Provisional; Region: PRK14054
31964006820	HMMPfam hit to PF01625, Peptide methionine sulfoxide reductase, score 5.2e-67
31964006821	MarR family; Region: MarR_2; cl17246
31964006822	helix_turn_helix multiple antibiotic resistance protein; Region: HTH_MARR; smart00347
31964006823	HMMPfam hit to PF01047, Bacterial regulatory protein, MarR, score 2.3e-21
31964006824	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964006825	putative ABC transporter ATP-binding protein; Reviewed; Region: PRK11819
31964006826	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
31964006827	Walker A/P-loop; other site
31964006828	ATP binding site [chemical binding]; other site
31964006829	Q-loop/lid; other site
31964006830	ATP-binding cassette domain of elongation factor 3, subfamily F; Region: ABCF_EF-3; cd03221
31964006831	ABC transporter; Region: ABC_tran_2; pfam12848
31964006832	ATP-binding cassette domain of elongation factor 3, subfamily F; Region: ABCF_EF-3; cd03221
31964006833	HMMPfam hit to PF00005, ABC transporter, score 1.2e-51
31964006834	PS00017 ATP/GTP-binding site motif A (P-loop).
31964006835	PS00211 ABC transporters family signature.
31964006836	HMMPfam hit to PF00005, ABC transporter, score 1.2e-37
31964006837	PS00017 ATP/GTP-binding site motif A (P-loop).
31964006838	PS00211 ABC transporters family signature.
31964006839	4-hydroxybenzoyl-CoA thioesterase (4HBT). Catalyzes the final step in the 4-chlorobenzoate degradation pathway in which 4-chlorobenzoate is converted to 4-hydroxybenzoate in certain soil-dwelling bacteria. 4HBT forms a homotetramer with four active sites; Region: 4HBT; cd00586
31964006840	active site
31964006841	HMMPfam hit to PF03061, Thioesterase superfamily,score 8e-06
31964006842	Acyl-CoA thioesterase [Lipid metabolism]; Region: TesB; COG1946
31964006843	Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP)...; Region: Thioesterase_II_repeat2; cd03445
31964006844	active site
31964006845	Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP)...; Region: Thioesterase_II_repeat1; cd03444
31964006846	catalytic triad [active]
31964006847	dimer interface [polypeptide binding]; other site
31964006848	HMMPfam hit to PF02551, Acyl-CoA thioesterase,score 7.7e-42
31964006849	HMMPfam hit to PF02551, Acyl-CoA thioesterase,score 6.2e-29
31964006850	DNA polymerase III subunits gamma and tau; Provisional; Region: PRK14965
31964006851	Homeodomain-like domain; Region: HTH_23; cl17451
31964006852	Winged helix-turn helix; Region: HTH_29; pfam13551
31964006853	Integrase core domain; Region: rve; pfam00665
31964006854	Integrase core domain; Region: rve_3; pfam13683
31964006855	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964006856	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964006857	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964006858	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.6e-38
31964006859	SOUL heme-binding protein; Region: SOUL; pfam04832
31964006860	HMMPfam hit to PF04832, SOUL heme-binding protein,score 6.3e-46
31964006861	YbaK-like.  The YbaK family of deacylase domains includes the INS amino acid-editing domain of  the bacterial class II prolyl tRNA synthetase (ProRS), and it's trans-acting homologs, YbaK, ProX, and PrdX. The primary function of INS is to hydrolyze...; Region: YbaK_like; cd04332
31964006862	putative deacylase active site [active]
31964006863	HMMPfam hit to PF04073, YbaK/prolyl-tRNA synthetase associated region, score 6.5e-21
31964006864	Predicted dithiol-disulfide isomerase involved in polyketide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism]; Region: FrnE; COG2761
31964006865	DsbA family, FrnE subfamily; FrnE is a DsbA-like protein containing a CXXC motif. It is presumed to be a thiol oxidoreductase involved in polyketide biosynthesis, specifically in the production of the aromatic antibiotics frenolicin and nanaomycins; Region: DsbA_FrnE; cd03024
31964006866	catalytic residues [active]
31964006867	HMMPfam hit to PF01323, DSBA oxidoreductase, score 3.7e-44
31964006868	putative TIM-barrel protein, nifR3 family; Region: nifR3_yhdG; TIGR00737
31964006869	Dihydrouridine synthase-like (DUS-like) FMN-binding domain. Members of this family catalyze the reduction of the 5,6-double bond of a uridine residue on tRNA. Dihydrouridine modification of tRNA is widely observed in prokaryotes and eukaryotes, and also...; Region: DUS_like_FMN; cd02801
31964006870	FMN binding site [chemical binding]; other site
31964006871	active site
31964006872	catalytic residues [active]
31964006873	substrate binding site [chemical binding]; other site
31964006874	HMMPfam hit to PF01207, Dihydrouridine synthase,DuS, score 7.1e-108
31964006875	PS01136 Uncharacterized protein family UPF0034 signature.
31964006876	deoxyguanosinetriphosphate triphosphohydrolase-like protein; Provisional; Region: PRK03007
31964006877	Metal dependent phosphohydrolases with conserved 'HD' motif; Region: HDc; cd00077
31964006878	Zn2+ binding site [ion binding]; other site
31964006879	Mg2+ binding site [ion binding]; other site
31964006880	Phosphohydrolase-associated domain; Region: HD_assoc; pfam13286
31964006881	HMMPfam hit to PF01966, Metal-dependent phosphohydrolase, HD subdomain, score 1.8e-14
31964006882	DNA primase; Validated; Region: dnaG; PRK05667
31964006883	CHC2 zinc finger; Region: zf-CHC2; pfam01807
31964006884	DNA primase catalytic core, N-terminal domain; Region: Toprim_N; pfam08275
31964006885	TOPRIM_DnaG_primases: The topoisomerase-primase (TORPIM) nucleotidyl transferase/hydrolase domain found in the active site regions of proteins similar to Escherichia coli DnaG. Primases synthesize RNA primers for the initiation of DNA replication. DnaG...; Region: TOPRIM_DnaG_primases; cd03364
31964006886	active site
31964006887	metal binding site [ion binding]; metal-binding site
31964006888	interdomain interaction site; other site
31964006889	DnaB-helicase binding domain of primase; Region: DnaB_bind; pfam10410
31964006890	HMMPfam hit to PF01807, Zn-finger, CHC2 type, score 7.9e-47
31964006891	HMMPfam hit to PF01751, TOPRIM, score 8.8e-12
31964006892	ABC-type dipeptide transport system, periplasmic component [Amino acid transport and metabolism]; Region: DdpA; COG0747
31964006893	The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold; Region: PBP2_NikA_DppA_OppA_like_20; cd08519
31964006894	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964006895	HMMPfam hit to PF00496, Bacterial extracellular solute-binding protein, family 5, score 1.8e-55
31964006896	ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism]; Region: DppB; COG0601
31964006897	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964006898	dimer interface [polypeptide binding]; other site
31964006899	conserved gate region; other site
31964006900	putative PBP binding loops; other site
31964006901	ABC-ATPase subunit interface; other site
31964006902	6 probable transmembrane helices predicted for CMS1559 by TMHMM2.0 at aa 31-53, 127-149, 162-184,232-251, 286-308 and 336-358
31964006903	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 2.3e-49
31964006904	ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism]; Region: DppC; COG1173
31964006905	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964006906	dimer interface [polypeptide binding]; other site
31964006907	conserved gate region; other site
31964006908	ABC-ATPase subunit interface; other site
31964006909	6 probable transmembrane helices predicted for CMS1560 by TMHMM2.0 at aa 37-59, 108-130, 137-159,169-191, 233-255 and 278-300
31964006910	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 1.2e-30
31964006911	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964006912	ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]; Region: COG1123
31964006913	ATP-binding cassette domain of nickel/oligopeptides specific transporters; Region: ABC_NikE_OppD_transporters; cd03257
31964006914	Walker A/P-loop; other site
31964006915	ATP binding site [chemical binding]; other site
31964006916	Q-loop/lid; other site
31964006917	ABC transporter signature motif; other site
31964006918	Walker B; other site
31964006919	D-loop; other site
31964006920	H-loop/switch region; other site
31964006921	Oligopeptide/dipeptide transporter, C-terminal region; Region: oligo_HPY; cl07097
31964006922	ATP-binding cassette domain of nickel/oligopeptides specific transporters; Region: ABC_NikE_OppD_transporters; cd03257
31964006923	Walker A/P-loop; other site
31964006924	ATP binding site [chemical binding]; other site
31964006925	Q-loop/lid; other site
31964006926	ABC transporter signature motif; other site
31964006927	Walker B; other site
31964006928	D-loop; other site
31964006929	H-loop/switch region; other site
31964006930	Oligopeptide/dipeptide transporter, C-terminal region; Region: oligo_HPY; pfam08352
31964006931	HMMPfam hit to PF00005, ABC transporter, score 2.1e-59
31964006932	PS00017 ATP/GTP-binding site motif A (P-loop).
31964006933	PS00211 ABC transporters family signature.
31964006934	HMMPfam hit to PF00005, ABC transporter, score 8.1e-63
31964006935	PS00017 ATP/GTP-binding site motif A (P-loop).
31964006936	PS00211 ABC transporters family signature.
31964006937	ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]; Region: DppF; COG1124
31964006938	ATP-binding cassette domain of nickel/oligopeptides specific transporters; Region: ABC_NikE_OppD_transporters; cd03257
31964006939	Walker A/P-loop; other site
31964006940	ATP binding site [chemical binding]; other site
31964006941	Q-loop/lid; other site
31964006942	ABC transporter signature motif; other site
31964006943	Walker B; other site
31964006944	D-loop; other site
31964006945	H-loop/switch region; other site
31964006946	HMMPfam hit to PF00005, ABC transporter, score 2.9e-57
31964006947	PS00017 ATP/GTP-binding site motif A (P-loop).
31964006948	PS00211 ABC transporters family signature.
31964006949	Putative D-isomer specific 2-hydroxyacid dehydrogenases; Region: 2-Hacid_dh_2; cd12159
31964006950	Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism]; Region: SerA; COG0111
31964006951	putative ligand binding site [chemical binding]; other site
31964006952	putative NAD binding site [chemical binding]; other site
31964006953	catalytic site [active]
31964006954	HMMPfam hit to PF02826, D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding, score 2.3e-41
31964006955	PS00671 D-isomer specific 2-hydroxyacid dehydrogenases signature 3.
31964006956	Lactonase, 7-bladed beta-propeller; Region: Lactonase; pfam10282
31964006957	putative hydrolase, CocE/NonD family; Region: /NonD; TIGR00976
31964006958	Prolyl oligopeptidase family; Region: Peptidase_S9; pfam00326
31964006959	X-Pro dipeptidyl-peptidase C-terminal non-catalytic domain; Region: PepX_C; cl08482
31964006960	HMMPfam hit to PF02129, Peptidase S15, score 2.6e-33
31964006961	thiazole/oxazole-forming peptide maturase, SagD family component; Region: TOMM_cyclo_SagD; TIGR03604
31964006962	YcaO-like family; Region: YcaO; pfam02624
31964006963	YcaO-like family; Region: YcaO; pfam02624
31964006964	HMMPfam hit to PF00018, SH3, score 0.15
31964006965	FecCD transport family; Region: FecCD; pfam01032
31964006966	dimer interface [polypeptide binding]; other site
31964006967	9 probable transmembrane helices predicted for CMS1571 by TMHMM2.0 at aa 5-27, 66-88, 95-117, 122-144,156-178, 198-220, 246-268, 283-302 and 315-334
31964006968	HMMPfam hit to PF01032, Bacterial transport system permease protein, score 5.2e-107
31964006969	ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]; Region: FepC; COG1120
31964006970	ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins; Region: ABC_Iron-Siderophores_B12_Hemin; cd03214
31964006971	Walker A/P-loop; other site
31964006972	ATP binding site [chemical binding]; other site
31964006973	Q-loop/lid; other site
31964006974	ABC transporter signature motif; other site
31964006975	Walker B; other site
31964006976	D-loop; other site
31964006977	H-loop/switch region; other site
31964006978	HMMPfam hit to PF00005, ABC transporter, score 1.6e-56
31964006979	PS00017 ATP/GTP-binding site motif A (P-loop).
31964006980	PS00211 ABC transporters family signature.
31964006981	proposed F420-0 ABC transporter, periplasmic F420-0 binding protein; Region: F420-O_ABCperi; TIGR03868
31964006982	Helical backbone metal receptor (TroA-like domain). These proteins have been shown to function in the ABC transport of ferric siderophores and metal ions such as Mn2+, Fe3+, Cu2+ and/or Zn2+.  Their ligand binding site is formed in the interface between...; Region: TroA-like; cl00262
31964006983	intersubunit interface [polypeptide binding]; other site
31964006984	1 probable transmembrane helix predicted for CMS1573 by TMHMM2.0 at aa 13-35
31964006985	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964006986	HMMPfam hit to PF01497, Periplasmic binding protein, score 5.7e-12
31964006987	H+ Antiporter protein; Region: 2A0121; TIGR00900
31964006988	12 probable transmembrane helices predicted for CMS1574 by TMHMM2.0 at aa 21-43, 53-75, 87-106, 116-138,151-173, 177-199, 234-256, 266-285, 292-314, 319-341,361-383 and 387-406
31964006989	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964006990	Homeodomain-like domain; Region: HTH_23; cl17451
31964006991	Winged helix-turn helix; Region: HTH_29; pfam13551
31964006992	Integrase core domain; Region: rve; pfam00665
31964006993	Integrase core domain; Region: rve_3; pfam13683
31964006994	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964006995	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964006996	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964006997	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.6e-38
31964006998	Polypeptide or peptide deformylase; a family of metalloenzymes that catalyzes the removal of the N-terminal formyl group in a growing polypeptide chain following translation initiation during protein synthesis in prokaryotes. These enzymes utilize Fe(II)...; Region: Pep_deformylase; cd00487
31964006999	active site
31964007000	catalytic residues [active]
31964007001	metal binding site [ion binding]; metal-binding site
31964007002	HMMPfam hit to PF01327, Formylmethionine deformylase, score 5.2e-59
31964007003	Magnesium transporter NIPA; Region: Mg_trans_NIPA; pfam05653
31964007004	9 probable transmembrane helices predicted for CMS1577 by TMHMM2.0 at aa 15-36, 62-84, 89-111, 124-146,156-178, 183-205, 215-234, 246-268 and 273-295
31964007005	This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1; Region: GT1_UGDG_like; cd03817
31964007006	Glycosyltransferase [Cell envelope biogenesis, outer membrane]; Region: RfaG; COG0438
31964007007	putative ADP-binding pocket [chemical binding]; other site
31964007008	HMMPfam hit to PF00534, Glycosyl transferase, group 1, score 1.7e-39
31964007009	Predicted acyltransferases [Lipid metabolism]; Region: COG1835
31964007010	glucans biosynthesis protein; Provisional; Region: opgC; PRK03854
31964007011	HMMPfam hit to PF01757, Acyltransferase 3, score 5.6e-68
31964007012	10 probable transmembrane helices predicted for CMS1579 by TMHMM2.0 at aa 132-154, 175-197, 247-265,272-291, 306-328, 335-357, 363-385, 398-417, 421-443 and 471-493
31964007013	GDP-fucose synthetase, extended (e) SDRs; Region: GDP_FS_SDR_e; cd05239
31964007014	GDP-4-keto-6-deoxymannose-3, 5-epimerase-4-reductase; Region: PLN02725
31964007015	NADP binding site [chemical binding]; other site
31964007016	active site
31964007017	putative substrate binding site [chemical binding]; other site
31964007018	GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane]; Region: Gmd; COG1089
31964007019	GDP-mannose 4,6 dehydratase, extended (e) SDRs; Region: GDP_MD_SDR_e; cd05260
31964007020	NADP-binding site; other site
31964007021	homotetramer interface [polypeptide binding]; other site
31964007022	substrate binding site [chemical binding]; other site
31964007023	homodimer interface [polypeptide binding]; other site
31964007024	active site
31964007025	HMMPfam hit to PF01370, NAD-dependent epimerase/dehydratase, score 2.2e-13
31964007026	PS00061 Short-chain dehydrogenases/reductases family signature.
31964007027	This family is most closely related to the GT1 family of glycosyltransferases. wbuB in E. coli is involved in the biosynthesis of the O26 O-antigen.  It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase; Region: GT1_wbuB_like; cd03794
31964007028	putative glycosyl transferase; Provisional; Region: PRK10307
31964007029	HMMPfam hit to PF00534, Glycosyl transferase, group 1, score 0.00023
31964007030	putative acyl transferase; Provisional; Region: PRK10502
31964007031	wcaF-like: This group is composed of the protein product of the E. coli wcaF gene and similar proteins. WcaF is part of the gene cluster responsible for the biosynthesis of the extracellular polysaccharide colanic acid. The wcaF protein is predicted to...; Region: LbH_wcaF_like; cd05825
31964007032	putative trimer interface [polypeptide binding]; other site
31964007033	putative active site [active]
31964007034	putative substrate binding site [chemical binding]; other site
31964007035	putative CoA binding site [chemical binding]; other site
31964007036	Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate...; Region: Glycosyltransferase_GTB_type; cl10013
31964007037	Glycosyltransferase [Cell envelope biogenesis, outer membrane]; Region: RfaG; COG0438
31964007038	HMMPfam hit to PF00534, Glycosyl transferase, group 1, score 1.8e-16
31964007039	12 probable transmembrane helices predicted for CMS1585 by TMHMM2.0 at aa 31-53, 63-85, 92-114, 129-151,178-200, 215-237, 257-276, 280-297, 304-323, 413-432,445-464 and 468-485
31964007040	Polysaccharide pyruvyl transferase; Region: PS_pyruv_trans; pfam04230
31964007041	This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to...; Region: GT1_YqgM_like; cd03801
31964007042	Glycosyltransferase [Cell envelope biogenesis, outer membrane]; Region: RfaG; COG0438
31964007043	HMMPfam hit to PF00534, Glycosyl transferase, group 1, score 4.9e-09
31964007044	Multidrug and toxic compound extrusion family and similar proteins; Region: MATE_like; cl09326
31964007045	Membrane protein involved in the export of O-antigen and teichoic acid [General function prediction only]; Region: RfbX; COG2244
31964007046	8 probable transmembrane helices predicted for CMS1589 by TMHMM2.0 at aa 3-25, 35-57, 78-100, 163-185,275-297, 312-334, 341-363 and 367-389
31964007047	HMMPfam hit to PF01943, Polysaccharide biosynthesis protein, score 1.4e-15
31964007048	exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase; Region: EPS_sugtrans; TIGR03025
31964007049	Bacterial sugar transferase; Region: Bac_transf; pfam02397
31964007050	HMMPfam hit to PF02397, Bacterial sugar transferase, score 1.8e-79
31964007051	5 probable transmembrane helices predicted for CMS1590 by TMHMM2.0 at aa 61-83, 103-125, 138-157, 162-184 and 339-361
31964007052	Cold-Shock Protein (CSP) contains an S1-like cold-shock domain (CSD) that is found in eukaryotes, prokaryotes, and archaea.  CSP's include the major cold-shock proteins CspA and CspB in bacteria and the eukaryotic gene regulatory factor Y-box...; Region: CSP_CDS; cd04458
31964007053	DNA-binding site [nucleotide binding]; DNA binding site
31964007054	RNA-binding motif; other site
31964007055	HMMPfam hit to PF00313, Cold-shock protein,DNA-binding, score 1.1e-42
31964007056	PS00352 'Cold-shock' DNA-binding domain signature.
31964007057	bifunctional 3'-5' exonuclease/DNA polymerase; Provisional; Region: PRK14975
31964007058	Family A polymerase primarily fills DNA gaps that arise during DNA repair, recombination and replication; Region: DNA_pol_A; cd06444
31964007059	active site
31964007060	DNA binding site [nucleotide binding]
31964007061	catalytic site [active]
31964007062	HMMPfam hit to PF00476, DNA-directed DNA polymerase, score 4e-10
31964007063	Protein of unknown function (DUF1684); Region: DUF1684; pfam07920
31964007064	Predicted transcriptional regulators [Transcription]; Region: COG1695
31964007065	Transcriptional regulator PadR-like family; Region: PadR; pfam03551
31964007066	HMMPfam hit to PF03551, Transcriptional regulator PadR-like, score 1.9e-08
31964007067	Protein of unknown function (DUF3145); Region: DUF3145; pfam11343
31964007068	beta-ketoacyl-acyl-carrier-protein synthase II; Region: fabF; TIGR03150
31964007069	Beta-ketoacyl-acyl carrier protein (ACP) synthase (KAS), type I and II. KASs are responsible for the elongation steps in fatty acid biosynthesis. KASIII catalyses the initial condensation and KAS I and II catalyze further elongation steps by Claisen...; Region: KAS_I_II; cd00834
31964007070	dimer interface [polypeptide binding]; other site
31964007071	active site
31964007072	HMMPfam hit to PF02801, Beta-ketoacyl synthase,score 7.1e-48
31964007073	HMMPfam hit to PF00109, Beta-ketoacyl synthase,score 1.4e-64
31964007074	acyl carrier protein; Provisional; Region: acpP; PRK00982
31964007075	HMMPfam hit to PF00550, Phosphopantetheine-binding,score 6.2e-15
31964007076	3-oxoacyl-(acyl carrier protein) synthase III; Reviewed; Region: PRK09352
31964007077	Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems. It is found in bacteria and plants. Elongation of fatty acids in the type II systems occurs by Claisen condensation of malonyl-acyl...; Region: KAS_III; cd00830
31964007078	dimer interface [polypeptide binding]; other site
31964007079	active site
31964007080	CoA binding pocket [chemical binding]; other site
31964007081	malonyl CoA-acyl carrier protein transacylase; Region: fabD; TIGR00128
31964007082	(acyl-carrier-protein) S-malonyltransferase [Lipid metabolism]; Region: FabD; COG0331
31964007083	HMMPfam hit to PF00698, Acyl transferase region,score 1.3e-09
31964007084	PucR C-terminal helix-turn-helix domain; Region: HTH_30; pfam13556
31964007085	Predicted helix-turn-helix motif with score 1692.000, SD 4.95 at aa 351-372, sequence RSLEATARELFVHPNTVRYRLK
31964007086	pyruvate dehydrogenase subunit E1; Reviewed; Region: aceE; PRK09405
31964007087	Thiamine pyrophosphate (TPP) family, E1 of E. coli PDC-like subfamily, TPP-binding module; composed of proteins similar to the E1 component of the Escherichia coli pyruvate dehydrogenase multienzyme complex (PDC). PDC catalyzes the oxidative...; Region: TPP_E1_EcPDC_like; cd02017
31964007088	dimer interface [polypeptide binding]; other site
31964007089	TPP-binding site [chemical binding]; other site
31964007090	Pyrimidine (PYR) binding domain of thiamine pyrophosphate (TPP)-dependent enzymes; Region: TPP_enzyme_PYR; cl11410
31964007091	Peroxiredoxin [Posttranslational modification, protein turnover, chaperones]; Region: AhpC; COG0450
31964007092	Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE. AhpE is described as a 1-cys PRX because of the absence of a resolving cysteine. The structure and sequence of AhpE, however, show greater...; Region: PRX_AhpE_like; cd03018
31964007093	dimer interface [polypeptide binding]; other site
31964007094	catalytic triad [active]
31964007095	5 probable transmembrane helices predicted for CMS1606 by TMHMM2.0 at aa 13-35, 39-58, 71-93, 108-127 and 205-227
31964007096	tetracycline repressor protein TetR; Provisional; Region: PRK13756
31964007097	Bacterial regulatory proteins, tetR family; Region: TetR_N; pfam00440
31964007098	Tetracyclin repressor, C-terminal all-alpha domain; Region: TetR_C; pfam02909
31964007099	HMMPfam hit to PF02909, Tetracyclin repressor,C-terminal, score 4.1e-14
31964007100	HMMPfam hit to PF00440, Bacterial regulatory protein, TetR, score 2.8e-13
31964007101	Predicted helix-turn-helix motif with score 1636.000, SD 4.76 at aa 62-83, sequence FTMRRLAAALDVQPSALYWHFP
31964007102	ECF-type riboflavin transporter, S component; Region: ECF-ribofla_trS; cl17272
31964007103	HMMPfam hit to PF02632, BioY protein, score 4e-30
31964007104	5 probable transmembrane helices predicted for CMS1608 by TMHMM2.0 at aa 15-37, 44-66, 70-92, 105-127 and 142-164
31964007105	ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism]; Region: CbiO; COG1122
31964007106	First domain of the ATP-binding cassette component of cobalt transport system; Region: ABC_cobalt_CbiO_domain1; cd03225
31964007107	Walker A/P-loop; other site
31964007108	ATP binding site [chemical binding]; other site
31964007109	Q-loop/lid; other site
31964007110	ABC transporter signature motif; other site
31964007111	Walker B; other site
31964007112	D-loop; other site
31964007113	H-loop/switch region; other site
31964007114	HMMPfam hit to PF00005, ABC transporter, score 3.5e-44
31964007115	PS00017 ATP/GTP-binding site motif A (P-loop).
31964007116	PS00211 ABC transporters family signature.
31964007117	ABC-type cobalt transport system, permease component CbiQ and related transporters [Inorganic ion transport and metabolism]; Region: CbiQ; COG0619
31964007118	4 probable transmembrane helices predicted for CMS1610 by TMHMM2.0 at aa 21-43, 73-95, 102-121 and 141-160
31964007119	Uncharacterized conserved protein [Function unknown]; Region: COG0327
31964007120	NIF3 (NGG1p interacting factor 3); Region: NIF3; pfam01784
31964007121	HMMPfam hit to PF01784, Protein of unknown function DUF34, score 6.4e-63
31964007122	Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]; Region: COG1579
31964007123	Putative zinc ribbon domain; Region: DUF164; pfam02591
31964007124	HMMPfam hit to PF02591, Protein of unknown function DUF164, score 0.00051
31964007125	Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism]; Region: NagC; COG1940
31964007126	HMMPfam hit to PF00480, ROK, score 1.2e-07
31964007127	Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway. Ketopantoate hydroxymethyltransferase (KPHMT) catalyzes the first committed step in the biosynthesis of pantothenate (vitamin B5), which is a...; Region: KPHMT-like; cd06557
31964007128	oligomerization interface [polypeptide binding]; other site
31964007129	active site
31964007130	metal binding site [ion binding]; metal-binding site
31964007131	HMMPfam hit to PF02548, Ketopantoate hydroxymethyltransferase, score 2e-128
31964007132	Glutamine synthetase [Amino acid transport and metabolism]; Region: GlnA; COG0174
31964007133	Glutamine synthetase, beta-Grasp domain; Region: Gln-synt_N; pfam03951
31964007134	Glutamine synthetase, catalytic domain; Region: Gln-synt_C; pfam00120
31964007135	HMMPfam hit to PF03951, Glutamine synthetase,beta-Grasp, score 3.2e-30
31964007136	HMMPfam hit to PF00120, Glutamine synthetase,catalytic region, score 4.5e-122
31964007137	PS00181 Glutamine synthetase  ATP-binding region signature.
31964007138	bifunctional glutamine-synthetase adenylyltransferase/deadenyltransferase; Provisional; Region: PRK14109
31964007139	Nucleotidyltransferase (NT) domain of Escherichia coli adenylyltransferase (GlnE), Escherichia coli uridylyl transferase (GlnD), and similar proteins; Region: NT_GlnE_GlnD_like; cd05401
31964007140	metal binding triad; other site
31964007141	GlnD PII-uridylyltransferase; Region: GlnD_UR_UTase; pfam08335
31964007142	Nucleotidyltransferase (NT) domain of Escherichia coli adenylyltransferase (GlnE), Escherichia coli uridylyl transferase (GlnD), and similar proteins; Region: NT_GlnE_GlnD_like; cd05401
31964007143	metal binding triad; other site
31964007144	HMMPfam hit to PF03710, Glutamate-ammonia ligase adenylyltransferase, score 2.6e-59
31964007145	HMMPfam hit to PF03710, Glutamate-ammonia ligase adenylyltransferase, score 2.5e-38
31964007146	glutamine synthetase, type I; Region: GlnA; TIGR00653
31964007147	Glutamine synthetase, beta-Grasp domain; Region: Gln-synt_N; pfam03951
31964007148	Glutamine synthetase, catalytic domain; Region: Gln-synt_C; pfam00120
31964007149	HMMPfam hit to PF00120, Glutamine synthetase,catalytic region, score 5.9e-162
31964007150	PS00181 Glutamine synthetase  ATP-binding region signature.
31964007151	HMMPfam hit to PF03951, Glutamine synthetase,beta-Grasp, score 1.6e-38
31964007152	PS00180 Glutamine synthetase signature 1.
31964007153	RDD family; Region: RDD; pfam06271
31964007154	HMMPfam hit to PF06271, RDD, score 3.8e-09
31964007155	2 probable transmembrane helices predicted for CMS1620 by TMHMM2.0 at aa 40-58 and 68-90
31964007156	1 probable transmembrane helix predicted for CMS1621 by TMHMM2.0 at aa 29-51
31964007157	Domain of unknown function (DUF4191); Region: DUF4191; pfam13829
31964007158	2 probable transmembrane helices predicted for CMS1622 by TMHMM2.0 at aa 16-38 and 42-64
31964007159	Protein Kinases, catalytic domain; Region: PKc_like; cl09925
31964007160	active site
31964007161	ATP binding site [chemical binding]; other site
31964007162	substrate binding site [chemical binding]; other site
31964007163	HMMPfam hit to PF00069, Protein kinase, score 0.0013
31964007164	1 probable transmembrane helix predicted for CMS1623 by Phobius
31964007165	Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases. 2-oxo acid dehydrogenase multienzyme complexes, like pyruvate dehydrogenase (PDH), 2-oxoglutarate dehydrogenase (OGDH) and branched-chain 2-oxo acid...; Region: lipoyl_domain; cd06849
31964007166	E3 interaction surface; other site
31964007167	lipoyl attachment site [posttranslational modification]; other site
31964007168	2-oxoacid dehydrogenases acyltransferase (catalytic domain); Region: 2-oxoacid_dh; pfam00198
31964007169	HMMPfam hit to PF00198, Catalytic domain of components of various dehydrogenase complexes, score 3.2e-109
31964007170	HMMPfam hit to PF02817, E3 binding, score 1.5e-16
31964007171	HMMPfam hit to PF00364, Biotin/lipoyl attachment,score 7.6e-33
31964007172	PS00189 2-oxo acid dehydrogenases acyltransferase component lipoyl binding site.
31964007173	dihydrolipoamide dehydrogenase; Reviewed; Region: PRK06416
31964007174	Pyridine nucleotide-disulphide oxidoreductase; Region: Pyr_redox; pfam00070
31964007175	Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain; Region: Pyr_redox_dim; pfam02852
31964007176	HMMPfam hit to PF02852, Pyridine nucleotide-disulphide oxidoreductase dimerisation region,score 6.2e-33
31964007177	HMMPfam hit to PF00070, FAD-dependent pyridine nucleotide-disulphide oxidoreductase, score 4.4e-93
31964007178	PS00076 Pyridine nucleotide-disulphide oxidoreductases class-I active site.
31964007179	multifunctional aminopeptidase A; Provisional; Region: PRK00913
31964007180	Cytosol aminopeptidase family, N-terminal and catalytic domains.  Family M17 contains zinc- and manganese-dependent exopeptidases ( EC  3.4.11.1), including leucine aminopeptidase. They catalyze removal of amino acids from the N-terminus of a protein and...; Region: Peptidase_M17; cd00433
31964007181	interface (dimer of trimers) [polypeptide binding]; other site
31964007182	Substrate-binding/catalytic site; other site
31964007183	Zn-binding sites [ion binding]; other site
31964007184	HMMPfam hit to PF00883, Peptidase M17, cytosol aminopeptidase, C-terminal, score 2.9e-128
31964007185	PS00631 Cytosol aminopeptidase signature.
31964007186	HMMPfam hit to PF02789, Peptidase M17, cytosol aminopeptidase, N-terminal, score 0.00014
31964007187	PAC2 family; Region: PAC2; pfam09754
31964007188	HMMPfam hit to PF01908, Protein of unknown function DUF75, score 3.8e-28
31964007189	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
31964007190	Major Facilitator Superfamily; Region: MFS_1; pfam07690
31964007191	putative substrate translocation pore; other site
31964007192	10 probable transmembrane helices predicted for CMS1628 by TMHMM2.0 at aa 7-29, 44-66, 79-101, 161-183,217-239, 249-271, 283-305, 309-331, 344-366 and 388-407
31964007193	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964007194	RNA polymerase sigma factor SigB; Reviewed; Region: PRK07921
31964007195	Sigma-70 region 2; Region: Sigma70_r2; pfam04542
31964007196	Sigma-70 region 3; Region: Sigma70_r3; pfam04539
31964007197	Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs). A SF is a dissociable subunit of RNA polymerase, it directs bacterial or...; Region: Sigma70_r4; cd06171
31964007198	DNA binding residues [nucleotide binding]
31964007199	HMMPfam hit to PF00140, Sigma-70 region 1.2, score 6.3e-16
31964007200	HMMPfam hit to PF04542, Sigma-70 region 2, score 5.8e-29
31964007201	PS00715 Sigma-70 factors family signature 1.
31964007202	HMMPfam hit to PF04539, Sigma-70 region 3, score 7.3e-41
31964007203	HMMPfam hit to PF04545, Sigma-70 region 4, score 6.8e-23
31964007204	Predicted helix-turn-helix motif with score 1613.000, SD 4.68 at aa 314-335, sequence KTLDQIGDTFGVTRERIRQIES
31964007205	PS00716 Sigma-70 factors family signature 2.
31964007206	Mur ligase middle domain; Region: Mur_ligase_M; pfam08245
31964007207	Domain of unknown function (DUF1727); Region: DUF1727; pfam08353
31964007208	Type 1 glutamine amidotransferase (GATase1)-like domain; Region: GAT_1; cl00020
31964007209	conserved cys residue [active]
31964007210	HMMPfam hit to PF07685, CobB/CobQ-like glutamine amidotransferase domain
31964007211	DNA topoisomerase IV subunit B; Reviewed; Region: PRK05559
31964007212	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
31964007213	ATP binding site [chemical binding]; other site
31964007214	Mg2+ binding site [ion binding]; other site
31964007215	G-X-G motif; other site
31964007216	TopoIIA_Trans_DNA_gyrase: Transducer domain, having a ribosomal S5 domain 2-like fold, of the type found in proteins of the type IIA family of DNA topoisomerases similar to the B subunits of E. coli DNA gyrase and E. coli Topoisomerase IV which are; Region: TopoII_Trans_DNA_gyrase; cd00822
31964007217	anchoring element; other site
31964007218	dimer interface [polypeptide binding]; other site
31964007219	ATP binding site [chemical binding]; other site
31964007220	Topoisomerase-primase domain. This is a nucleotidyl transferase/hydrolase domain found in type IA, type IIA and type IIB topoisomerases, bacterial DnaG-type primases, small primase-like proteins from bacteria and archaea, OLD family nucleases from...; Region: TOPRIM; cl00718
31964007221	active site
31964007222	metal binding site [ion binding]; metal-binding site
31964007223	DNA gyrase B subunit, carboxyl terminus; Region: DNA_gyraseB_C; pfam00986
31964007224	HMMPfam hit to PF02518, ATP-binding region,ATPase-like, score 4.3e-23
31964007225	HMMPfam hit to PF00204, DNA topoisomerase II, score 2e-25
31964007226	HMMPfam hit to PF01751, TOPRIM, score 0.001
31964007227	PS00177 DNA topoisomerase II signature.
31964007228	HMMPfam hit to PF00986, DNA gyrase, subunit B,C-terminal, score 7.8e-30
31964007229	DNA topoisomerase IV subunit A; Validated; Region: PRK05561
31964007230	DNA Topoisomerase, subtype IIA; domain A'; bacterial DNA topoisomerase IV (C subunit, ParC), bacterial DNA gyrases (A subunit, GyrA),mammalian DNA toposiomerases II. DNA topoisomerases are essential enzymes that regulate the conformational changes...; Region: TOP4c; cd00187
31964007231	CAP-like domain; other site
31964007232	active site
31964007233	primary dimer interface [polypeptide binding]; other site
31964007234	HMMPfam hit to PF03989, DNA gyrase C-terminal repeat, beta-propeller, score 0.0008
31964007235	HMMPfam hit to PF00521, DNA gyrase/topoisomerase IV, subunit A, score 7.1e-250
31964007236	Phosphopentomutase [Carbohydrate transport and metabolism]; Region: DeoB; cl17415
31964007237	Molybdopterin-Binding (MopB) domain of the MopB superfamily of proteins, a  large, diverse, heterogeneous superfamily of enzymes that, in general, bind molybdopterin as a cofactor. The MopB domain is found in a wide variety of molybdenum- and...; Region: Molybdopterin-Binding; cl09928
31964007238	HMMPfam hit to PF01663, Type I phosphodiesterase/nucleotide pyrophosphatase, score 1.2e-06
31964007239	Protein of unknown function (DUF3071); Region: DUF3071; pfam11268
31964007240	Predicted helix-turn-helix motif with score 1133.000, SD 3.05 at aa 70-91, sequence MSAEDVARETGASVEYVRKFEG
31964007241	Domain of unknown function (DUF4193); Region: DUF4193; pfam13834
31964007242	leucine-zipper of insertion element IS481; Region: LZ_Tnp_IS481; pfam13011
31964007243	Winged helix-turn helix; Region: HTH_29; pfam13551
31964007244	Integrase core domain; Region: rve; pfam00665
31964007245	Integrase core domain; Region: rve_3; pfam13683
31964007246	HMMPfam hit to PF00665, Integrase, catalytic region, score 2.5e-37
31964007247	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964007248	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964007249	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964007250	Protein of unknown function (DUF3093); Region: DUF3093; pfam11292
31964007251	1 probable transmembrane helix predicted for CMS1639 by TMHMM2.0 at aa 5-27
31964007252	Trimeric dUTP diphosphatases; Region: trimeric_dUTPase; cd07557
31964007253	trimer interface [polypeptide binding]; other site
31964007254	active site
31964007255	HMMPfam hit to PF00692, DeoxyUTP pyrophosphatase,score 6.6e-33
31964007256	Protein of unknown function (DUF3710); Region: DUF3710; pfam12502
31964007257	Protein of unknown function (DUF3159); Region: DUF3159; pfam11361
31964007258	6 probable transmembrane helices predicted for CMS1642 by TMHMM2.0 at aa 74-96, 100-117, 124-146,161-183, 203-222 and 232-254
31964007259	aconitate hydratase; Validated; Region: PRK09277
31964007260	Aconitase catalytic domain; Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle; Region: Aconitase; cl00285
31964007261	substrate binding site [chemical binding]; other site
31964007262	ligand binding site [chemical binding]; other site
31964007263	Aconitase A swivel domain. This is the major form of the TCA cycle enzyme aconitate hydratase, also known as aconitase and citrate hydro-lyase. It includes bacterial and archaeal aconitase A, and the eukaryotic cytosolic form of aconitase. This group...; Region: AcnA_IRP_Swivel; cd01580
31964007264	substrate binding site [chemical binding]; other site
31964007265	HMMPfam hit to PF00330, Aconitate hydratase,N-terminal, score 6.5e-226
31964007266	PS00450 Aconitase family signature 1.
31964007267	HMMPfam hit to PF00694, Aconitate hydratase,C-terminal, score 3.2e-53
31964007268	1-deoxy-D-xylulose-5-phosphate synthase; Provisional; Region: PRK05444
31964007269	Thiamine pyrophosphate (TPP) family, DXS subfamily, TPP-binding module; 1-Deoxy-D-xylulose-5-phosphate synthase (DXS) is a regulatory enzyme of the mevalonate-independent pathway involved in terpenoid biosynthesis. Terpeniods are plant natural products...; Region: TPP_DXS; cd02007
31964007270	TPP-binding site; other site
31964007271	Pyrimidine (PYR) binding domain of 1-deoxy-D-xylulose-5-phosphate synthase (DXS), transketolase (TK), and related proteins; Region: TPP_PYR_DXS_TK_like; cd07033
31964007272	PYR/PP interface [polypeptide binding]; other site
31964007273	dimer interface [polypeptide binding]; other site
31964007274	TPP binding site [chemical binding]; other site
31964007275	Transketolase, C-terminal domain; Region: Transketolase_C; pfam02780
31964007276	HMMPfam hit to PF02779, Transketolase, central region, score 5.7e-53
31964007277	HMMPfam hit to PF02780, Transketolase, C terminal,score 1.1e-25
31964007278	Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism]; Region: CaiD; COG1024
31964007279	Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily. This superfamily contains a diverse set of enzymes including enoyl-CoA hydratase, napthoate synthase, methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA dehydratase, and dienoyl-CoA isomerase; Region: crotonase-like; cd06558
31964007280	substrate binding site [chemical binding]; other site
31964007281	oxyanion hole (OAH) forming residues; other site
31964007282	trimer interface [polypeptide binding]; other site
31964007283	3-hydroxybutyryl-CoA dehydrogenase; Region: PLN02545
31964007284	3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; Region: 3HCDH_N; pfam02737
31964007285	3-hydroxyacyl-CoA dehydrogenase, C-terminal domain; Region: 3HCDH; pfam00725
31964007286	HMMPfam hit to PF00725, 3-hydroxyacyl-CoA dehydrogenase, C-terminal, score 1.1e-11
31964007287	HMMPfam hit to PF02737, 3-hydroxyacyl-CoA dehydrogenase, NAD-binding, score 1.7e-61
31964007288	HMMPfam hit to PF00378, Enoyl-CoA hydratase/isomerase, score 1.2e-11
31964007289	Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine. They are found in prokaryotes and...; Region: thiolase; cd00751
31964007290	acetyl-CoA acetyltransferases; Region: AcCoA-C-Actrans; TIGR01930
31964007291	dimer interface [polypeptide binding]; other site
31964007292	active site
31964007293	HMMPfam hit to PF02803, Thiolase, score 3e-43
31964007294	PS00099 Thiolases active site.
31964007295	PS00737 Thiolases signature 2.
31964007296	HMMPfam hit to PF00108, Thiolase, score 1.3e-32
31964007297	Ribonuclease D [Translation, ribosomal structure and biogenesis]; Region: Rnd; COG0349
31964007298	DEDDy 3'-5' exonuclease domain of Ribonuclease D and similar proteins; Region: RNaseD_exo; cd06142
31964007299	catalytic site [active]
31964007300	putative active site [active]
31964007301	putative substrate binding site [chemical binding]; other site
31964007302	HRDC domain; Region: HRDC; pfam00570
31964007303	HMMPfam hit to PF00570, HRDC, score 4.5e-07
31964007304	HMMPfam hit to PF01612, 3'-5' exonuclease, score 7.4e-46
31964007305	Protein of unknown function (DUF3000); Region: DUF3000; pfam11452
31964007306	RibD C-terminal domain; Region: RibD_C; cl17279
31964007307	HMMPfam hit to PF01872, Bacterial bifunctional deaminase-reductase, C-terminal, score 1.8e-08
31964007308	Fe-S metabolism associated domain; Region: SufE; cl00951
31964007309	HMMPfam hit to PF02657, Fe-S metabolism associated SufE, score 2.9e-24
31964007310	Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism]; Region: SseA; COG2897
31964007311	Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain. TST contains 2 copies of the Rhodanese Homology Domain; this is the 1st repeat, which does not contain the catalytically active Cys residue. The role of the 1st repeat is uncertain, but it...; Region: TST_Repeat_1; cd01448
31964007312	active site residue [active]
31964007313	Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain. TST contains 2 copies of the Rhodanese Homology Domain; this is the second repeat. Only the second repeat contains the catalytically active Cys residue; Region: TST_Repeat_2; cd01449
31964007314	active site residue [active]
31964007315	HMMPfam hit to PF00581, Rhodanese-like, score 1.2e-21
31964007316	PS00683 Rhodanese C-terminal signature.
31964007317	HMMPfam hit to PF00581, Rhodanese-like, score 4.3e-26
31964007318	PS00380 Rhodanese signature 1.
31964007319	AFG1-like ATPase; Region: AFG1_ATPase; pfam03969
31964007320	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cl17189
31964007321	HMMPfam hit to PF03969, AFG1-like ATPase, score 1.5e-60
31964007322	PS00017 ATP/GTP-binding site motif A (P-loop).
31964007323	Ammonia permease [Inorganic ion transport and metabolism]; Region: AmtB; COG0004
31964007324	11 probable transmembrane helices predicted for CMS1653 by TMHMM2.0 at aa 6-28, 41-63, 109-131, 138-160,184-206, 219-238, 248-270, 282-301, 305-324, 336-358 and 373-395
31964007325	HMMPfam hit to PF00909, Rh-like protein/ammonium transporter, score 4.6e-147
31964007326	PS01219 Ammonium transporters signature.
31964007327	Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols. AKRs are present in all phyla and are of importance to both health and industrial...; Region: Aldo_ket_red; cd06660
31964007328	Aldo/keto reductase family; Region: Aldo_ket_red; pfam00248
31964007329	active site
31964007330	catalytic tetrad [active]
31964007331	HMMPfam hit to PF00248, Aldo/keto reductase, score 1e-87
31964007332	PS00798 Aldo/keto reductase family signature 1.
31964007333	PS00062 Aldo/keto reductase family signature 2.
31964007334	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cl17173
31964007335	N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional; Region: PRK09328
31964007336	leucine-zipper of insertion element IS481; Region: LZ_Tnp_IS481; pfam13011
31964007337	Winged helix-turn helix; Region: HTH_29; pfam13551
31964007338	Integrase core domain; Region: rve; pfam00665
31964007339	Integrase core domain; Region: rve_3; pfam13683
31964007340	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964007341	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964007342	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964007343	HMMPfam hit to PF00665, Integrase, catalytic region, score 3.5E-36
31964007344	HIT family: HIT (Histidine triad) proteins, named for a motif related to the sequence HxHxH/Qxx (x, a hydrophobic amino acid), are a superfamily of nucleotide hydrolases and transferases, which act on the alpha-phosphate of ribonucleotides. On the basis...; Region: HIT_like; cl00228
31964007345	Substrate binding domain of ABC-type glycine betaine transport system; Region: OpuAC; pfam04069
31964007346	HMMPfam hit to PF04069, Substrate-binding region of ABC-type glycine betaine transport system, score 1.8e-40
31964007347	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964007348	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cl00427
31964007349	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 1.6e-24
31964007350	6 probable transmembrane helices predicted for CMS1661 by TMHMM2.0 at aa 34-56, 69-91, 95-117, 138-156,160-182 and 189-211
31964007351	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964007352	PS00017 ATP/GTP-binding site motif A (P-loop).
31964007353	ATP-binding cassette domain of the osmoprotectant transporter; Region: ABC_OpuCA_Osmoprotection; cd03295
31964007354	Walker A/P-loop; other site
31964007355	ATP binding site [chemical binding]; other site
31964007356	ABC transporter; Region: ABC_tran; pfam00005
31964007357	Q-loop/lid; other site
31964007358	ABC transporter signature motif; other site
31964007359	Walker B; other site
31964007360	D-loop; other site
31964007361	H-loop/switch region; other site
31964007362	The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called...; Region: CBS_pair; cd02205
31964007363	HMMPfam hit to PF00571, CBS, score 0.00082
31964007364	HMMPfam hit to PF00571, CBS, score 0.38
31964007365	HMMPfam hit to PF00005, ABC transporter, score 3.5e-60
31964007366	PS00211 ABC transporters family signature.
31964007367	PS00017 ATP/GTP-binding site motif A (P-loop).
31964007368	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964007369	dimer interface [polypeptide binding]; other site
31964007370	conserved gate region; other site
31964007371	putative PBP binding loops; other site
31964007372	ABC-ATPase subunit interface; other site
31964007373	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 1.7e-14
31964007374	5 probable transmembrane helices predicted for CMS1663 by TMHMM2.0 at aa 20-42, 49-71, 76-98, 148-170 and 180-202
31964007375	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964007376	DnaJ domain or J-domain.  DnaJ/Hsp40 (heat shock protein 40) proteins are highly conserved and play crucial roles in protein translation, folding, unfolding, translocation, and degradation. They act primarily by stimulating the ATPase activity of Hsp70s; Region: DnaJ; cd06257
31964007377	HSP70 interaction site [polypeptide binding]; other site
31964007378	1 probable transmembrane helix predicted for CMS1664 by TMHMM2.0 at aa 139-161
31964007379	Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]; Region: WcaG; COG0451
31964007380	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
31964007381	NAD(P) binding site [chemical binding]; other site
31964007382	active site
31964007383	Mg2+ and Co2+ transporters [Inorganic ion transport and metabolism]; Region: CorA; COG0598
31964007384	Mycobacterium tuberculosis CorA-like subfamily; Region: MtCorA-like; cd12830
31964007385	oligomer interface [polypeptide binding]; other site
31964007386	metal binding site [ion binding]; metal-binding site
31964007387	metal binding site [ion binding]; metal-binding site
31964007388	putative Cl binding site [ion binding]; other site
31964007389	basic sphincter; other site
31964007390	hydrophobic gate; other site
31964007391	periplasmic entrance; other site
31964007392	HMMPfam hit to PF01544, Mg2+ transporter protein,CorA-like, score 4.1e-48
31964007393	2 probable transmembrane helices predicted for CMS1666 by TMHMM2.0 at aa 332-351 and 361-383
31964007394	hypothetical protein; Provisional; Region: PRK07906
31964007395	M20 Peptidase, carboxypeptidase yscS-like; Region: M20_yscS_like; cd05675
31964007396	putative metal binding site [ion binding]; other site
31964007397	HMMPfam hit to PF01546, Peptidase M20, score 1.9e-23
31964007398	HMMPfam hit to PF07687, Peptidase dimerisation domain, score 2.9e-15
31964007399	undecaprenyl pyrophosphate phosphatase; Reviewed; Region: PRK12554
31964007400	HMMPfam hit to PF02673, Bacitracin resistance protein BacA, score 6.7e-72
31964007401	6 probable transmembrane helices predicted for CMS1668 by TMHMM2.0 at aa 53-72, 79-98, 113-132, 151-173,188-210 and 217-238
31964007402	nucleotidyl transferase superfamily; Region: nt_trans; cl00015
31964007403	cysteinyl-tRNA synthetase; Provisional; Region: PRK12418
31964007404	active site
31964007405	HIGH motif; other site
31964007406	nucleotide binding site [chemical binding]; other site
31964007407	nucleotidyl transferase superfamily; Region: nt_trans; cl00015
31964007408	active site
31964007409	KMSKS motif; other site
31964007410	HMMPfam hit to PF01406, Cysteinyl-tRNA synthetase,class Ia, score 2.2e-81
31964007411	PAC2 family; Region: PAC2; pfam09754
31964007412	HMMPfam hit to PF01908, Protein of unknown function DUF75, score 1.2e-45
31964007413	beta-phosphoglucomutase family hydrolase; Region: PGMB-YQAB-SF; TIGR02009
31964007414	haloacid dehalogenase-like hydrolase; Region: HAD; cl17202
31964007415	Haloacid dehalogenase-like hydrolases. The haloacid dehalogenase-like (HAD) superfamily includes L-2-haloacid dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, and many others; Region: HAD_like; cd01427
31964007416	motif II; other site
31964007417	HMMPfam hit to PF00702, Haloacid dehalogenase-like hydrolase, score 5.2e-23
31964007418	tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis]; Region: GCD14; COG2519
31964007419	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
31964007420	S-adenosylmethionine binding site [chemical binding]; other site
31964007421	FKBP-type peptidyl-prolyl cis-trans isomerase; Region: FKBP_C; pfam00254
31964007422	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964007423	PS00017 ATP/GTP-binding site motif A (P-loop).
31964007424	HMMPfam hit to PF00254, Peptidylprolyl isomerase,FKBP-type, score 3.7e-14
31964007425	Predicted transcriptional regulator [Transcription]; Region: COG2378
31964007426	WYL domain; Region: WYL; pfam13280
31964007427	Predicted transcriptional regulator [Transcription]; Region: COG2378
31964007428	FeoC like transcriptional regulator; Region: FeoC; cl17677
31964007429	WYL domain; Region: WYL; pfam13280
31964007430	Predicted helix-turn-helix motif with score 1191.000, SD 3.24 at aa 30-51, sequence VSVSQAAAHFRVPPEQIRQAVR
31964007431	mttA/Hcf106 family; Region: MttA_Hcf106; pfam02416
31964007432	HMMPfam hit to PF02416, Bacterial sec-independent translocation protein mttA/Hcf106, score 1.7e-17
31964007433	1 probable transmembrane helix predicted for CMS1676 by TMHMM2.0 at aa 10-32
31964007434	Sec-independent protein translocase protein (TatC); Region: TatC; pfam00902
31964007435	HMMPfam hit to PF00902, Sec-independent periplasmic protein translocase, score 1.5e-49
31964007436	6 probable transmembrane helices predicted for CMS1677 by TMHMM2.0 at aa 31-53, 88-110, 122-144, 174-196,203-222 and 227-249
31964007437	DEAD-like helicases superfamily; Region: DEXDc; smart00487
31964007438	DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region; Region: DEXDc; cd00046
31964007439	ATP binding site [chemical binding]; other site
31964007440	putative Mg++ binding site [ion binding]; other site
31964007441	Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may...; Region: HELICc; cd00079
31964007442	nucleotide binding region [chemical binding]; other site
31964007443	ATP-binding site [chemical binding]; other site
31964007444	DSHCT (NUC185) domain; Region: DSHCT; pfam08148
31964007445	HMMPfam hit to PF04851, Type III restriction enzyme, res subunit, score 1.1e-06
31964007446	HMMPfam hit to PF00270, DEAD/DEAH box helicase,N-terminal, score 1.3e-30
31964007447	PS00017 ATP/GTP-binding site motif A (P-loop).
31964007448	HMMPfam hit to PF00271, Helicase, C-terminal, score 2.4e-10
31964007449	Apolipoprotein N-acyl transferase (class 9 nitrilases); Region: ALP_N-acyl_transferase; cd07571
31964007450	putative active site [active]
31964007451	catalytic triad [active]
31964007452	putative dimer interface [polypeptide binding]; other site
31964007453	7 probable transmembrane helices predicted for CMS1679 by TMHMM2.0 at aa 53-70, 75-94, 104-126, 138-155,184-206, 219-241 and 505-522
31964007454	HMMPfam hit to PF00795, Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase, score 9.9e-07
31964007455	Domain of unknown function (DUF4109); Region: DUF4109; pfam13397
31964007456	Glycerophosphoryl diester phosphodiesterase [Energy production and conversion]; Region: UgpQ; COG0584
31964007457	Glycerophosphodiester phosphodiesterase domain of Streptomyces coelicolor cytoplasmic phosphodiesterases UgpQ2 and similar proteins; Region: GDPD_cytoplasmic_ScUgpQ2_like; cd08561
31964007458	putative active site [active]
31964007459	catalytic site [active]
31964007460	putative metal binding site [ion binding]; other site
31964007461	HMMPfam hit to PF03009, Glycerophosphoryl diester phosphodiesterase, score 1.7e-28
31964007462	2 probable transmembrane helices predicted for CMS1682 by TMHMM2.0 at aa 10-25 and 32-54
31964007463	short chain dehydrogenase; Provisional; Region: PRK07806
31964007464	Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only]; Region: FabG; COG1028
31964007465	NAD(P) binding site [chemical binding]; other site
31964007466	active site
31964007467	HMMPfam hit to PF00106, Short-chain dehydrogenase/reductase SDR, score 7e-18
31964007468	Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism]; Region: DAP2; COG1506
31964007469	Prolyl oligopeptidase family; Region: Peptidase_S9; pfam00326
31964007470	HMMPfam hit to PF07676, WD40-like Beta Propeller Repeat
31964007471	HMMPfam hit to PF07676, WD40-like Beta Propeller Repeat
31964007472	HMMPfam hit to PF07676, WD40-like Beta Propeller Repeat
31964007473	HMMPfam hit to PF00326, Peptidase S9, prolyl oligopeptidase active site region, score 1.3e-55
31964007474	Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+...; Region: Nudix_Hydrolase; cl00447
31964007475	nudix motif; other site
31964007476	HMMPfam hit to PF00293, NUDIX hydrolase, score 2e-18
31964007477	PS00893 mutT domain signature.
31964007478	Similarity to part of the Cmm pathogenicity island
31964007479	Alpha/beta hydrolase family; Region: Abhydrolase_5; pfam12695
31964007480	Prolyl oligopeptidase family; Region: Peptidase_S9; pfam00326
31964007481	Transcriptional regulators [Transcription]; Region: PurR; COG1609
31964007482	Helix-turn-helix (HTH) DNA binding domain of the LacI family of transcriptional regulators; Region: HTH_LacI; cd01392
31964007483	DNA binding site [nucleotide binding]
31964007484	domain linker motif; other site
31964007485	Ligand-binding domain of DNA transcription repressor LacI specific for lactose, a member of the LacI-GalR family of bacterial transcription regulators; Region: PBP1_LacI; cd01574
31964007486	ligand binding site [chemical binding]; other site
31964007487	dimerization interface (open form) [polypeptide binding]; other site
31964007488	dimerization interface (closed form) [polypeptide binding]; other site
31964007489	HMMPfam hit to PF00356, Bacterial regulatory protein, LacI, score 1.3e-06
31964007490	Predicted helix-turn-helix motif with score 1621.000, SD 4.71 at aa 13-34, sequence PGMVDVAQIAGVSHVTVSRVLN
31964007491	PS00356 Bacterial regulatory proteins, lacI family signature.
31964007492	HMMPfam hit to PF00532, Periplasmic binding protein/LacI transcriptional regulator, score 3.3e-09
31964007493	Beta-xylosidase [Carbohydrate transport and metabolism]; Region: XynB; COG3507
31964007494	Glycosyl hydrolase family 43, beta-D-xylosidase; Region: GH43_XYL_1; cd09000
31964007495	inhibitor binding site; inhibition site
31964007496	active site
31964007497	HMMPfam hit to PF04616, Glycoside hydrolase, family 43, score 4.8e-50
31964007498	ABC-type sugar transport system, periplasmic component [Carbohydrate transport and metabolism]; Region: UgpB; COG1653
31964007499	Bacterial extracellular solute-binding protein; Region: SBP_bac_1; pfam01547
31964007500	HMMPfam hit to PF01547, Bacterial extracellular solute-binding protein, family 1, score 8.9e-31
31964007501	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964007502	6 probable transmembrane helices predicted for CMS1693 by TMHMM2.0 at aa 7-29, 66-88, 101-123, 143-165,200-222 and 255-277
31964007503	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 0.0012
31964007504	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964007505	5 probable transmembrane helices predicted for CMS1694 by TMHMM2.0 at aa 32-54, 94-116, 129-151, 161-183 and 204-226
31964007506	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 5e-05
31964007507	HMMPfam hit to PF01055, Glycoside hydrolase, family 31, score 1e-05
31964007508	HMMPfam hit to PF01055, Glycoside hydrolase, family 31, score 1.3e-16
31964007509	submitted with no further information
31964007510	1 probable transmembrane helix predicted for CMS1696 by TMHMM2.0 at aa 19-41
31964007511	HMMPfam hit to PF00232, Glycoside hydrolase, family 1, score 6.2e-32
31964007512	Glycosyl hydrolase family 3 N terminal domain; Region: Glyco_hydro_3; pfam00933
31964007513	Beta-glucosidase-related glycosidases [Carbohydrate transport and metabolism]; Region: BglX; COG1472
31964007514	Glycosyl hydrolase family 3 C-terminal domain; Region: Glyco_hydro_3_C; pfam01915
31964007515	Fibronectin type III-like domain; Region: Fn3-like; pfam14310
31964007516	HMMPfam hit to PF01915, Glycoside hydrolase, family 3, C-terminal, score 1.4e-80
31964007517	HMMPfam hit to PF00933, Glycoside hydrolase, family 3, N-terminal, score 4.8e-106
31964007518	Major Facilitator Superfamily; Region: MFS_1; pfam07690
31964007519	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cl17904
31964007520	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
31964007521	HMMPfam hit to PF00083, General substrate transporter, score 2.2e-05
31964007522	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964007523	12 probable transmembrane helices predicted for CMS1702 by TMHMM2.0 at aa 51-73, 88-110, 123-142, 147-169,181-203, 207-229, 263-285, 300-322, 329-346, 356-378,391-413 and 423-445
31964007524	Beta-glucosidase-related glycosidases [Carbohydrate transport and metabolism]; Region: BglX; COG1472
31964007525	Glycosyl hydrolase family 3 N terminal domain; Region: Glyco_hydro_3; pfam00933
31964007526	Glycosyl hydrolase family 3 C-terminal domain; Region: Glyco_hydro_3_C; pfam01915
31964007527	Fibronectin type III-like domain; Region: Fn3-like; pfam14310
31964007528	submitted with no further information
31964007529	HMMPfam hit to PF00933, Glycoside hydrolase, family 3, N-terminal, score 7.1e-69
31964007530	HMMPfam hit to PF01915, Glycoside hydrolase, family 3, C-terminal, score 5.1e-61
31964007531	Transcriptional regulators [Transcription]; Region: PurR; COG1609
31964007532	Helix-turn-helix (HTH) DNA binding domain of the LacI family of transcriptional regulators; Region: HTH_LacI; cd01392
31964007533	DNA binding site [nucleotide binding]
31964007534	domain linker motif; other site
31964007535	Ligand binding domain of the LacI tanscriptional regulator family belonging to the type I periplasmic-binding fold protein superfamily; Region: PBP1_LacI_sugar_binding_like; cd06267
31964007536	ligand binding site [chemical binding]; other site
31964007537	dimerization interface [polypeptide binding]; other site
31964007538	Predicted helix-turn-helix motif with score 2025.000, SD 6.08 at aa 2-23, sequence ATSADVAQHAGLSRSTVSQILN
31964007539	Glycosyl hydrolases family 2, sugar binding domain; Region: Glyco_hydro_2_N; pfam02837
31964007540	Glycosyl hydrolases family 2; Region: Glyco_hydro_2; pfam00703
31964007541	Glycosyl hydrolases family 2, TIM barrel domain; Region: Glyco_hydro_2_C; pfam02836
31964007542	HMMPfam hit to PF02837, Glycoside hydrolase, family 2, sugar binding, score 1.1e-21
31964007543	HMMPfam hit to PF00703, Glycoside hydrolase family 2, immunoglobulin-like beta-sandwich domain, score 0.0014
31964007544	HMMPfam hit to PF02836, Glycoside hydrolase, family 2, TIM barrel domain, score 6.5e-09
31964007545	HMMPfam hit to PF00106, Short-chain dehydrogenase/reductase SDR, score 3.7e-47
31964007546	PS00061 Short-chain dehydrogenases/reductases family signature.
31964007547	Membrane transporters of cations and cationic drugs [Inorganic ion transport and metabolism]; Region: EmrE; COG2076
31964007548	4 probable transmembrane helices predicted for CMS1707 by TMHMM2.0 at aa 5-24, 29-51, 55-77 and 82-104
31964007549	HMMPfam hit to PF00893, Small multidrug resistance protein, score 6.3e-22
31964007550	3 probable transmembrane helices predicted for CMS1708 by TMHMM2.0 at aa 27-49, 56-78 and 82-104
31964007551	HMMPfam hit to PF00893, Small multidrug resistance protein, score 1.5e-08
31964007552	Bacterial regulatory proteins, tetR family; Region: TetR_N; pfam00440
31964007553	transcriptional repressor BetI; Region: betaine_BetI; TIGR03384
31964007554	HMMPfam hit to PF00440, Bacterial regulatory protein, TetR, score 3.4e-07
31964007555	Predicted helix-turn-helix motif with score 1263.000, SD 3.49 at aa 21-42, sequence LTIDSVAREAGLTKPGVIHHFA
31964007556	submitted with no further information
31964007557	CoA-disulfide reductase; Region: CoA_CoA_reduc; TIGR03385
31964007558	Pyridine nucleotide-disulphide oxidoreductase; Region: Pyr_redox; pfam00070
31964007559	Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain; Region: Pyr_redox_dim; pfam02852
31964007560	Member of the Rhodanese Homology Domain superfamily. Included in this CD are the Lactococcus lactis NADH oxidase, Bacillus cereus NADH dehydrogenase, and Bacteroides thetaiotaomicron pyridine nucleotide-disulphide oxidoreductase, and similar...; Region: RHOD_Pyr_redox; cd01524
31964007561	active site residue [active]
31964007562	HMMPfam hit to PF00070, FAD-dependent pyridine nucleotide-disulphide oxidoreductase, score 6.7e-57
31964007563	HMMPfam hit to PF02852, Pyridine nucleotide-disulphide oxidoreductase dimerisation region,score 7.2e-14
31964007564	HMMPfam hit to PF00581, Rhodanese-like, score 2.4e-07
31964007565	Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein. The cysteine containing enzymatically active version of the domain is also found in the Cdc25 class of protein phosphatases and a variety of proteins...; Region: RHOD; cd00158
31964007566	active site residue [active]
31964007567	HMMPfam hit to PF00581, Rhodanese-like, score 1.6e-11
31964007568	Transcriptional regulators CsoR (copper-sensitive operon repressor), RcnR, and FrmR, and related domains; this domain superfamily was previously known as DUF156; Region: CsoR-like_DUF156; cd10148
31964007569	putative homodimer interface [polypeptide binding]; other site
31964007570	putative homotetramer interface [polypeptide binding]; other site
31964007571	putative allosteric switch controlling residues; other site
31964007572	putative metal binding site [ion binding]; other site
31964007573	putative homodimer-homodimer interface [polypeptide binding]; other site
31964007574	HMMPfam hit to PF02583, Protein of unknown function DUF156, score 3.2e-12
31964007575	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
31964007576	NADH(P)-binding; Region: NAD_binding_10; pfam13460
31964007577	NAD(P) binding site [chemical binding]; other site
31964007578	active site
31964007579	leucine-zipper of insertion element IS481; Region: LZ_Tnp_IS481; pfam13011
31964007580	Winged helix-turn helix; Region: HTH_29; pfam13551
31964007581	Integrase core domain; Region: rve; pfam00665
31964007582	Integrase core domain; Region: rve_3; pfam13683
31964007583	HMMPfam hit to PF00665, Integrase, catalytic region, score 3.5E-36
31964007584	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964007585	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964007586	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964007587	glycyl-tRNA synthetase; Provisional; Region: PRK04173
31964007588	Class II tRNA amino-acyl synthetase-like catalytic core domain. Class II amino acyl-tRNA synthetases (aaRS) share a common fold and generally attach an amino acid to the 3' OH of ribose of the appropriate tRNA.   PheRS is an exception in that it...; Region: class_II_aaRS-like_core; cl00268
31964007589	motif 1; other site
31964007590	Glycyl-tRNA synthetase (GlyRS)-like class II core catalytic domain. GlyRS functions as a homodimer in eukaryotes, archaea and some bacteria and as a heterotetramer in the remainder of prokaryotes. It is responsible for the attachment of glycine to the 3...; Region: GlyRS-like_core; cd00774
31964007591	active site
31964007592	motif 2; other site
31964007593	motif 3; other site
31964007594	GlyRS Glycyl-anticodon binding domain. GlyRS belongs to class II aminoacyl-tRNA synthetases (aaRS). This alignment contains the anticodon binding domain, which is responsible for specificity in tRNA-binding, so that the activated amino acid is...; Region: GlyRS_anticodon; cd00858
31964007595	anticodon binding site; other site
31964007596	HMMPfam hit to PF03129, Anticodon-binding, score 3.1e-28
31964007597	HMMPfam hit to PF00587, tRNA synthetases, class-II (G, H, P and S), score 3.3e-52
31964007598	PS00179 Aminoacyl-transfer RNA synthetases class-II signature 1.
31964007599	PS00017 ATP/GTP-binding site motif A (P-loop).
31964007600	putative oxidoreductase; Provisional; Region: PRK11579
31964007601	Oxidoreductase family, NAD-binding Rossmann fold; Region: GFO_IDH_MocA; pfam01408
31964007602	Oxidoreductase family, C-terminal alpha/beta domain; Region: GFO_IDH_MocA_C; pfam02894
31964007603	HMMPfam hit to PF02894, Oxidoreductase, C-terminal,score 1.3e-12
31964007604	HMMPfam hit to PF01408, Oxidoreductase, N-terminal,score 9.8e-17
31964007605	Cis (Z)-Isoprenyl Diphosphate Synthases (cis-IPPS); homodimers which catalyze the successive 1'-4 condensation of the isopentenyl diphosphate (IPP) molecule to trans,trans-farnesyl diphosphate (FPP) or to cis,trans-FPP to form long-chain polyprenyl...; Region: CIS_IPPS; cd00475
31964007606	Putative undecaprenyl diphosphate synthase; Region: Prenyltransf; pfam01255
31964007607	catalytic residue [active]
31964007608	putative FPP diphosphate  binding site; other site
31964007609	putative FPP binding hydrophobic cleft; other site
31964007610	dimer interface [polypeptide binding]; other site
31964007611	putative IPP diphosphate binding site; other site
31964007612	HMMPfam hit to PF01255,Di-trans-poly-cis-decaprenylcistransferase, score 7.5e-117
31964007613	DNA repair protein RecO; Reviewed; Region: recO; PRK00085
31964007614	Recombination protein O N terminal; Region: RecO_N; pfam11967
31964007615	Recombination protein O C terminal; Region: RecO_C; pfam02565
31964007616	HMMPfam hit to PF02565, Recombination protein O,RecO, score 8.1e-42
31964007617	Predicted membrane protein [Function unknown]; Region: COG2860
31964007618	UPF0126 domain; Region: UPF0126; pfam03458
31964007619	HMMPfam hit to PF03458, Protein of unknown function UPF0126, score 8.3e-08
31964007620	7 probable transmembrane helices predicted for CMS1726 by TMHMM2.0 at aa 10-31, 38-60, 64-86, 95-114,118-140, 153-175 and 179-198
31964007621	HMMPfam hit to PF03458, Protein of unknown function UPF0126, score 4.1e-09
31964007622	2-isopropylmalate synthase; Validated; Region: PRK03739
31964007623	Mycobacterium tuberculosis LeuA3 and related proteins, N-terminal catalytic TIM barrel domain; Region: DRE_TIM_LeuA; cd07942
31964007624	active site
31964007625	catalytic residues [active]
31964007626	metal binding site [ion binding]; metal-binding site
31964007627	LeuA allosteric (dimerisation) domain; Region: LeuA_dimer; smart00917
31964007628	HMMPfam hit to PF00682, HMG-CoA lyase-like, score 6.9e-90
31964007629	PS00816 Alpha-isopropylmalate and homocitrate synthases signature 2.
31964007630	PS00815 Alpha-isopropylmalate and homocitrate synthases signature 1.
31964007631	Uncharacterized conserved protein [Function unknown]; Region: COG2898
31964007632	Uncharacterized conserved protein (DUF2156); Region: DUF2156; pfam09924
31964007633	HMMPfam hit to PF04331, Protein of unknown function DUF472, score 2.9e-07
31964007634	HMMPfam hit to PF04330, Protein of unknown function DUF471, score 1.5e-10
31964007635	HMMPfam hit to PF04329, Protein of unknown function DUF470, score 1.1e-08
31964007636	12 probable transmembrane helices predicted for CMS1728 by TMHMM2.0 at aa 21-43, 76-98, 105-127, 142-164,171-188, 192-214, 227-246, 295-317, 322-344, 364-386,402-424 and 467-489
31964007637	HMMPfam hit to PF01694, Rhomboid-like protein,score 0.00017
31964007638	Predicted esterase [General function prediction only]; Region: COG0627
31964007639	HMMPfam hit to PF00756,  esterase, score 0.00032
31964007640	4 probable transmembrane helices predicted for CMS1729 by TMHMM2.0 at aa 10-32, 52-74, 89-107 and 128-150
31964007641	Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription]; Region: CitB; COG2197
31964007642	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
31964007643	active site
31964007644	phosphorylation site [posttranslational modification]
31964007645	intermolecular recognition site; other site
31964007646	dimerization interface [polypeptide binding]; other site
31964007647	C-terminal DNA-binding domain of LuxR-like proteins. This domain contains a helix-turn-helix motif and binds DNA. Proteins belonging to this group are response regulators; some act as transcriptional activators, others as transcriptional repressors. Many...; Region: LuxR_C_like; cd06170
31964007648	DNA binding residues [nucleotide binding]
31964007649	dimerization interface [polypeptide binding]; other site
31964007650	HMMPfam hit to PF00196, Bacterial regulatory protein, LuxR, score 1.4e-22
31964007651	Predicted helix-turn-helix motif with score 1165.000, SD 3.15 at aa 177-198, sequence LSNAEIAQAEFLSEATVKTHVS
31964007652	HMMPfam hit to PF00072, Response regulator receiver, score 1.4e-31
31964007653	Histidine kinase; Region: HisKA_3; pfam07730
31964007654	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; Region: HATPase_c; pfam02518
31964007655	HMMPfam hit to PF02518, ATP-binding region,ATPase-like, score 6.4e-07
31964007656	HMMPfam hit to PF07730, Histidine kinase
31964007657	5 probable transmembrane helices predicted for CMS1731 by TMHMM2.0 at aa 12-34, 39-61, 68-87, 107-129 and 150-172
31964007658	GTPase Era; Reviewed; Region: era; PRK00089
31964007659	E. coli Ras-like protein (Era) is a multifunctional GTPase; Region: Era; cd04163
31964007660	G1 box; other site
31964007661	GTP/Mg2+ binding site [chemical binding]; other site
31964007662	Switch I region; other site
31964007663	G2 box; other site
31964007664	Switch II region; other site
31964007665	G3 box; other site
31964007666	G4 box; other site
31964007667	G5 box; other site
31964007668	KH domain; Region: KH_2; pfam07650
31964007669	HMMPfam hit to PF07650, KH, type 2, score 7.9e-19
31964007670	HMMPfam hit to PF01926, GTP-binding protein,HSR1-related, score 1e-33
31964007671	PS00017 ATP/GTP-binding site motif A (P-loop).
31964007672	Hemolysins and related proteins containing CBS domains [General function prediction only]; Region: TlyC; COG1253
31964007673	Domain of unknown function DUF21; Region: DUF21; pfam01595
31964007674	This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain. CorC_HlyC is a transporter associated domain. This small domain is found in Na+/H+ antiporters, in proteins involved in...; Region: CBS_pair_CorC_HlyC_assoc; cd04590
31964007675	HMMPfam hit to PF03471, Transporter-associated region, score 7.4e-18
31964007676	HMMPfam hit to PF00571, CBS, score 6.8e-09
31964007677	HMMPfam hit to PF00571, CBS, score 5.5e-10
31964007678	HMMPfam hit to PF01595, Protein of unknown function DUF21, score 4.4e-12
31964007679	3 probable transmembrane helices predicted for CMS1733 by TMHMM2.0 at aa 4-26, 60-82 and 86-108
31964007680	metal-binding heat shock protein; Provisional; Region: PRK00016
31964007681	HMMPfam hit to PF02130, Protein of unknown function UPF0054, score 1.2e-36
31964007682	PS01306 Uncharacterized protein family UPF0054 signature.
31964007683	Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms]; Region: PhoH; COG1702
31964007684	K homology RNA-binding domain, type I.  KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA. There are two different KH domains that...; Region: KH-I; cl17245
31964007685	nucleic acid binding region [nucleotide binding]; other site
31964007686	G-X-X-G motif; other site
31964007687	PhoH-like protein; Region: PhoH; pfam02562
31964007688	HMMPfam hit to PF02562, PhoH-like protein, score 1.5e-133
31964007689	PS00017 ATP/GTP-binding site motif A (P-loop).
31964007690	HMMPfam hit to PF00013, KH, type 1, score 0.0001
31964007691	Protein Kinase C Interacting protein related (PKCI): PKCI and related proteins belong to the ubiquitous HIT family of hydrolases that act on alpha-phosphates of ribonucleotides. The members of this subgroup have a conserved HxHxHxx motif (x is a...; Region: PKCI_related; cd01276
31964007692	nucleotide binding site/active site [active]
31964007693	HIT family signature motif; other site
31964007694	catalytic residue [active]
31964007695	HMMPfam hit to PF01230, Histidine triad (HIT) protein, score 4.5e-33
31964007696	16S ribosomal RNA methyltransferase RsmE; Provisional; Region: PRK11713
31964007697	HMMPfam hit to PF04452, Protein of unknown function DUF558, score 5.2e-30
31964007698	chaperone protein DnaJ; Provisional; Region: PRK14278
31964007699	DnaJ domain or J-domain.  DnaJ/Hsp40 (heat shock protein 40) proteins are highly conserved and play crucial roles in protein translation, folding, unfolding, translocation, and degradation. They act primarily by stimulating the ATPase activity of Hsp70s; Region: DnaJ; cd06257
31964007700	HSP70 interaction site [polypeptide binding]; other site
31964007701	Zinc finger domain of DnaJ and HSP40; Region: DnaJ_zf; cd10719
31964007702	Zn binding sites [ion binding]; other site
31964007703	C-terminal substrate binding domain of DnaJ and HSP40; Region: DnaJ_C; cd10747
31964007704	dimer interface [polypeptide binding]; other site
31964007705	HMMPfam hit to PF01556, Chaperone DnaJ, C-terminal,score 1.7e-43
31964007706	HMMPfam hit to PF00684, DnaJ central region, score 9e-23
31964007707	HMMPfam hit to PF00226, Heat shock protein DnaJ,N-terminal, score 5.6e-34
31964007708	PS00636 Nt-dnaJ domain signature.
31964007709	HMMPfam hit to PF01628, Negative regulator of class I heat shock protein, score 2.1e-52
31964007710	Tic20-like protein; Region: Tic20; pfam09685
31964007711	3 probable transmembrane helices predicted for CMS1740 by TMHMM2.0 at aa 22-44, 65-87 and 91-113
31964007712	This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins; Region: Glo_EDI_BRP_like; cd06587
31964007713	active site
31964007714	metal binding site [ion binding]; metal-binding site
31964007715	coproporphyrinogen III oxidase; Validated; Region: PRK05628
31964007716	Radical SAM superfamily. Enzymes of this family generate radicals by combining a 4Fe-4S cluster and S-adenosylmethionine (SAM) in close proximity. They are characterized by a conserved CxxxCxxC motif, which coordinates the conserved iron-sulfur cluster; Region: Radical_SAM; cd01335
31964007717	FeS/SAM binding site; other site
31964007718	HMMPfam hit to PF06969, HemN, C-terminal, score 9.6e-25
31964007719	HMMPfam hit to PF04055, Radical SAM, score 2.3e-25
31964007720	Predicted phosphatases [General function prediction only]; Region: Gph; COG0546
31964007721	HAD-hyrolase-like; Region: Hydrolase_like; pfam13242
31964007722	HMMPfam hit to PF00702, Haloacid dehalogenase-like hydrolase, score 5.7e-10
31964007723	Domain of unknown function (DUF1990); Region: DUF1990; pfam09348
31964007724	1 probable transmembrane helix predicted for CMS1745 by TMHMM2.0 at aa 5-27
31964007725	1 probable transmembrane helix predicted for CMS1746 by TMHMM2.0 at aa 13-35
31964007726	1 probable transmembrane helix predicted for CMS1747 by TMHMM2.0 at aa 5-27
31964007727	1 probable transmembrane helix predicted for tmhmm2embl_unknown_001727_1841211_1842038 by TMHMM2.0 at aa 7-29
31964007728	GTP-binding protein LepA; Provisional; Region: PRK05433
31964007729	LepA also known as Elongation Factor 4 (EF4); Region: LepA; cd01890
31964007730	G1 box; other site
31964007731	putative GEF interaction site [polypeptide binding]; other site
31964007732	GTP/Mg2+ binding site [chemical binding]; other site
31964007733	Switch I region; other site
31964007734	G2 box; other site
31964007735	G3 box; other site
31964007736	Switch II region; other site
31964007737	G4 box; other site
31964007738	G5 box; other site
31964007739	lepA_II: This subfamily represents the domain II of LepA, a GTP-binding protein localized in the cytoplasmic membrane. The N-terminal domain of LepA shares regions of homology to translation factors. In terms of interaction with the ribosome, EF-G, EF-Tu...; Region: lepA_II; cd03699
31964007740	lepA_C: This family represents the C-terminal region of LepA, a GTP-binding protein localized in the cytoplasmic membrane.   LepA is ubiquitous in Bacteria and Eukaryota (e.g. Saccharomyces cerevisiae GUF1p), but is missing from Archaea. LepA exhibits...; Region: lepA_C; cd03709
31964007741	GTP-binding protein LepA C-terminus; Region: LepA_C; pfam06421
31964007742	HMMPfam hit to PF06421, GTP-binding protein LepA,score 9.6e-77
31964007743	HMMPfam hit to PF00679, Elongation factor G,C-terminal, score 3.4e-36
31964007744	HMMPfam hit to PF03144, Elongation factor Tu,domain 2, score 3.2e-05
31964007745	HMMPfam hit to PF00009, Protein synthesis factor,GTP-binding, score 5.1e-68
31964007746	PS00301 GTP-binding elongation factors signature.
31964007747	PS00017 ATP/GTP-binding site motif A (P-loop).
31964007748	1 probable transmembrane helix predicted for CMS1750 by TMHMM2.0 at aa 54-76
31964007749	RNA polymerase sigma factor, sigma-70 family; Region: sigma70-ECF; TIGR02937
31964007750	Sigma-70 region 2; Region: Sigma70_r2; pfam04542
31964007751	Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs). A SF is a dissociable subunit of RNA polymerase, it directs bacterial or...; Region: Sigma70_r4; cd06171
31964007752	DNA binding residues [nucleotide binding]
31964007753	HMMPfam hit to PF04545, Sigma-70 region 4, score 8e-13
31964007754	HMMPfam hit to PF04542, Sigma-70 region 2, score 7.7e-12
31964007755	TIGR01777 family protein; Region: yfcH
31964007756	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
31964007757	NAD(P) binding site [chemical binding]; other site
31964007758	active site
31964007759	Predicted helix-turn-helix motif with score 1007.000, SD 2.62 at aa 91-112, sequence ETTAELARAVADSARPVPVWIN
31964007760	PS00038 Myc-type, 'helix-loop-helix' dimerization domain signature.
31964007761	Superfamily of metallo-dependent hydrolases (also called amidohydrolase superfamily) is a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site. The vast majority of the members have a...; Region: metallo-dependent_hydrolases; cl00281
31964007762	Metallo-dependent hydrolases, subgroup C is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site. The vast majority of the...; Region: Met_dep_hydrolase_C; cd01309
31964007763	Amidohydrolase; Region: Amidohydro_4; pfam13147
31964007764	active site
31964007765	HMMPfam hit to PF01979, Amidohydrolase, score 4.8e-05
31964007766	Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly...; Region: Nudix_Hydrolase_17; cd04676
31964007767	nudix motif; other site
31964007768	HMMPfam hit to PF00293, NUDIX hydrolase, score 2.9e-23
31964007769	30S ribosomal protein S20; Reviewed; Region: rpsT; PRK00239
31964007770	HMMPfam hit to PF01649, Ribosomal protein S20,score 8.6e-30
31964007771	DNA polymerase III, delta subunit [DNA replication, recombination, and repair]; Region: HolA; COG1466
31964007772	HMMPfam hit to PF06144, DNA polymerase III, delta,score 2.4e-06
31964007773	HMMPfam hit to PF03772, ComEC/Rec2-related protein,score 1.4e-41
31964007774	SLBB domain; Region: SLBB; pfam10531
31964007775	comEA protein; Region: comE; TIGR01259
31964007776	1 probable transmembrane helix predicted for CMS1758 by TMHMM2.0 at aa 115-137
31964007777	submitted with no further information
31964007778	The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called...; Region: CBS_pair; cd02205
31964007779	leucyl-tRNA synthetase; Validated; Region: leuS; PRK00390
31964007780	catalytic core domain of leucyl-tRNA synthetases; Region: LeuRS_core; cd00812
31964007781	HIGH motif; other site
31964007782	Leucyl-tRNA synthetase, Domain 2; Region: tRNA-synt_1_2; pfam13603
31964007783	nucleotidyl transferase superfamily; Region: nt_trans; cl00015
31964007784	active site
31964007785	KMSKS motif; other site
31964007786	Anticodon-binding domain of class Ia aminoacyl tRNA synthetases and similar domains; Region: Anticodon_Ia_like; cl12020
31964007787	tRNA binding surface [nucleotide binding]; other site
31964007788	anticodon binding site; other site
31964007789	HMMPfam hit to PF00133, Aminoacyl-tRNA synthetase,class Ia, score 7.6e-119
31964007790	PS00178 Aminoacyl-transfer RNA synthetases class-I signature.
31964007791	Anthranilate synthase component I, N terminal region; Region: Anth_synt_I_N; pfam04715
31964007792	aminodeoxychorismate synthase; Provisional; Region: PRK07508
31964007793	chorismate binding enzyme; Region: Chorismate_bind; pfam00425
31964007794	HMMPfam hit to PF00425, Anthranilate synthase component I and chorismate binding protein, score 4.4e-104
31964007795	Aminotransferase class IV; Region: Aminotran_4; pfam01063
31964007796	substrate-cofactor binding pocket; other site
31964007797	pyridoxal 5'-phosphate binding site [chemical binding]; other site
31964007798	catalytic residue [active]
31964007799	ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]; Region: SalX; COG1136
31964007800	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
31964007801	Walker A/P-loop; other site
31964007802	ATP binding site [chemical binding]; other site
31964007803	Q-loop/lid; other site
31964007804	ABC transporter signature motif; other site
31964007805	Walker B; other site
31964007806	D-loop; other site
31964007807	H-loop/switch region; other site
31964007808	HMMPfam hit to PF00005, ABC transporter, score 2.1e-33
31964007809	PS00211 ABC transporters family signature.
31964007810	PS00017 ATP/GTP-binding site motif A (P-loop).
31964007811	6 probable transmembrane helices predicted for CMS1763 by TMHMM2.0 at aa 20-42, 52-71, 132-154, 159-181,237-259 and 274-296
31964007812	HMMPfam hit to PF00664, ABC transporter,transmembrane region, score 0.00089
31964007813	thiol reductant ABC exporter, CydD subunit; Region: CydD; TIGR02857
31964007814	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
31964007815	Walker A/P-loop; other site
31964007816	ATP binding site [chemical binding]; other site
31964007817	Q-loop/lid; other site
31964007818	ABC transporter signature motif; other site
31964007819	Walker B; other site
31964007820	D-loop; other site
31964007821	H-loop/switch region; other site
31964007822	HMMPfam hit to PF00005, ABC transporter, score 1e-40
31964007823	PS00211 ABC transporters family signature.
31964007824	PS00017 ATP/GTP-binding site motif A (P-loop).
31964007825	HMMPfam hit to PF00664, ABC transporter,transmembrane region, score 1.1e-09
31964007826	5 probable transmembrane helices predicted for CMS1764 by TMHMM2.0 at aa 3-25, 35-57, 114-133, 138-160 and 219-241
31964007827	Winged helix-turn helix; Region: HTH_29; pfam13551
31964007828	leucine-zipper of insertion element IS481; Region: LZ_Tnp_IS481; pfam13011
31964007829	Integrase core domain; Region: rve; pfam00665
31964007830	Integrase core domain; Region: rve_3; pfam13683
31964007831	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.8e-38
31964007832	Predicted helix-turn-helix motif with score 1638.000, SD 4.77 at aa 45-66, sequence RPVSHVARELGVSRQCAHRWVA
31964007833	Cytochrome oxidase subunit II; Region: Cyto_ox_2; pfam02322
31964007834	cytochrome d ubiquinol oxidase subunit 2; Provisional; Region: PRK15003; cl12219
31964007835	HMMPfam hit to PF02322, Cytochrome bd ubiquinol oxidase, subunit II, score 2.1e-143
31964007836	8 probable transmembrane helices predicted for CMS1766 by TMHMM2.0 at aa 5-24, 78-100, 113-135, 160-182,194-216, 220-242, 249-271 and 297-319
31964007837	cytochrome d terminal oxidase subunit 1; Provisional; Region: PRK15097
31964007838	Bacterial Cytochrome Ubiquinol Oxidase; Region: Bac_Ubq_Cox; pfam01654
31964007839	HMMPfam hit to PF01654, Cytochrome bd ubiquinol oxidase, subunit I, score 2.8e-178
31964007840	9 probable transmembrane helices predicted for CMS1767 by TMHMM2.0 at aa 15-37, 57-79, 99-121, 128-150,190-212, 225-247, 336-358, 370-392 and 415-437
31964007841	Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane]; Region: COG1247
31964007842	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cd04301
31964007843	Coenzyme A binding pocket [chemical binding]; other site
31964007844	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 4.2e-21
31964007845	Acetyltransferase (GNAT) family; Region: Acetyltransf_1; pfam00583
31964007846	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 9.7e-19
31964007847	UbiA prenyltransferase family; Region: UbiA; pfam01040
31964007848	7 probable transmembrane helices predicted for CMS1771 by TMHMM2.0 at aa 7-29, 99-121, 128-150, 154-176,197-219, 229-251 and 258-275
31964007849	HMMPfam hit to PF01040, UbiA prenyltransferase,score 1.6e-06
31964007850	ubiquinone biosynthesis hydroxylase family protein; Provisional; Region: PRK07608; cl17314
31964007851	2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion]; Region: UbiH; COG0654
31964007852	HMMPfam hit to PF01360, Flavoprotein monooxygenase,score 8.3e-22
31964007853	HMMPfam hit to PF01494, Monooxygenase, FAD-binding,score 7.8e-12
31964007854	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
31964007855	S-adenosylmethionine binding site [chemical binding]; other site
31964007856	Predicted naringenin-chalcone synthase [Secondary metabolites biosynthesis, transport, and catabolism]; Region: BcsA; COG3424
31964007857	Chalcone and stilbene synthases; plant-specific polyketide synthases (PKS) and related enzymes, also called type III PKSs. PKS generate an array of different products, dependent on the nature of the starter molecule. They share a common chemical strategy; Region: CHS_like; cd00831
31964007858	malonyl-CoA binding site [chemical binding]; other site
31964007859	dimer interface [polypeptide binding]; other site
31964007860	active site
31964007861	product binding site; other site
31964007862	HMMPfam hit to PF02797, Naringenin-chalcone synthase, score 1.1e-20
31964007863	HMMPfam hit to PF00195, Naringenin-chalcone synthase, score 2.1e-08
31964007864	Protein of unknown function (DUF3618); Region: DUF3618; pfam12277
31964007865	1 probable transmembrane helix predicted for CMS1774 by TMHMM2.0 at aa 145-167
31964007866	Periplasmic glycine betaine/choline-binding (lipo)protein of an ABC-type transport system (osmoprotectant binding protein) [Cell envelope biogenesis, outer membrane]; Region: OpuBC; COG1732
31964007867	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964007868	dimer interface [polypeptide binding]; other site
31964007869	conserved gate region; other site
31964007870	ABC-ATPase subunit interface; other site
31964007871	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cl00427
31964007872	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 8.6e-16
31964007873	6 probable transmembrane helices predicted for CMS1775 by TMHMM2.0 at aa 15-37, 50-72, 82-104, 125-144,149-171 and 183-205
31964007874	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964007875	ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]; Region: GlnQ; COG1126
31964007876	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
31964007877	Walker A/P-loop; other site
31964007878	ATP binding site [chemical binding]; other site
31964007879	Q-loop/lid; other site
31964007880	ABC transporter signature motif; other site
31964007881	Walker B; other site
31964007882	D-loop; other site
31964007883	H-loop/switch region; other site
31964007884	HMMPfam hit to PF00005, ABC transporter, score 6.8e-60
31964007885	PS00211 ABC transporters family signature.
31964007886	PS00017 ATP/GTP-binding site motif A (P-loop).
31964007887	Uncharacterized ACR, COG2135; Region: DUF159; pfam02586
31964007888	HMMPfam hit to PF02586, Protein of unknown function DUF159, score 4.5e-17
31964007889	Uncharacterized conserved protein [Function unknown]; Region: COG4850
31964007890	Uncharacterized conserved protein (DUF2183); Region: DUF2183; pfam09949
31964007891	Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols. AKRs are present in all phyla and are of importance to both health and industrial...; Region: Aldo_ket_red; cd06660
31964007892	Aldo/keto reductase family; Region: Aldo_ket_red; pfam00248
31964007893	active site
31964007894	catalytic tetrad [active]
31964007895	HMMPfam hit to PF00248, Aldo/keto reductase, score 2e-43
31964007896	Nicotinamide mononucleotide transporter [Coenzyme metabolism]; Region: PnuC; COG3201
31964007897	HMMPfam hit to PF04973, Nicotinamide mononucleotide transporter PnuC, score 4.5e-06
31964007898	4 probable transmembrane helices predicted for CMS1781 by TMHMM2.0 at aa 42-64, 113-135, 147-169 and 184-206
31964007899	Transcriptional regulator [Transcription]; Region: LytR; COG1316
31964007900	HMMPfam hit to PF03816, Cell envelope-related transcriptional attenuator, score 6.3e-44
31964007901	1 probable transmembrane helix predicted for CMS1782 by TMHMM2.0 at aa 54-76
31964007902	Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism]; Region: COG0412
31964007903	BAAT / Acyl-CoA thioester hydrolase C terminal; Region: BAAT_C; pfam08840
31964007904	HMMPfam hit to PF01738, Dienelactone hydrolase,score 9.6e-48
31964007905	glucose-6-phosphate 1-dehydrogenase; Provisional; Region: PRK12853
31964007906	Glucose-6-phosphate dehydrogenase, NAD binding domain; Region: G6PD_N; pfam00479
31964007907	Glucose-6-phosphate dehydrogenase, C-terminal domain; Region: G6PD_C; pfam02781
31964007908	HMMPfam hit to PF02781, Glucose-6-phosphate dehydrogenase, score 4.9e-48
31964007909	HMMPfam hit to PF00479, Glucose-6-phosphate dehydrogenase, score 2e-14
31964007910	HMMPfam hit to PF02231, Phosphoesterase PHP,N-terminal, score 1.1e-07
31964007911	HMMPfam hit to PF02811, PHP, C-terminal, score 0.041
31964007912	HMMPfam hit to PF07733, Bacterial DNA polymerase III alpha subunit, score 4.4e-143
31964007913	HMMPfam hit to PF01336, OB-fold nucleic acid binding, score 1.8e-07
31964007914	Bacterial protein of unknown function (DUF939); Region: DUF939; pfam06081
31964007915	5 probable transmembrane helices predicted for CMS1786 by TMHMM2.0 at aa 21-43, 63-85, 90-107, 112-134 and 141-160
31964007916	alpha/beta hydrolase fold; Region: Abhydrolase_1; pfam00561
31964007917	HMMPfam hit to PF00561, Alpha/beta hydrolase fold,score 1.1e-22
31964007918	alpha/beta hydrolase fold; Region: Abhydrolase_1; pfam00561
31964007919	HMMPfam hit to PF00561, Alpha/beta hydrolase fold,score 2e-21
31964007920	HMMPfam hit to PF04264, YceI, score 2.7e-70
31964007921	putative NAD(P)H quinone oxidoreductase, PIG3 family; Region: quinone_pig3; TIGR02824
31964007922	PIG3 p53-inducible quinone oxidoreductase; Region: p53_inducible_oxidoreductase; cd05276
31964007923	NAD(P) binding site [chemical binding]; other site
31964007924	HMMPfam hit to PF00107, Zinc-containing alcohol dehydrogenase superfamily, score 3.6e-84
31964007925	Homeodomain-like domain; Region: HTH_23; cl17451
31964007926	Winged helix-turn helix; Region: HTH_29; pfam13551
31964007927	Integrase core domain; Region: rve; pfam00665
31964007928	Integrase core domain; Region: rve_3; pfam13683
31964007929	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.4e-41
31964007930	Predicted helix-turn-helix motif with score 1316.000, SD 3.67 at aa 25-46, sequence WPVRRAAERFQCSPATASRWAR
31964007931	drug resistance transporter, EmrB/QacA subfamily; Region: efflux_EmrB; TIGR00711
31964007932	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
31964007933	14 probable transmembrane helices predicted for CMS1792 by TMHMM2.0 at aa 26-48, 63-82, 94-116, 121-143,150-172, 177-199, 212-231, 236-258, 278-300, 310-332,339-361, 376-398, 411-428 and 438-460
31964007934	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964007935	alpha/beta hydrolase fold; Region: Abhydrolase_1; pfam00561
31964007936	Alpha/beta hydrolase family; Region: Abhydrolase_6; pfam12697
31964007937	Putative lysophospholipase; Region: Hydrolase_4; pfam12146
31964007938	HMMPfam hit to PF00561, Alpha/beta hydrolase fold,score 3e-15
31964007939	histidinol-phosphate aminotransferase; Provisional; Region: PRK03317
31964007940	Aspartate aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). Pyridoxal phosphate combines with an alpha-amino acid to form a compound called a Schiff base or aldimine...; Region: AAT_like; cd00609
31964007941	pyridoxal 5'-phosphate binding site [chemical binding]; other site
31964007942	homodimer interface [polypeptide binding]; other site
31964007943	catalytic residue [active]
31964007944	HMMPfam hit to PF00155, Aminotransferase, class I and II, score 2.6e-44
31964007945	PS00599 Aminotransferases class-II pyridoxal-phosphate attachment site.
31964007946	short chain dehydrogenase; Provisional; Region: PRK06197
31964007947	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
31964007948	NAD(P) binding site [chemical binding]; other site
31964007949	active site
31964007950	HMMPfam hit to PF00106, Short-chain dehydrogenase/reductase SDR, score 4.1e-10
31964007951	DEAD-like helicases superfamily; Region: DEXDc; smart00487
31964007952	DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region; Region: DEXDc; cd00046
31964007953	ATP binding site [chemical binding]; other site
31964007954	putative Mg++ binding site [ion binding]; other site
31964007955	Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may...; Region: HELICc; cd00079
31964007956	nucleotide binding region [chemical binding]; other site
31964007957	ATP-binding site [chemical binding]; other site
31964007958	Domain of unknown function (DUF3516); Region: DUF3516; pfam12029
31964007959	HMMPfam hit to PF00271, Helicase, C-terminal, score 1.9e-10
31964007960	HMMPfam hit to PF00270, DEAD/DEAH box helicase,N-terminal, score 3.3e-13
31964007961	1 probable transmembrane helix predicted for CMS1798 by TMHMM2.0 at aa 63-85
31964007962	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
31964007963	NAD(P) binding site [chemical binding]; other site
31964007964	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
31964007965	NAD(P) binding site [chemical binding]; other site
31964007966	active site
31964007967	PS00455  AMP-binding domain signature.
31964007968	Histidine-containing phosphocarrier protein (HPr)-like proteins. HPr is a central component of the bacterial phosphoenolpyruvate sugar phosphotransferase system (PTS). The PTS catalyses the phosphorylation of sugar substrates during their translocation...; Region: PTS-HPr_like; cd00367
31964007969	dimerization domain swap beta strand [polypeptide binding]; other site
31964007970	regulatory protein interface [polypeptide binding]; other site
31964007971	active site
31964007972	regulatory phosphorylation site [posttranslational modification]; other site
31964007973	HMMPfam hit to PF00381, Phosphocarrier HPr protein,score 1.8e-13
31964007974	PS00369 PTS HPR component histidine phosphorylation site signature.
31964007975	PTS system 2-O-a-mannosyl-D-glycerate specific transporter subunit IIABC; Provisional; Region: PRK09765
31964007976	PTS_IIA, PTS system, fructose/mannitol specific IIA subunit. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. This...; Region: PTS_IIA_fru; cd00211
31964007977	active site
31964007978	phosphorylation site [posttranslational modification]
31964007979	PTS_IIB_fructose: subunit IIB of enzyme II (EII) of the fructose-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS). In this system, EII (also referred to as FruAB) is a fructose-specific permease made up of two proteins (FruA and...; Region: PTS_IIB_fructose; cd05569
31964007980	active site
31964007981	P-loop; other site
31964007982	phosphorylation site [posttranslational modification]
31964007983	Phosphotransferase system, fructose-specific IIC component [Carbohydrate transport and metabolism]; Region: FruA; COG1299
31964007984	9 probable transmembrane helices predicted for CMS1801 by TMHMM2.0 at aa 318-340, 374-396, 411-433,446-468, 483-505, 536-558, 573-592, 597-619 and 634-656
31964007985	HMMPfam hit to PF02378, Phosphotransferase system,EIIC, score 4.8e-28
31964007986	HMMPfam hit to PF02379, Phosphotransferase system PTS, fructose-specific IIB subunit, score 2.7e-31
31964007987	HMMPfam hit to PF00359,Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2, score 1.5e-18
31964007988	PS00372 PTS EIIA domains phosphorylation site signature 2.
31964007989	Fructose-1-phosphate kinase and related fructose-6-phosphate kinase (PfkB) [Carbohydrate transport and metabolism]; Region: FruK; COG1105
31964007990	1-phosphofructokinase (FruK), minor 6-phosphofructokinase (pfkB) and related sugar kinases. FruK plays an important role in the predominant pathway for fructose utilisation.This group also contains tagatose-6-phophate kinase, an enzyme of the tagatose...; Region: FruK_PfkB_like; cd01164
31964007991	putative substrate binding site [chemical binding]; other site
31964007992	putative ATP binding site [chemical binding]; other site
31964007993	HMMPfam hit to PF00294, Carbohydrate kinase, PfkB,score 7.3e-18
31964007994	PS00584 pfkB family of carbohydrate kinases signature 2.
31964007995	transcriptional repressor UlaR; Provisional; Region: PRK13509
31964007996	helix_turn_helix, Deoxyribose operon repressor; Region: HTH_DEOR; smart00420
31964007997	DeoR C terminal sensor domain; Region: DeoRC; pfam00455
31964007998	HMMPfam hit to PF00455, Bacterial regulatory protein, DeoR, score 1.6e-45
31964007999	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely...; Region: SGNH_hydrolase; cl01053
31964008000	active site
31964008001	catalytic triad [active]
31964008002	oxyanion hole [active]
31964008003	1 probable transmembrane helix predicted for CMS1804 by TMHMM2.0 at aa 21-43
31964008004	2 probable transmembrane helices predicted for CMS1805 by TMHMM2.0 at aa 42-64 and 95-117
31964008005	Nuclease-related domain; Region: NERD; pfam08378
31964008006	2 probable transmembrane helices predicted for CMS1806 by TMHMM2.0 at aa 4-26 and 107-129
31964008007	Transcription factor zinc-finger; Region: zf-TFIIB; cl01565
31964008008	iojap-like ribosome-associated protein; Region: iojap_ybeB; TIGR00090
31964008009	HMMPfam hit to PF02410, Iojap-related protein,score 1.6e-40
31964008010	flagellar biosynthesis regulator FlhF; Validated; Region: flhF; PRK06995
31964008011	1 probable transmembrane helix predicted for CMS1809 by TMHMM2.0 at aa 488-510
31964008012	nicotinic acid mononucleotide adenylyltransferase; Provisional; Region: nadD; PRK00071
31964008013	Nicotinamide/nicotinate mononucleotide adenylyltransferase; Region: NMNAT; cd02165
31964008014	active site
31964008015	(T/H)XGH motif; other site
31964008016	HMMPfam hit to PF01467, Cytidylyltransferase, score 4e-46
31964008017	1 probable transmembrane helix predicted for CMS1811 by TMHMM2.0 at aa 20-42
31964008018	Gamma-glutamyl phosphate reductase (GPR), aldehyde dehydrogenase families 18 and 19; Region: ALDH_F18-19_ProA-GPR; cd07079
31964008019	gamma-glutamyl phosphate reductase; Region: proA; TIGR00407
31964008020	putative catalytic cysteine [active]
31964008021	gamma-glutamyl kinase; Provisional; Region: PRK12314
31964008022	substrate binding site [chemical binding]; other site
31964008023	nucleotide binding site [chemical binding]; other site
31964008024	HMMPfam hit to PF00696,Aspartate/glutamate/uridylate kinase, score 1.4e-47
31964008025	GTPase CgtA; Reviewed; Region: obgE; PRK12296
31964008026	GTP1/OBG; Region: GTP1_OBG; pfam01018
31964008027	Obg GTPase; Region: Obg; cd01898
31964008028	G1 box; other site
31964008029	GTP/Mg2+ binding site [chemical binding]; other site
31964008030	Switch I region; other site
31964008031	G2 box; other site
31964008032	G3 box; other site
31964008033	Switch II region; other site
31964008034	G4 box; other site
31964008035	G5 box; other site
31964008036	Domain of unknown function (DUF1967); Region: DUF1967; pfam09269
31964008037	HMMPfam hit to PF01926, GTP-binding protein,HSR1-related, score 2.8e-38
31964008038	PS00905 GTP1/OBG family signature.
31964008039	PS00017 ATP/GTP-binding site motif A (P-loop).
31964008040	HMMPfam hit to PF01018, GTP1/OBG subdomain, score 2.1e-60
31964008041	50S ribosomal protein L27; Validated; Region: rpmA; PRK05435
31964008042	HMMPfam hit to PF01016, Ribosomal protein L27,score 1.2e-53
31964008043	PS00831 Ribosomal protein L27 signature.
31964008044	50S ribosomal protein L21; Validated; Region: rplU; PRK05573
31964008045	HMMPfam hit to PF00829, Ribosomal protein L21,score 5.2e-32
31964008046	Protein of unknown function (DUF4031); Region: DUF4031; pfam13223
31964008047	ribonuclease, Rne/Rng family; Region: RNaseEG; TIGR00757
31964008048	S1_RNase_E: RNase E and RNase G, S1-like RNA-binding domain. RNase E is an essential endoribonuclease in the processing and degradation of RNA. In addition to its role in mRNA degradation, RNase E has also been implicated in the processing of rRNA, and...; Region: S1_RNase_E; cd04453
31964008049	homodimer interface [polypeptide binding]; other site
31964008050	oligonucleotide binding site [chemical binding]; other site
31964008051	HMMPfam hit to PF00575, RNA binding S1, score 8e-05
31964008052	Vitamin K epoxide reductase family in bacteria; Region: VKOR_5; cd12922
31964008053	putative active site [active]
31964008054	redox center [active]
31964008055	5 probable transmembrane helices predicted for CMS1819 by TMHMM2.0 at aa 13-32, 74-93, 100-119, 123-145 and 175-197
31964008056	Nucleoside diphosphate kinase Group I (NDPk_I)-like: NDP kinase domains are present in a large family of structurally and functionally conserved proteins from bacteria to humans that generally catalyze the transfer of gamma-phosphates of a nucleoside...; Region: NDPk_I; cd04413
31964008057	active site
31964008058	multimer interface [polypeptide binding]; other site
31964008059	HMMPfam hit to PF00334, Nucleoside diphosphate kinase, score 3.9e-56
31964008060	PS00469 Nucleoside diphosphate kinases active site.
31964008061	Protein of unknown function (DUF4233); Region: DUF4233; pfam14017
31964008062	3 probable transmembrane helices predicted for CMS1821 by TMHMM2.0 at aa 21-43, 53-75 and 88-110
31964008063	Folylpolyglutamate synthase [Coenzyme metabolism]; Region: FolC; COG0285
31964008064	Mur ligase middle domain; Region: Mur_ligase_M; pfam08245
31964008065	HMMPfam hit to PF02875, Cytoplasmic peptidoglycan synthetases, C-terminal, score 1.5e-07
31964008066	HMMPfam hit to PF01225, Cytoplasmic peptidoglycan synthetase, N-terminal, score 2.6e-28
31964008067	PS01011 Folylpolyglutamate synthase signature 1.
31964008068	isoleucyl-tRNA synthetase; Reviewed; Region: ileS; PRK06039
31964008069	catalytic core domain of isoleucyl-tRNA synthetases; Region: IleRS_core; cd00818
31964008070	HIGH motif; other site
31964008071	catalytic core domain of isoleucyl-tRNA synthetases; Region: IleRS_core; cd00818
31964008072	active site
31964008073	KMSKS motif; other site
31964008074	Anticodon-binding domain of archaeal, bacterial, and eukaryotic cytoplasmic isoleucyl tRNA synthetases; Region: Anticodon_Ia_Ile_ABEc; cd07961
31964008075	tRNA binding surface [nucleotide binding]; other site
31964008076	anticodon binding site; other site
31964008077	HMMPfam hit to PF00133, Aminoacyl-tRNA synthetase,class Ia, score 6e-179
31964008078	PS00178 Aminoacyl-transfer RNA synthetases class-I signature.
31964008079	Homeodomain-like domain; Region: HTH_23; cl17451
31964008080	Winged helix-turn helix; Region: HTH_29; pfam13551
31964008081	Integrase core domain; Region: rve; pfam00665
31964008082	Integrase core domain; Region: rve_3; pfam13683
31964008083	HMMPfam hit to PF00665, Integrase, catalytic region, score 5.3e-40
31964008084	Predicted helix-turn-helix motif with score 1316.000, SD 3.67 at aa 25-46, sequence WPVRRAAERFQCSPATASRWAR
31964008085	tetracycline repressor protein TetR; Provisional; Region: PRK13756
31964008086	Predicted helix-turn-helix motif with score 2069.000, SD 6.23 at aa 31-52, sequence LTLTSLAHRLGVDHSTLYRHVA
31964008087	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely...; Region: SGNH_hydrolase; cl01053
31964008088	active site
31964008089	oxyanion hole [active]
31964008090	catalytic triad [active]
31964008091	HMMPfam hit to PF00657, Lipolytic enzyme, G-D-S-L,score 8.2e-05
31964008092	2 probable transmembrane helices predicted for CMS1827 by TMHMM2.0 at aa 13-35 and 111-133
31964008093	atypical (a) SDRs, subgroup 2; Region: SDR_a2; cd05245
31964008094	Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]; Region: COG0702
31964008095	putative NAD(P) binding site [chemical binding]; other site
31964008096	putative active site [active]
31964008097	Protein of unknown function (DUF2867); Region: DUF2867; pfam11066
31964008098	Putative hydrophobic ligand-binding SRPBCC domain of Micromonospora echinospora CalC, human Aha1, and related proteins; Region: SRPBCC_CalC_Aha1-like; cd07814
31964008099	putative hydrophobic ligand binding site [chemical binding]; other site
31964008100	Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism]; Region: NagC; COG1940
31964008101	Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily; Region: NBD_sugar-kinase_HSP70_actin; cl17037
31964008102	nucleotide binding site [chemical binding]; other site
31964008103	HMMPfam hit to PF00480, ROK, score 2e-34
31964008104	PS01125 ROK family signature.
31964008105	Cyanate permease [Inorganic ion transport and metabolism]; Region: CynX; COG2807
31964008106	12 probable transmembrane helices predicted for CMS1831 by TMHMM2.0 at aa 13-35, 50-69, 76-98, 102-124,131-153, 168-190, 225-247, 262-284, 291-313, 317-339,346-368 and 378-400
31964008107	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964008108	uncharacterized Actinobacterial protein TIGR03083; Region: TIGR03083
31964008109	Mycothiol maleylpyruvate isomerase N-terminal domain; Region: MDMPI_N; pfam11716
31964008110	HMMPfam hit to PF07739, , score 3.3e-19
31964008111	HMMPfam hit to PF00376, Bacterial regulatory protein, MerR, score 6.3e-08
31964008112	This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins; Region: Glo_EDI_BRP_like; cd06587
31964008113	active site
31964008114	bifunctional riboflavin kinase/FMN adenylyltransferase; Reviewed; Region: PRK05627
31964008115	FAD synthetase, N-terminal domain of the bifunctional enzyme; Region: FAD_synthetase_N; cd02064
31964008116	active site
31964008117	Riboflavin kinase; Region: Flavokinase; smart00904
31964008118	HMMPfam hit to PF01687, Riboflavin kinase / FAD synthetase, score 2.7e-41
31964008119	HMMPfam hit to PF06574, Riboflavin kinase / FAD synthetase, score 1.2e-69
31964008120	4 probable transmembrane helices predicted for CMS1836 by TMHMM2.0 at aa 12-29, 44-66, 78-100 and 110-132
31964008121	4 probable transmembrane helices predicted for CMS1837 by TMHMM2.0 at aa 4-26, 33-55, 70-89 and 94-116
31964008122	tRNA pseudouridine synthase B; Provisional; Region: truB; PRK03287
31964008123	Pseudouridine synthase, Escherichia coli TruB like; Region: PseudoU_synth_EcTruB; cd02573
31964008124	RNA binding site [nucleotide binding]; other site
31964008125	active site
31964008126	tRNA Pseudouridine synthase II, C terminal; Region: TruB_C; pfam09142
31964008127	HMMPfam hit to PF01509, Pseudouridylate synthase TruB, N-terminal, score 8e-50
31964008128	Ketopantoate reductase [Coenzyme metabolism]; Region: ApbA; COG1893
31964008129	Ketopantoate reductase PanE/ApbA; Region: ApbA; pfam02558
31964008130	Ketopantoate reductase PanE/ApbA C terminal; Region: ApbA_C; pfam08546
31964008131	HMMPfam hit to PF02558, Ketopantoate reductase ApbA/PanE, score 5.7e-08
31964008132	Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates...; Region: NK; cl17190
31964008133	A/G-specific DNA glycosylase [DNA replication, recombination, and repair]; Region: MutY; COG1194
31964008134	endonuclease III; includes endonuclease III (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA glycosidases (Alka-family) and other DNA glycosidases; Region: ENDO3c; cd00056
31964008135	minor groove reading motif; other site
31964008136	helix-hairpin-helix signature motif; other site
31964008137	Iron-sulfur binding domain of endonuclease III; Region: EndIII_4Fe-2S; pfam10576
31964008138	HMMPfam hit to PF00730, HhH-GPD, score 1.2e-13
31964008139	HMMPfam hit to PF00633, Helix-hairpin-helix motif,score 9e-07
31964008140	ribosome-binding factor A; Validated; Region: rbfA; PRK00521
31964008141	HMMPfam hit to PF02033, Ribosome-binding factor A,score 9.3e-44
31964008142	Translation initiation factor IF-2, N-terminal region; Region: IF2_N; pfam04760
31964008143	translation initiation factor IF-2; Region: IF-2; TIGR00487
31964008144	Translation initiation factor IF-2, N-terminal region; Region: IF2_N; pfam04760
31964008145	Initiation Factor 2 (IF2)/ eukaryotic Initiation Factor 5B (eIF5B) family; Region: IF2_eIF5B; cd01887
31964008146	G1 box; other site
31964008147	putative GEF interaction site [polypeptide binding]; other site
31964008148	GTP/Mg2+ binding site [chemical binding]; other site
31964008149	Switch I region; other site
31964008150	G2 box; other site
31964008151	G3 box; other site
31964008152	Switch II region; other site
31964008153	G4 box; other site
31964008154	G5 box; other site
31964008155	This family represents the domain II of bacterial Initiation Factor 2 (IF2) and its eukaryotic mitochondrial homologue mtIF2. IF2, the largest initiation factor is an essential GTP binding protein. In E. coli three natural forms of IF2 exist in the cell; Region: IF2_mtIF2_II; cd03702
31964008156	Translation-initiation factor 2; Region: IF-2; pfam11987
31964008157	mtIF2_IVc: this family represents the C2 subdomain of domain IV of mitochondrial translation initiation factor 2 (mtIF2) which adopts a beta-barrel fold displaying a high degree of structural similarity with domain II of the translation elongation factor...; Region: mtIF2_IVc; cd03692
31964008158	HMMPfam hit to PF03144, Elongation factor Tu,domain 2, score 1.5e-12
31964008159	HMMPfam hit to PF00009, Protein synthesis factor,GTP-binding, score 1.9e-49
31964008160	PS00017 ATP/GTP-binding site motif A (P-loop).
31964008161	HMMPfam hit to PF04760, Translation initiation factor IF-2, N-terminal, score 1.2e-08
31964008162	HMMPfam hit to PF04760, Translation initiation factor IF-2, N-terminal, score 7.3e-07
31964008163	transcription elongation factor NusA; Provisional; Region: nusA; PRK12327
31964008164	NusA N-terminal domain; Region: NusA_N; pfam08529
31964008165	S1_NusA: N-utilizing substance A protein (NusA), S1-like RNA-binding domain. S1-like RNA-binding domains are found in a wide variety of RNA-associated proteins. NusA is a transcription elongation factor containing an N-terminal catalytic domain and three...; Region: S1_NusA; cd04455
31964008166	RNA binding site [nucleotide binding]; other site
31964008167	homodimer interface [polypeptide binding]; other site
31964008168	NusA-like KH domain; Region: KH_5; pfam13184
31964008169	NusA_K homology RNA-binding domain (KH). NusA is an essential multifunctional transcription elongation factor that is universally conserved among prokaryotes and archaea. NusA anti-termination function plays an important role in the expression of...; Region: NusA_KH; cd02134
31964008170	G-X-X-G motif; other site
31964008171	prolyl-tRNA synthetase; Provisional; Region: PRK09194
31964008172	Prolyl-tRNA synthetase (ProRS) class II core catalytic domain. ProRS is a homodimer. It is responsible for the attachment of proline to the 3' OH group of ribose of the appropriate tRNA. This domain is primarily responsible for ATP-dependent...; Region: ProRS_core_prok; cd00779
31964008173	dimer interface [polypeptide binding]; other site
31964008174	motif 1; other site
31964008175	active site
31964008176	motif 2; other site
31964008177	INS is an amino acid-editing domain inserted (INS) into the bacterial class II prolyl-tRNA synthetase (ProRS) however, this CD is not exclusively bacterial. It is also found at the N-terminus of the eukaryotic/archaea-like ProRS's of yeasts and...; Region: ProRS-INS; cd04334
31964008178	putative deacylase active site [active]
31964008179	Class II tRNA amino-acyl synthetase-like catalytic core domain. Class II amino acyl-tRNA synthetases (aaRS) share a common fold and generally attach an amino acid to the 3' OH of ribose of the appropriate tRNA.   PheRS is an exception in that it...; Region: class_II_aaRS-like_core; cl00268
31964008180	active site
31964008181	motif 3; other site
31964008182	HGTP anticodon binding domain, as found at the C-terminus of histidyl, glycyl, threonyl and prolyl tRNA synthetases, which are classified as a group of class II aminoacyl-tRNA synthetases (aaRS). In aaRSs, the anticodon binding domain is responsible for...; Region: HGTP_anticodon; cl00266
31964008183	anticodon binding site; other site
31964008184	HMMPfam hit to PF03129, Anticodon-binding, score 4.7e-13
31964008185	HMMPfam hit to PF00587, tRNA synthetases, class-II (G, H, P and S), score 2.9e-50
31964008186	PS00179 Aminoacyl-transfer RNA synthetases class-II signature 1.
31964008187	Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]; Region: WcaG; COG0451
31964008188	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
31964008189	NAD(P) binding site [chemical binding]; other site
31964008190	active site
31964008191	HMMPfam hit to PF01073, 3-beta hydroxysteroid dehydrogenase/isomerase, score 2.9e-30
31964008192	PS00339 Aminoacyl-transfer RNA synthetases class-II signature 2.
31964008193	haloalkane dehalogenase; Provisional; Region: PRK03204
31964008194	peptide synthase; Provisional; Region: PRK09274
31964008195	Adenylate forming domain, Class I; Region: AFD_class_I; cl17068
31964008196	acyl-activating enzyme (AAE) consensus motif; other site
31964008197	AMP binding site [chemical binding]; other site
31964008198	active site
31964008199	CoA binding site [chemical binding]; other site
31964008200	HMMPfam hit to PF00501, AMP-dependent synthetase and ligase, score 1.2e-35
31964008201	PS00455  AMP-binding domain signature.
31964008202	HMMPfam hit to PF00561, Alpha/beta hydrolase fold,score 1.2e-09
31964008203	3-oxoacyl-(acyl carrier protein) synthase III; Reviewed; Region: PRK09258
31964008204	Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems. It is found in bacteria and plants. Elongation of fatty acids in the type II systems occurs by Claisen condensation of malonyl-acyl...; Region: KAS_III; cd00830
31964008205	dimer interface [polypeptide binding]; other site
31964008206	active site
31964008207	CoA binding pocket [chemical binding]; other site
31964008208	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Reviewed; Region: ispG; PRK00366
31964008209	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Validated; Region: PRK00694
31964008210	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Validated; Region: PRK00694
31964008211	HMMPfam hit to PF04551, IspG protein, score 4.1e-229
31964008212	RseP-like Site-2 proteases (S2P), zinc metalloproteases (MEROPS family M50A), cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. In Escherichia coli, the S2P homolog...; Region: S2P-M50_PDZ_RseP-like; cd06163
31964008213	active site
31964008214	Site-2 protease (S2P) class of zinc metalloproteases (MEROPS family M50) cleaves transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of this family use proteolytic...; Region: S2P-M50; cl10020
31964008215	Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane]; Region: COG0750
31964008216	PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms. May be responsible for substrate recognition and/or binding, as most PDZ...; Region: PDZ_metalloprotease; cd00989
31964008217	Site-2 protease (S2P) class of zinc metalloproteases (MEROPS family M50) cleaves transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of this family use proteolytic...; Region: S2P-M50; cl10020
31964008218	putative substrate binding region [chemical binding]; other site
31964008219	4 probable transmembrane helices predicted for CMS1850 by TMHMM2.0 at aa 13-35, 164-186, 396-418 and 454-476
31964008220	HMMPfam hit to PF02163, Peptidase M50, score 4.3e-43
31964008221	PS00142 Neutral zinc metallopeptidases,zinc-binding region signature.
31964008222	Protein Kinases, catalytic domain; Region: PKc_like; cl09925
31964008223	Serine/Threonine protein kinases, catalytic domain; Region: S_TKc; smart00220
31964008224	active site
31964008225	ATP binding site [chemical binding]; other site
31964008226	substrate binding site [chemical binding]; other site
31964008227	activation loop (A-loop); other site
31964008228	HMMPfam hit to PF00069, Protein kinase, score 1.8e-51
31964008229	PS00107 Protein kinases ATP-binding region signature.
31964008230	PS00108 Serine/Threonine protein kinases active-site signature.
31964008231	1 probable transmembrane helix predicted for CMS1851 by TMHMM2.0 at aa 368-390
31964008232	type VI secretion ATPase, ClpV1 family; Region: VI_ClpV1; TIGR03345
31964008233	1 probable transmembrane helix predicted for CMS1852 by TMHMM2.0 at aa 28-50
31964008234	1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional; Region: PRK05447
31964008235	1-deoxy-D-xylulose 5-phosphate reductoisomerase; Region: DXP_reductoisom; pfam02670
31964008236	1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal; Region: DXP_redisom_C; pfam08436
31964008237	DXP reductoisomerase C-terminal domain; Region: DXPR_C; pfam13288
31964008238	HMMPfam hit to PF02670, 1-deoxy-D-xylulose 5-phosphate reductoisomerase, score 1.2e-160
31964008239	PS00430 TonB-dependent receptor proteins signature 1.
31964008240	FKBP-type peptidyl-prolyl cis-trans isomerase; Region: FKBP_C; pfam00254
31964008241	HMMPfam hit to PF00254, Peptidylprolyl isomerase,FKBP-type, score 5.7e-30
31964008242	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964008243	Homeodomain-like domain; Region: HTH_23; cl17451
31964008244	Winged helix-turn helix; Region: HTH_29; pfam13551
31964008245	Integrase core domain; Region: rve; pfam00665
31964008246	Integrase core domain; Region: rve_3; pfam13683
31964008247	Predicted helix-turn-helix motif with score 1316.000, SD 3.67 at aa 25-46, sequence WPVRRAAERFQCSPATASRWAR
31964008248	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.3e-41
31964008249	Predicted helix-turn-helix motif with score 1631.000, SD 4.74 at aa 26-47, sequence WSLDVLAARCFLSPSTLSRIET
31964008250	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
31964008251	Zinc dependent phospholipase C/S1-P1 nuclease; Region: ZnPC_S1P1; cl16915
31964008252	5 probable transmembrane helices predicted for CMS1859 by TMHMM2.0 at aa 31-53, 83-105, 129-151, 174-196 and 206-228
31964008253	Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]; Region: SrmB; COG0513
31964008254	DEAD-box helicases. A diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker  B motif; Region: DEADc; cd00268
31964008255	ATP binding site [chemical binding]; other site
31964008256	Mg++ binding site [ion binding]; other site
31964008257	motif III; other site
31964008258	Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may...; Region: HELICc; cd00079
31964008259	nucleotide binding region [chemical binding]; other site
31964008260	ATP-binding site [chemical binding]; other site
31964008261	RNA recognition motif in Escherichia coli cold-shock DEAD box protein A (CsdA) and similar proteins; Region: RRM_EcCsdA_like; cd12499
31964008262	putative RNA binding site [nucleotide binding]; other site
31964008263	HMMPfam hit to PF00270, DEAD/DEAH box helicase,N-terminal, score 2.9e-70
31964008264	PS00017 ATP/GTP-binding site motif A (P-loop).
31964008265	PS00039 DEAD-box subfamily ATP-dependent helicases signature.
31964008266	HMMPfam hit to PF00271, Helicase, C-terminal, score 7.7e-34
31964008267	HMMPfam hit to PF03880, DbpA, RNA-binding, score 7.6e-33
31964008268	submitted with no further information
31964008269	Helix-turn-helix domain; Region: HTH_38; pfam13936
31964008270	Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair]; Region: Tra8; COG2826
31964008271	Integrase core domain; Region: rve; pfam00665
31964008272	PS00017 ATP/GTP-binding site motif A (P-loop).
31964008273	Predicted helix-turn-helix motif with score 1119.000, SD 3.00 at aa 43-64, sequence MSRRVAASRVGVHERTAQDWDR
31964008274	PS01043 Transposases, IS30 family, signature.
31964008275	2 probable transmembrane helices predicted for CMS1863 by TMHMM2.0 at aa 7-29 and 39-57
31964008276	2 probable transmembrane helices predicted for CMS1864 by TMHMM2.0 at aa 140-159 and 163-185
31964008277	Acetyltransferase (GNAT) domain; Region: Acetyltransf_3; pfam13302
31964008278	Acetyltransferase (GNAT) family; Region: Acetyltransf_1; pfam00583
31964008279	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 2.9e-09
31964008280	Alpha/beta hydrolase family; Region: Abhydrolase_6; pfam12697
31964008281	HMMPfam hit to PF00561, Alpha/beta hydrolase fold,score 3.4e-06
31964008282	PS00120 Lipases, serine active site.
31964008283	Carboxylesterase family; Region: COesterase; pfam00135
31964008284	Esterases and lipases (includes fungal lipases, cholinesterases, etc.)  These enzymes act on carboxylic esters (EC: 3.1.1.-). The catalytic apparatus involves three residues (catalytic triad): a serine, a glutamate or aspartate and a histidine.These...; Region: Esterase_lipase; cd00312
31964008285	substrate binding pocket [chemical binding]; other site
31964008286	catalytic triad [active]
31964008287	HMMPfam hit to PF00135, Carboxylesterase, type B,score 8e-53
31964008288	Bacterial regulatory proteins, tetR family; Region: TetR_N; pfam00440
31964008289	HMMPfam hit to PF00440, Bacterial regulatory protein, TetR, score 0.00019
31964008290	Protein-tyrosine-phosphatase [Signal transduction mechanisms]; Region: Wzb; COG0394
31964008291	Low molecular weight phosphatase family; Region: LMWPc; cl00105
31964008292	active site
31964008293	HMMPfam hit to PF01451, Low molecular weight phosphotyrosine protein phosphatase, score 2.4e-21
31964008294	Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to...; Region: HTH_ARSR; cd00090
31964008295	dimerization interface [polypeptide binding]; other site
31964008296	putative DNA binding site [nucleotide binding]; other site
31964008297	putative Zn2+ binding site [ion binding]; other site
31964008298	HMMPfam hit to PF01022, Bacterial regulatory protein, ArsR, score 2.3e-14
31964008299	Predicted helix-turn-helix motif with score 1243.000, SD 3.42 at aa 35-56, sequence AYPALLAERLGLTRQNVSNHLA
31964008300	P-loop containing region of AAA domain; Region: AAA_29; cl17516
31964008301	5 probable transmembrane helices predicted for CMS1871 by TMHMM2.0 at aa 29-51, 56-78, 91-113, 123-142 and 163-185
31964008302	Domain of unknown function (DUF3817); Region: DUF3817; pfam12823
31964008303	2 probable transmembrane helices predicted for CMS1874 by TMHMM2.0 at aa 56-78 and 98-120
31964008304	Uncharacterized conserved protein [Function unknown]; Region: COG1284
31964008305	Uncharacterized BCR, YitT family COG1284; Region: DUF161; pfam02588
31964008306	6 probable transmembrane helices predicted for CMS1875 by TMHMM2.0 at aa 33-50, 65-87, 100-122, 127-146,166-188 and 193-210
31964008307	HMMPfam hit to PF02588, Protein of unknown function DUF161, score 5e-14
31964008308	HMMPfam hit to PF02588, Protein of unknown function DUF161, score 2.9e-18
31964008309	domain in bacterial beta-glucosidases other glycosidases, glycosyltransferases, proteases, amidases, yeast adhesins, and bacterial toxins; Region: PA14; smart00758
31964008310	RHS repeat-associated core domain; Region: Rhs_assc_core; TIGR03696
31964008311	1 probable transmembrane helix predicted for CMS1879 by TMHMM2.0 at aa 1020-1042
31964008312	HMMPfam hit to PF05593, YD repeat, score 2.6
31964008313	HMMPfam hit to PF05593, YD repeat, score 3.9
31964008314	HMMPfam hit to PF05593, YD repeat, score 0.075
31964008315	HMMPfam hit to PF05593, YD repeat, score 1.3
31964008316	HMMPfam hit to PF05593, YD repeat, score 1.2
31964008317	HMMPfam hit to PF07691, PA14 domain, score 5e-13
31964008318	HMMPfam hit to PF05593, YD repeat, score 4.7
31964008319	HMMPfam hit to PF05593, YD repeat, score 1.8
31964008320	PA14 domain; Region: PA14; pfam07691
31964008321	HMMPfam hit to PF07691, PA14 domain, score 3.8e-21
31964008322	Siderophore-interacting protein [Inorganic ion transport and metabolism]; Region: ViuB; COG2375
31964008323	Siderophore interacting proteins share the domain structure of the ferredoxin reductase like family. Siderophores are produced in various bacteria (and some plants) to extract iron from hosts. Binding constants are high, so iron can be pilfered from...; Region: siderophore_interacting; cd06193
31964008324	FAD binding pocket [chemical binding]; other site
31964008325	FAD binding motif [chemical binding]; other site
31964008326	phosphate binding motif [ion binding]; other site
31964008327	NAD binding pocket [chemical binding]; other site
31964008328	HMMPfam hit to PF04954, Siderophore-interacting protein, score 1.2e-46
31964008329	lipoate-protein ligase B; Provisional; Region: PRK14345
31964008330	HMMPfam hit to PF03099, Biotin/lipoate A/B protein ligase, score 1.3e-22
31964008331	PS01313 Lipoate-protein ligase B signature.
31964008332	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964008333	lipoyl synthase; Provisional; Region: PRK05481
31964008334	Radical SAM superfamily. Enzymes of this family generate radicals by combining a 4Fe-4S cluster and S-adenosylmethionine (SAM) in close proximity. They are characterized by a conserved CxxxCxxC motif, which coordinates the conserved iron-sulfur cluster; Region: Radical_SAM; cd01335
31964008335	FeS/SAM binding site; other site
31964008336	HMMPfam hit to PF04055, Radical SAM, score 3e-17
31964008337	Predicted transcriptional regulators [Transcription]; Region: COG1695
31964008338	Transcriptional regulator PadR-like family; Region: PadR; pfam03551
31964008339	HMMPfam hit to PF03551, Transcriptional regulator PadR-like, score 4.4e-26
31964008340	HMMPfam hit to PF03109, ABC-1, score 9.5e-31
31964008341	Uncharacterized conserved protein [Function unknown]; Region: COG1615
31964008342	Uncharacterized protein family (UPF0182); Region: UPF0182; pfam03699
31964008343	HMMPfam hit to PF03699, Protein of unknown function UPF0182, score 1.5e-283
31964008344	7 probable transmembrane helices predicted for CMS1887 by TMHMM2.0 at aa 21-43, 58-80, 108-130, 164-186,207-224, 250-272 and 279-301
31964008345	Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms]; Region: SdrC; COG3480
31964008346	PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis. May be responsible for substrate recognition and/or binding, as most PDZ domains bind...; Region: PDZ_serine_protease; cd00987
31964008347	Lon protease (S16) C-terminal proteolytic domain; Region: Lon_C; pfam05362
31964008348	HMMPfam hit to PF00595, PDZ/DHR/GLGF, score 1.7e-05
31964008349	1 probable transmembrane helix predicted for CMS1888 by TMHMM2.0 at aa 20-42
31964008350	uncharacterized protein, coenzyme F420 biosynthesis associated; Region: DUF2342_F420; TIGR03883
31964008351	Uncharacterized conserved protein (DUF2342); Region: DUF2342; pfam10103
31964008352	Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair]; Region: UvrD; COG0210
31964008353	Part of AAA domain; Region: AAA_19; pfam13245
31964008354	Family description; Region: UvrD_C_2; pfam13538
31964008355	HMMPfam hit to PF00580, UvrD/REP helicase, score 1.2e-76
31964008356	PS00017 ATP/GTP-binding site motif A (P-loop).
31964008357	NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair]; Region: NPY1; COG2816
31964008358	NADH pyrophosphatase zinc ribbon domain; Region: zf-NADH-PPase; pfam09297
31964008359	NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP. Like other members of the Nudix family, it requires a divalent cation, such as Mg2+ or Mn2+, for...; Region: NADH_pyrophosphatase; cd03429
31964008360	putative NADH binding site [chemical binding]; other site
31964008361	putative active site [active]
31964008362	nudix motif; other site
31964008363	putative metal binding site [ion binding]; other site
31964008364	HMMPfam hit to PF00293, NUDIX hydrolase, score 1.7e-22
31964008365	PS00893 mutT domain signature.
31964008366	Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family. The APH/ChoK family is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs)...; Region: APH_ChoK_like; cl17270
31964008367	active site
31964008368	ATP binding site [chemical binding]; other site
31964008369	Phosphotransferase enzyme family; Region: APH; pfam01636
31964008370	substrate binding site [chemical binding]; other site
31964008371	Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair]; Region: UvrD; COG0210
31964008372	Part of AAA domain; Region: AAA_19; pfam13245
31964008373	Family description; Region: UvrD_C_2; pfam13538
31964008374	PD-(D/E)XK nuclease superfamily; Region: PDDEXK_1; pfam12705
31964008375	HMMPfam hit to PF00580, UvrD/REP helicase, score 8.8e-58
31964008376	PS00017 ATP/GTP-binding site motif A (P-loop).
31964008377	UvrD/REP helicase N-terminal domain; Region: UvrD-helicase; pfam00580
31964008378	Part of AAA domain; Region: AAA_19; pfam13245
31964008379	PD-(D/E)XK nuclease superfamily; Region: PDDEXK_1; pfam12705
31964008380	HMMPfam hit to PF00580, UvrD/REP helicase, score 1.7e-10
31964008381	Protein of unknown function (DUF3107); Region: DUF3107; pfam11305
31964008382	3 probable transmembrane helices predicted for CMS1897 by TMHMM2.0 at aa 4-21, 28-47 and 57-79
31964008383	tRNA-(MS[2]IO[6]A)-hydroxylase (MiaE)-like; Region: MiaE_2; pfam13794
31964008384	ATP-dependent RNA helicase RhlB; Provisional; Region: PRK04837
31964008385	DEAD-box helicases. A diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker  B motif; Region: DEADc; cd00268
31964008386	ATP binding site [chemical binding]; other site
31964008387	Mg++ binding site [ion binding]; other site
31964008388	motif III; other site
31964008389	Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may...; Region: HELICc; cd00079
31964008390	nucleotide binding region [chemical binding]; other site
31964008391	ATP-binding site [chemical binding]; other site
31964008392	HMMPfam hit to PF00270, DEAD/DEAH box helicase,N-terminal, score 6.5e-57
31964008393	PS00017 ATP/GTP-binding site motif A (P-loop).
31964008394	PS00039 DEAD-box subfamily ATP-dependent helicases signature.
31964008395	HMMPfam hit to PF00271, Helicase, C-terminal, score 8.9e-34
31964008396	leucine-zipper of insertion element IS481; Region: LZ_Tnp_IS481; pfam13011
31964008397	Winged helix-turn helix; Region: HTH_29; pfam13551
31964008398	Integrase core domain; Region: rve; pfam00665
31964008399	Integrase core domain; Region: rve_3; pfam13683
31964008400	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964008401	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964008402	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964008403	HMMPfam hit to PF00665, Integrase, catalytic region, score 3.5E-36
31964008404	Predicted metal-dependent phosphoesterases (PHP family) [General function prediction only]; Region: COG0613
31964008405	Polymerase and Histidinol Phosphatase domain; Region: PHP; cl17102
31964008406	active site
31964008407	Polymerase and Histidinol Phosphatase domain of Histidinol phosphate phosphatase (HisPPase) AMP bound; Region: PHP_HisPPase_AMP; cd07438
31964008408	HMMPfam hit to PF02231, Phosphoesterase PHP,N-terminal, score 1e-21
31964008409	Aminopeptidase P, N-terminal domain; Region: AMP_N; smart01011
31964008410	Prolidase. E.C. 3.4.13.9. Also known as Xaa-Pro dipeptidase, X-Pro dipeptidase, proline dipeptidase., imidodipeptidase, peptidase D, gamma-peptidase. Catalyses hydrolysis of Xaa-Pro dipeptides; also acts on aminoacyl-hydroxyproline analogs. No action on...; Region: Prolidase; cd01087
31964008411	active site
31964008412	HMMPfam hit to PF05195, Peptidase M24B, X-Pro dipeptidase/aminopeptidase N-terminal, score 1.6e-17
31964008413	HMMPfam hit to PF00557, Peptidase M24, score 8.7e-64
31964008414	PS00491 Aminopeptidase P and proline dipeptidase signature.
31964008415	2 probable transmembrane helices predicted for CMS1904 by TMHMM2.0 at aa 58-80 and 85-107
31964008416	MgtE intracellular N domain; Region: MgtE_N; smart00924
31964008417	FOG: CBS domain [General function prediction only]; Region: COG0517
31964008418	This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE.  MgtE and its homologs are found in eubacteria, archaebacteria, and eukaryota. Members of this family transport Mg2+ or other...; Region: CBS_pair_Mg_transporter; cd04606
31964008419	HMMPfam hit to PF03448, MgtE intracellular region,score 4e-23
31964008420	HMMPfam hit to PF00571, CBS, score 0.035
31964008421	HMMPfam hit to PF00571, CBS, score 5.8e-11
31964008422	Protein of unknown function (DUF1003); Region: DUF1003; pfam06210
31964008423	HMMPfam hit to PF06210, Protein of unknown function DUF1003, score 7.2e-30
31964008424	2 probable transmembrane helices predicted for CMS1906 by TMHMM2.0 at aa 41-63 and 78-100
31964008425	Predicted metal-sulfur cluster biosynthetic enzyme [General function prediction only]; Region: PaaD; COG2151
31964008426	ATPases involved in chromosome partitioning [Cell division and chromosome partitioning]; Region: Mrp; COG0489
31964008427	The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain. Functionally, proteins in this superfamily use the energy from hydrolysis of NTP to transfer electron or ion; Region: Fer4_NifH; cl17203
31964008428	HMMPfam hit to PF01883, Protein of unknown function DUF59, score 6e-23
31964008429	PS00017 ATP/GTP-binding site motif A (P-loop).
31964008430	Transcriptional regulator [Transcription]; Region: LysR; COG0583
31964008431	Bacterial regulatory helix-turn-helix protein, lysR family; Region: HTH_1; pfam00126
31964008432	The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold; Region: PBP2_LTTR_like_6; cd08423
31964008433	putative dimerization interface [polypeptide binding]; other site
31964008434	HMMPfam hit to PF00126, Bacterial regulatory protein, LysR, score 2.9e-09
31964008435	HMMPfam hit to PF03466, LysR, substrate-binding,score 5.6e-36
31964008436	mttA/Hcf106 family; Region: MttA_Hcf106; cl00788
31964008437	Predicted O-methyltransferase [General function prediction only]; Region: COG4122
31964008438	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
31964008439	S-adenosylmethionine binding site [chemical binding]; other site
31964008440	HMMPfam hit to PF01596, O-methyltransferase, family 3, score 2.8e-10
31964008441	Homeodomain-like domain; Region: HTH_23; cl17451
31964008442	Winged helix-turn helix; Region: HTH_29; pfam13551
31964008443	Integrase core domain; Region: rve; pfam00665
31964008444	Integrase core domain; Region: rve_3; pfam13683
31964008445	HMMPfam hit to PF00665, Integrase, catalytic region, score 3.7e-42
31964008446	Predicted helix-turn-helix motif with score 1316.000, SD 3.67 at aa 25-46, sequence WPVRRAAERFQCSPATASRWAR
31964008447	Protein of unknown function (DUF3117); Region: DUF3117; pfam11314
31964008448	9 probable transmembrane helices predicted for CMS1914 by TMHMM2.0 at aa 30-52, 127-149, 156-178,201-223, 244-266, 303-325, 337-354, 358-375 and 382-404
31964008449	succinyl-diaminopimelate desuccinylase; Reviewed; Region: PRK13007
31964008450	M20 Peptidase actinobacterial DapE encoded N-succinyl-L,L-diaminopimelic acid desuccinylase; Region: M20_DapE_actinobac; cd05647
31964008451	metal binding site [ion binding]; metal-binding site
31964008452	putative dimer interface [polypeptide binding]; other site
31964008453	HMMPfam hit to PF01546, Peptidase M20, score 9.6e-15
31964008454	HMMPfam hit to PF07687, Peptidase dimerisation domain, score 1e-10
31964008455	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase; Region: DapD_actino; TIGR03535
31964008456	Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal...; Region: LbH_THP_succinylT_putative; cd04649
31964008457	putative trimer interface [polypeptide binding]; other site
31964008458	putative CoA binding site [chemical binding]; other site
31964008459	HMMPfam hit to PF00132, Bacterial transferase hexapeptide repeat, score 0.36
31964008460	HMMPfam hit to PF00132, Bacterial transferase hexapeptide repeat, score 24
31964008461	Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence...; Region: PP2Cc; cd00143
31964008462	Protein phosphatase 2C; Region: PP2C; pfam00481
31964008463	active site
31964008464	HMMPfam hit to PF00481, Protein phosphatase 2C-like, score 2.6e-05
31964008465	Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins. Putative nuclear signalling domain. FHA domains may bind phosphothreonine, phosphoserine and sometimes phosphotyrosine. In eukaryotes, many FHA domain-containing proteins...; Region: FHA; cl00062
31964008466	phosphopeptide binding site; other site
31964008467	PS00339 Aminoacyl-transfer RNA synthetases class-II signature 2.
31964008468	helix_turn_helix ASNC type; Region: HTH_ASNC; smart00344
31964008469	Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to...; Region: HTH_ARSR; cd00090
31964008470	putative DNA binding site [nucleotide binding]; other site
31964008471	putative Zn2+ binding site [ion binding]; other site
31964008472	AsnC family; Region: AsnC_trans_reg; pfam01037
31964008473	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 31-52, sequence RSYAEIGKAVGLSEAAVRQRVQ
31964008474	PS00519 Bacterial regulatory proteins, asnC family signature.
31964008475	HMMPfam hit to PF01037, Bacterial regulatory proteins, AsnC/Lrp, score 3.5e-14
31964008476	6-O-methylguanine DNA methyltransferase, ribonuclease-like domain; Region: Methyltransf_1N; pfam02870
31964008477	methylated-DNA--protein-cysteine methyltransferase; Provisional; Region: PRK00901
31964008478	The DNA repair protein O6-alkylguanine-DNA alkyltransferase (ATase; also known as AGT, AGAT and MGMT) reverses O6-alkylation DNA damage by transferring O6-alkyl adducts to an active site cysteine irreversibly, without inducing DNA strand breaks. ATases...; Region: ATase; cd06445
31964008479	DNA binding site [nucleotide binding]
31964008480	active site
31964008481	HMMPfam hit to PF02870, Methylguanine DNA methyltransferase, ribonuclease-like, score 0.00023
31964008482	HMMPfam hit to PF01035,Methylated-DNA-[protein]-cysteine S-methyltransferase,score 9.4e-32
31964008483	PS00374 Methylated-DNA--protein-cysteine methyltransferase active site.
31964008484	Methyladenine glycosylase; Region: Adenine_glyco; pfam03352
31964008485	HMMPfam hit to PF03352, Methyladenine glycosylase,score 2e-89
31964008486	hypothetical protein; Validated; Region: PRK02101
31964008487	HMMPfam hit to PF03883, Protein of unknown function DUF328, score 3.9e-07
31964008488	mitochondrial ATP synthase delta subunit; Region: F1-ATPase_delta; cd12152
31964008489	gamma subunit interface [polypeptide binding]; other site
31964008490	epsilon subunit interface [polypeptide binding]; other site
31964008491	LBP interface [polypeptide binding]; other site
31964008492	HMMPfam hit to PF02823, H+-transporting two-sector ATPase, delta/epsilon subunit, score 3.2e-18
31964008493	F0F1 ATP synthase subunit beta; Validated; Region: PRK09280
31964008494	ATP synthase alpha/beta family, beta-barrel domain; Region: ATP-synt_ab_N; pfam02874
31964008495	F1 ATP synthase beta subunit, nucleotide-binding domain. The F-ATPase is found in bacterial plasma membranes, mitochondrial inner membranes and in chloroplast thylakoid membranes. It has also been found in the archaea Methanosarcina barkeri. It uses a...; Region: F1-ATPase_beta; cd01133
31964008496	alpha subunit interaction interface [polypeptide binding]; other site
31964008497	Walker A motif; other site
31964008498	ATP binding site [chemical binding]; other site
31964008499	Walker B motif; other site
31964008500	inhibitor binding site; inhibition site
31964008501	ATP synthase alpha/beta chain, C terminal domain; Region: ATP-synt_ab_C; pfam00306
31964008502	HMMPfam hit to PF00306, H+-transporting two-sector ATPase, alpha/beta subunit, C-terminal, score 1.1e-36
31964008503	HMMPfam hit to PF00006, H+-transporting two-sector ATPase, alpha/beta subunit, central region, score 1.4e-91
31964008504	PS00152 ATP synthase alpha and beta subunits signature.
31964008505	PS00017 ATP/GTP-binding site motif A (P-loop).
31964008506	HMMPfam hit to PF02874, H+-transporting two-sector ATPase, alpha/beta subunit, N-terminal, score 6.1e-24
31964008507	mitochondrial ATP synthase gamma subunit; Region: F1-ATPase_gamma; cd12151
31964008508	core domain interface [polypeptide binding]; other site
31964008509	delta subunit interface [polypeptide binding]; other site
31964008510	epsilon subunit interface [polypeptide binding]; other site
31964008511	HMMPfam hit to PF00231, H+-transporting two-sector ATPase, gamma subunit, score 3.4e-93
31964008512	F0F1 ATP synthase subunit alpha; Validated; Region: PRK09281
31964008513	ATP synthase alpha/beta family, beta-barrel domain; Region: ATP-synt_ab_N; pfam02874
31964008514	F1 ATP synthase alpha, central domain. The F-ATPase is found in bacterial plasma membranes, mitochondrial inner membranes and in chloroplast thylakoid membranes. It has also been found in the archaea Methanosarcina barkeri. It uses a proton gradient to...; Region: F1_ATPase_alpha; cd01132
31964008515	beta subunit interaction interface [polypeptide binding]; other site
31964008516	Walker A motif; other site
31964008517	ATP binding site [chemical binding]; other site
31964008518	Walker B motif; other site
31964008519	ATP synthase alpha/beta chain, C terminal domain; Region: ATP-synt_ab_C; pfam00306
31964008520	HMMPfam hit to PF00306, H+-transporting two-sector ATPase, alpha/beta subunit, C-terminal, score 1.2e-33
31964008521	HMMPfam hit to PF00006, H+-transporting two-sector ATPase, alpha/beta subunit, central region, score 2.6e-106
31964008522	PS00152 ATP synthase alpha and beta subunits signature.
31964008523	PS00017 ATP/GTP-binding site motif A (P-loop).
31964008524	HMMPfam hit to PF02874, H+-transporting two-sector ATPase, alpha/beta subunit, N-terminal, score 5e-18
31964008525	F0F1 ATP synthase subunit delta; Provisional; Region: PRK13430
31964008526	ATP synthase delta (OSCP) subunit; Region: OSCP; pfam00213
31964008527	HMMPfam hit to PF00213, H+-transporting two-sector ATPase, delta (OSCP) subunit, score 1.8e-06
31964008528	PS00389 ATP synthase delta (OSCP) subunit signature.
31964008529	F0F1 ATP synthase subunit B; Validated; Region: PRK05759
31964008530	F0F1-type ATP synthase, subunit b [Energy production and conversion]; Region: AtpF; COG0711
31964008531	HMMPfam hit to PF00430, H+-transporting two-sector ATPase, B/B' subunit, score 1.2e-26
31964008532	1 probable transmembrane helix predicted for CMS1928 by TMHMM2.0 at aa 10-32
31964008533	ATP synthase subunit C; Region: ATP-synt_C; cl00466
31964008534	HMMPfam hit to PF00137, H+-transporting two-sector ATPase, C subunit, score 3.7e-17
31964008535	2 probable transmembrane helices predicted for CMS1929 by TMHMM2.0 at aa 10-32 and 53-75
31964008536	PS00605 ATP synthase c subunit signature.
31964008537	F0F1 ATP synthase subunit A; Validated; Region: PRK05815
31964008538	HMMPfam hit to PF00119, H+-transporting two-sector ATPase, A subunit, score 2.5e-25
31964008539	6 probable transmembrane helices predicted for CMS1930 by TMHMM2.0 at aa 2-19, 58-80, 85-107, 127-146,153-175 and 190-212
31964008540	leucine-zipper of insertion element IS481; Region: LZ_Tnp_IS481; pfam13011
31964008541	Winged helix-turn helix; Region: HTH_29; pfam13551
31964008542	Integrase core domain; Region: rve; pfam00665
31964008543	Integrase core domain; Region: rve_3; pfam13683
31964008544	HMMPfam hit to PF00665, Integrase, catalytic region, score 6.8e-38
31964008545	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964008546	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964008547	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964008548	Threonine aldolase [Amino acid transport and metabolism]; Region: GLY1; COG2008
31964008549	Low-specificity threonine aldolase (TA). This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I).  TA catalyzes the conversion of L-threonine or L-allo-threonine to glycine and acetaldehyde in a...; Region: TA_like; cd06502
31964008550	tetramer interface [polypeptide binding]; other site
31964008551	pyridoxal 5'-phosphate binding site [chemical binding]; other site
31964008552	catalytic residue [active]
31964008553	HMMPfam hit to PF01212, Tryptophanase, score 1.2e-60
31964008554	submitted with no further information
31964008555	Abi-like protein; Region: Abi_2; pfam07751
31964008556	HMMPfam hit to PF07751, Abi-like protein, score 2.5e-51
31964008557	Phosphoenolpyruvate carboxylase; Region: PEPcase; cl17418
31964008558	Phosphoenolpyruvate carboxylase [Energy production and conversion]; Region: Ppc; COG2352
31964008559	HMMPfam hit to PF00311, Phosphoenolpyruvate carboxylase, score 1.1e-57
31964008560	PS00781 Phosphoenolpyruvate carboxylase active site 1.
31964008561	Major Facilitator Superfamily; Region: MFS_1; pfam07690
31964008562	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
31964008563	HMMPfam hit to PF00083, General substrate transporter, score 0.00019
31964008564	12 probable transmembrane helices predicted for CMS1940 by TMHMM2.0 at aa 22-44, 57-79, 86-108, 112-134,146-168, 172-194, 232-254, 259-281, 288-307, 311-333,346-368 and 372-394
31964008565	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964008566	submitted with no further information
31964008567	Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]; Region: WcaG; COG0451
31964008568	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
31964008569	NAD(P) binding site [chemical binding]; other site
31964008570	active site
31964008571	Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription]; Region: CitB; COG2197
31964008572	C-terminal DNA-binding domain of LuxR-like proteins. This domain contains a helix-turn-helix motif and binds DNA. Proteins belonging to this group are response regulators; some act as transcriptional activators, others as transcriptional repressors. Many...; Region: LuxR_C_like; cd06170
31964008573	DNA binding residues [nucleotide binding]
31964008574	dimerization interface [polypeptide binding]; other site
31964008575	HMMPfam hit to PF00072, Response regulator receiver, score 0.0018
31964008576	HMMPfam hit to PF00196, Bacterial regulatory protein, LuxR, score 1.5e-14
31964008577	PS00622 Bacterial regulatory proteins, luxR family signature.
31964008578	Predicted helix-turn-helix motif with score 1092.000, SD 2.91 at aa 176-197, sequence WSNAEIAEEIALSSETVKSHVA
31964008579	1 probable transmembrane helix predicted for CMS1945 by TMHMM2.0 at aa 17-39
31964008580	3 probable transmembrane helices predicted for CMS1946 by TMHMM2.0 at aa 24-46, 58-80 and 84-101
31964008581	Homeodomain-like domain; Region: HTH_23; cl17451
31964008582	Winged helix-turn helix; Region: HTH_29; pfam13551
31964008583	Integrase core domain; Region: rve; pfam00665
31964008584	Integrase core domain; Region: rve_3; pfam13683
31964008585	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.8e-38
31964008586	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964008587	Predicted helix-turn-helix motif with score 1628.000, SD 4.73 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964008588	Predicted helix-turn-helix motif with score 1628.000, SD 4.73 at aa 25-46, sequence RPVAHVARELGVSWQCAHRWVN
31964008589	DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair]; Region: SSL2; COG1061
31964008590	DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region; Region: DEXDc; cd00046
31964008591	ATP binding site [chemical binding]; other site
31964008592	putative Mg++ binding site [ion binding]; other site
31964008593	HMMPfam hit to PF00271, Helicase, C-terminal, score 0.014
31964008594	HMMPfam hit to PF00270, DEAD/DEAH box helicase,N-terminal, score 4.4e-07
31964008595	HMMPfam hit to PF04851, Type III restriction enzyme, res subunit, score 6.7e-11
31964008596	PS00017 ATP/GTP-binding site motif A (P-loop).
31964008597	Acyl-CoA dehydrogenases [Lipid metabolism]; Region: CaiA; COG1960
31964008598	Acyl-CoA dehydrogenase; Region: ACAD; cl09933
31964008599	active site
31964008600	HMMPfam hit to PF00441, Acyl-CoA dehydrogenase,C-terminal, score 1.2e-06
31964008601	Predicted ring-cleavage extradiol dioxygenase [General function prediction only]; Region: COG2514
31964008602	This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins; Region: Glo_EDI_BRP_like; cl14632
31964008603	active site
31964008604	metal binding site [ion binding]; metal-binding site
31964008605	This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins; Region: Glo_EDI_BRP_like; cl14632
31964008606	active site
31964008607	HMMPfam hit to PF00903, Glyoxalase/bleomycin resistance protein/dioxygenase, score 4.9e-14
31964008608	PS00934 Glyoxalase I signature 1.
31964008609	HMMPfam hit to PF00903, Glyoxalase/bleomycin resistance protein/dioxygenase, score 3.8e-06
31964008610	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely...; Region: SGNH_hydrolase_like_1; cd01832
31964008611	active site
31964008612	catalytic triad [active]
31964008613	oxyanion hole [active]
31964008614	HMMPfam hit to PF00657, Lipolytic enzyme, G-D-S-L,score 4.1e-27
31964008615	D-alanyl-D-alanine carboxypeptidase; Region: Peptidase_S11; pfam00768
31964008616	Beta-lactamase enzyme family; Region: Beta-lactamase2; cl17872
31964008617	HMMPfam hit to PF00768, Peptidase S11,D-alanyl-D-alanine carboxypeptidase 1, score 2e-10
31964008618	Predicted helix-turn-helix motif with score 1289.000, SD 3.58 at aa 184-205, sequence LTGTHVADAMGLSPETVSTTAD
31964008619	1 probable transmembrane helix predicted for CMS1952 by TMHMM2.0 at aa 7-29
31964008620	rRNA methylases [Translation, ribosomal structure and biogenesis]; Region: SpoU; COG0566
31964008621	SpoU rRNA Methylase family; Region: SpoU_methylase; pfam00588
31964008622	HMMPfam hit to PF00588, tRNA/rRNA methyltransferase (SpoU), score 5.1e-34
31964008623	NAD-dependent deacetylase; Provisional; Region: PRK05333
31964008624	SIR2 superfamily of proteins includes silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation, where the acetyl group from the lysine epsilon-amino group is transferred to the ADP-ribose moiety of NAD+; Region: SIR2; cl00195
31964008625	HMMPfam hit to PF02146, Silent information regulator protein Sir2, score 1.4e-46
31964008626	Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction; Region: HP_PGM_like; cd07067
31964008627	catalytic core [active]
31964008628	HMMPfam hit to PF00300,Phosphoglycerate/bisphosphoglycerate mutase, score 9.6e-14
31964008629	Glycosyltransferase [Cell envelope biogenesis, outer membrane]; Region: RfaG; COG0438
31964008630	This family is most closely related to the GT1 family of glycosyltransferases. mtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the...; Region: GT1_mtfB_like; cd03809
31964008631	HMMPfam hit to PF00534, Glycosyl transferase, group 1, score 3.9e-14
31964008632	Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only]; Region: MhpC; COG0596
31964008633	HMMPfam hit to PF00561, Alpha/beta hydrolase fold,score 1e-13
31964008634	trehalose synthase; Region: treS_nterm; TIGR02456
31964008635	Alpha amylase catalytic domain found in Trehalose synthetase; Region: AmyAc_TreS; cd11334
31964008636	active site
31964008637	catalytic site [active]
31964008638	Alpha amylase, C-terminal all-beta domain; Region: Alpha-amylase_C; pfam02806
31964008639	HMMPfam hit to PF00128, Alpha amylase, catalytic region, score 2.5e-71
31964008640	DNA polymerase III, epsilon subunit and related 3'-5' exonucleases [DNA replication, recombination, and repair]; Region: DnaQ; COG0847
31964008641	DEDDh 3'-5' exonuclease domain family; Region: DEDDh; cd06127
31964008642	active site
31964008643	catalytic site [active]
31964008644	substrate binding site [chemical binding]; other site
31964008645	HMMPfam hit to PF00929, Exonuclease, score 2e-13
31964008646	50S ribosomal protein L31 type B; Reviewed; Region: rpmE2; PRK01678
31964008647	HMMPfam hit to PF01197, Ribosomal protein L31,score 2.6e-19
31964008648	PS01143 Ribosomal protein L31 signature.
31964008649	ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]; Region: FepC; COG1120
31964008650	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
31964008651	Walker A/P-loop; other site
31964008652	ATP binding site [chemical binding]; other site
31964008653	Q-loop/lid; other site
31964008654	ABC transporter signature motif; other site
31964008655	Walker B; other site
31964008656	D-loop; other site
31964008657	H-loop/switch region; other site
31964008658	HMMPfam hit to PF00005, ABC transporter, score 2.8e-38
31964008659	PS00017 ATP/GTP-binding site motif A (P-loop).
31964008660	glycogen synthase, Corynebacterium family; Region: glgA_Coryne; TIGR02149
31964008661	This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to...; Region: GT1_YqgM_like; cd03801
31964008662	HMMPfam hit to PF00534, Glycosyl transferase, group 1, score 9.8e-26
31964008663	glucose-1-phosphate adenylyltransferase; Provisional; Region: glgC; PRK00844
31964008664	ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch; Region: ADP_Glucose_PP; cd02508
31964008665	ligand binding site; other site
31964008666	oligomer interface; other site
31964008667	Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase. It catalyzes the first committed and...; Region: LbH_G1P_AT_C; cd04651
31964008668	dimer interface [polypeptide binding]; other site
31964008669	N-terminal domain interface [polypeptide binding]; other site
31964008670	sulfate 1 binding site; other site
31964008671	HMMPfam hit to PF00483, Nucleotidyl transferase,score 2.1e-82
31964008672	PS00808 ADP-glucose pyrophosphorylase signature 1.
31964008673	PS00809 ADP-glucose pyrophosphorylase signature 2.
31964008674	PS00810 ADP-glucose pyrophosphorylase signature 3.
31964008675	phosphoserine phosphatase SerB; Region: serB; TIGR00338
31964008676	Haloacid dehalogenase-like hydrolases. The haloacid dehalogenase-like (HAD) superfamily includes L-2-haloacid dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, and many others; Region: HAD_like; cd01427
31964008677	motif II; other site
31964008678	HMMPfam hit to PF00702, Haloacid dehalogenase-like hydrolase, score 5.1e-24
31964008679	PS00044 Bacterial regulatory proteins, lysR family signature.
31964008680	Phosphotransferase enzyme family; Region: APH; pfam01636
31964008681	Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family. The APH/ChoK family is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs)...; Region: APH_ChoK_like; cd05120
31964008682	active site
31964008683	ATP binding site [chemical binding]; other site
31964008684	HMMPfam hit to PF01636, Aminoglycoside phosphotransferase, score 5.1e-22
31964008685	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
31964008686	3-oxoacyl-(acyl-carrier-protein) reductase; Region: 3oxo_ACP_reduc; TIGR01830
31964008687	NAD(P) binding site [chemical binding]; other site
31964008688	active site
31964008689	HMMPfam hit to PF00106, Short-chain dehydrogenase/reductase SDR, score 2.7e-73
31964008690	PS00038 Myc-type, 'helix-loop-helix' dimerization domain signature.
31964008691	Protein of unknown function (DUF3099); Region: DUF3099; pfam11298
31964008692	1 probable transmembrane helix predicted for CMS1967 by TMHMM2.0 at aa 46-68
31964008693	SURF1 superfamily. Surf1/Shy1 has been implicated in the posttranslational steps of the biogenesis of the mitochondrially-encoded Cox1 subunit of cytochrome c oxidase (complex IV). Cytochrome c oxidase (complex IV), the terminal electron-transferring...; Region: SURF1; cd06662
31964008694	2 probable transmembrane helices predicted for CMS1969 by TMHMM2.0 at aa 12-34 and 218-237
31964008695	ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only]; Region: Uup; COG0488
31964008696	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
31964008697	Walker A/P-loop; other site
31964008698	ATP binding site [chemical binding]; other site
31964008699	Q-loop/lid; other site
31964008700	ABC transporter signature motif; other site
31964008701	Walker B; other site
31964008702	D-loop; other site
31964008703	H-loop/switch region; other site
31964008704	ATP-binding cassette domain of elongation factor 3, subfamily F; Region: ABCF_EF-3; cd03221
31964008705	HMMPfam hit to PF00005, ABC transporter, score 4.9e-42
31964008706	PS00211 ABC transporters family signature.
31964008707	PS00017 ATP/GTP-binding site motif A (P-loop).
31964008708	HMMPfam hit to PF00005, ABC transporter, score 4.8e-43
31964008709	PS00211 ABC transporters family signature.
31964008710	PS00017 ATP/GTP-binding site motif A (P-loop).
31964008711	Predicted metal-sulfur cluster biosynthetic enzyme [General function prediction only]; Region: PaaD; COG2151
31964008712	HMMPfam hit to PF01883, Protein of unknown function DUF59, score 3.5e-22
31964008713	Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones]; Region: sufC; COG0396
31964008714	ABC-type transport system involved in Fe-S cluster assembly, ATPase component; Region: ABC_FeS_Assembly; cd03217
31964008715	Walker A/P-loop; other site
31964008716	ATP binding site [chemical binding]; other site
31964008717	Q-loop/lid; other site
31964008718	ABC transporter signature motif; other site
31964008719	Walker B; other site
31964008720	D-loop; other site
31964008721	H-loop/switch region; other site
31964008722	HMMPfam hit to PF00005, ABC transporter, score 2.4e-25
31964008723	PS00017 ATP/GTP-binding site motif A (P-loop).
31964008724	Rieske non-heme iron oxygenase (RO) family, Rieske ferredoxin component; composed of the Rieske ferredoxin component of some three-component RO systems including biphenyl dioxygenase (BPDO) and carbazole 1,9a-dioxygenase (CARDO). The RO family comprise a...; Region: Rieske_RO_ferredoxin; cd03528
31964008725	[2Fe-2S] cluster binding site [ion binding]; other site
31964008726	HMMPfam hit to PF00355, Rieske [2Fe-2S] region,score 1.9e-22
31964008727	FeS assembly protein SufD; Region: sufD; TIGR01981
31964008728	Uncharacterized protein family (UPF0051); Region: UPF0051; pfam01458
31964008729	HMMPfam hit to PF01458, SufBD, score 7.6e-28
31964008730	cysteine desulfurase activator complex subunit SufB; Provisional; Region: PRK11814; cl03223
31964008731	FeS assembly protein SufB; Region: sufB; TIGR01980
31964008732	HMMPfam hit to PF01458, SufBD, score 9.3e-128
31964008733	Cytochrome oxidase assembly protein; Region: COX15-CtaA; pfam02628
31964008734	Uncharacterized protein required for cytochrome oxidase assembly [Posttranslational modification, protein turnover, chaperones]; Region: CtaA; COG1612
31964008735	HMMPfam hit to PF02628, Cytochrome oxidase assembly, score 1.7e-11
31964008736	8 probable transmembrane helices predicted for CMS1976 by TMHMM2.0 at aa 27-49, 79-101, 108-130, 140-162,183-205, 225-242, 255-274 and 278-300
31964008737	protoheme IX farnesyltransferase; Provisional; Region: PRK04375
31964008738	UbiA prenyltransferase family; Region: UbiA; pfam01040
31964008739	9 probable transmembrane helices predicted for CMS1977 by TMHMM2.0 at aa 31-50, 55-77, 104-121, 126-145,152-171, 175-197, 218-235, 240-262 and 283-305
31964008740	HMMPfam hit to PF01040, UbiA prenyltransferase,score 1.5e-78
31964008741	PS00943 UbiA prenyltransferase family signature.
31964008742	Transketolase [Carbohydrate transport and metabolism]; Region: TktA; COG0021
31964008743	Thiamine pyrophosphate (TPP) family, Transketolase (TK) subfamily, TPP-binding module; TK catalyzes the transfer of a two-carbon unit from ketose phosphates to aldose phosphates. In heterotrophic organisms, TK provides a link between glycolysis and the...; Region: TPP_TK; cd02012
31964008744	TPP-binding site [chemical binding]; other site
31964008745	dimer interface [polypeptide binding]; other site
31964008746	Pyrimidine (PYR) binding domain of 1-deoxy-D-xylulose-5-phosphate synthase (DXS), transketolase (TK), and related proteins; Region: TPP_PYR_DXS_TK_like; cd07033
31964008747	PYR/PP interface [polypeptide binding]; other site
31964008748	dimer interface [polypeptide binding]; other site
31964008749	TPP binding site [chemical binding]; other site
31964008750	Transketolase, C-terminal domain; Region: Transketolase_C; pfam02780
31964008751	HMMPfam hit to PF00456, Transketolase, N terminal,score 3.2e-175
31964008752	PS00801 Transketolase signature 1.
31964008753	HMMPfam hit to PF02779, Transketolase, central region, score 5e-64
31964008754	PS00802 Transketolase signature 2.
31964008755	HMMPfam hit to PF02780, Transketolase, C terminal,score 1.6e-11
31964008756	Transaldolase-like proteins from plants and bacteria; Region: Transaldolase_like; cd00955
31964008757	putative active site [active]
31964008758	transaldolase; Provisional; Region: PRK03903
31964008759	catalytic residue [active]
31964008760	HMMPfam hit to PF00923, Transaldolase, score 2.6e-92
31964008761	PS01054 Transaldolase signature 1.
31964008762	PS00958 Transaldolase active site.
31964008763	bifunctional transaldolase/phosoglucose isomerase; Validated; Region: PRK09533
31964008764	Phosphoglucose isomerase (PGI) contains two SIS (Sugar ISomerase) domains. This classification is based on the alignment of the first SIS domain. PGI is a multifunctional enzyme which as an intracellular dimer catalyzes the reversible isomerization of...; Region: SIS_PGI_1; cd05015
31964008765	active site
31964008766	dimer interface [polypeptide binding]; other site
31964008767	SIS domain. SIS (Sugar ISomerase) domains are found in many phosphosugar isomerases and phosphosugar binding proteins. SIS domains are also found in proteins that regulate the expression of genes involved in synthesis of phosphosugars; Region: SIS; cl00389
31964008768	HMMPfam hit to PF00342, Phosphoglucose isomerase (PGI), score 3.4e-07
31964008769	glucose-6-phosphate 1-dehydrogenase; Validated; Region: PRK05722
31964008770	Glucose-6-phosphate dehydrogenase, NAD binding domain; Region: G6PD_N; pfam00479
31964008771	Glucose-6-phosphate dehydrogenase, C-terminal domain; Region: G6PD_C; pfam02781
31964008772	HMMPfam hit to PF00479, Glucose-6-phosphate dehydrogenase, score 5.1e-66
31964008773	PS00069 Glucose-6-phosphate dehydrogenase active site.
31964008774	HMMPfam hit to PF02781, Glucose-6-phosphate dehydrogenase, score 8.7e-144
31964008775	glucose-6-phosphate dehydrogenase assembly protein OpcA; Region: OpcA; TIGR00534
31964008776	Glucose-6-phosphate dehydrogenase subunit; Region: OpcA_G6PD_assem; pfam10128
31964008777	6-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminase [Carbohydrate transport and metabolism]; Region: NagB; COG0363
31964008778	6PGL: 6-Phosphogluconolactonase (6PGL) subfamily; 6PGL catalyzes the second step of the oxidative phase of the pentose phosphate pathway, the hydrolyzation of 6-phosphoglucono-1,5-lactone (delta form) to 6-phosphogluconate. 6PGL is thought to guard...; Region: 6PGL; cd01400
31964008779	putative active site [active]
31964008780	HMMPfam hit to PF01182,Glucosamine/galactosamine-6-phosphate isomerase, score 0.00047
31964008781	PS00144 Asparaginase / glutaminase active site signature 1.
31964008782	Domain of unknown function (DUF4109); Region: DUF4109; pfam13397
31964008783	preprotein translocase subunit SecG; Reviewed; Region: secG; PRK06870
31964008784	HMMPfam hit to PF03840, Preprotein translocase SecG subunit, score 3.5e-21
31964008785	2 probable transmembrane helices predicted for CMS1985 by TMHMM2.0 at aa 4-26 and 58-77
31964008786	Triosephosphate isomerase (TIM) is a glycolytic enzyme that catalyzes the interconversion of dihydroxyacetone phosphate and D-glyceraldehyde-3-phosphate. The reaction is very efficient and requires neither cofactors nor metal ions. TIM, usually...; Region: TIM; cd00311
31964008787	triosephosphate isomerase; Provisional; Region: PRK14567
31964008788	substrate binding site [chemical binding]; other site
31964008789	dimer interface [polypeptide binding]; other site
31964008790	catalytic triad [active]
31964008791	HMMPfam hit to PF00121, Triosephosphate isomerase,score 4e-96
31964008792	Phosphoglycerate kinase; Region: PGK; pfam00162
31964008793	Phosphoglycerate kinase (PGK) is a monomeric enzyme which catalyzes the transfer of the high-energy phosphate group of 1,3-bisphosphoglycerate to ADP, forming ATP and 3-phosphoglycerate. This reaction represents the first of the two substrate-level...; Region: Phosphoglycerate_kinase; cd00318
31964008794	substrate binding site [chemical binding]; other site
31964008795	hinge regions; other site
31964008796	ADP binding site [chemical binding]; other site
31964008797	catalytic site [active]
31964008798	HMMPfam hit to PF00162, Phosphoglycerate kinase,score 3.1e-198
31964008799	PS00111 Phosphoglycerate kinase signature.
31964008800	Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism]; Region: GapA; COG0057
31964008801	Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; Region: Gp_dh_N; pfam00044
31964008802	Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain; Region: Gp_dh_C; pfam02800
31964008803	HMMPfam hit to PF02800, Glyceraldehyde 3-phosphate dehydrogenase, score 4.1e-110
31964008804	PS00071 Glyceraldehyde 3-phosphate dehydrogenase active site.
31964008805	HMMPfam hit to PF00044, Glyceraldehyde 3-phosphate dehydrogenase, score 2e-94
31964008806	Superoxide dismutase [Inorganic ion transport and metabolism]; Region: SodA; COG0605
31964008807	Iron/manganese superoxide dismutases, alpha-hairpin domain; Region: Sod_Fe_N; pfam00081
31964008808	Iron/manganese superoxide dismutases, C-terminal domain; Region: Sod_Fe_C; pfam02777
31964008809	HMMPfam hit to PF02777, Manganese and iron superoxide dismutase, score 1.4e-57
31964008810	PS00088 Manganese and iron superoxide dismutases signature.
31964008811	HMMPfam hit to PF00081, Manganese and iron superoxide dismutase, score 1.1e-18
31964008812	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG1481
31964008813	Sporulation Regulator WhiA N terminal; Region: WhiA_N; pfam10298
31964008814	HMMPfam hit to PF02650, Protein of unknown function DUF199, score 8.6e-106
31964008815	glmZ(sRNA)-inactivating NTPase; Provisional; Region: PRK05416
31964008816	shikimate kinase; Reviewed; Region: aroK; PRK00131
31964008817	HMMPfam hit to PF03668, Uncharacterised P-loop ATPase protein UPF0042, score 3e-124
31964008818	excinuclease ABC subunit C; Validated; Region: uvrC; PRK00558
31964008819	Catalytic GIY-YIG domain of nucleotide excision repair endonucleases UvrC, Cho, and similar proteins; Region: GIY-YIG_UvrC_Cho; cd10434
31964008820	GIY-YIG motif/motif A; other site
31964008821	active site
31964008822	catalytic site [active]
31964008823	putative DNA binding site [nucleotide binding]; other site
31964008824	metal binding site [ion binding]; metal-binding site
31964008825	UvrC Helix-hairpin-helix N-terminal; Region: UvrC_HhH_N; pfam08459
31964008826	HMMPfam hit to PF02151, UvrB/UvrC protein, score 2.2e-08
31964008827	HMMPfam hit to PF01541, Excinuclease ABC, C subunit, N-terminal, score 4.5e-25
31964008828	excinuclease ABC subunit A; Reviewed; Region: uvrA; PRK00349
31964008829	ATP-binding cassette domain I of the excision repair protein UvrA; Region: ABC_UvrA_I; cd03270
31964008830	ATP-binding cassette domain I of the excision repair protein UvrA; Region: ABC_UvrA_I; cd03270
31964008831	ATP-binding cassette domain II of the excision repair protein UvrA; Region: ABC_UvrA_II; cd03271
31964008832	HMMPfam hit to PF00005, ABC transporter, score 4.9e-33
31964008833	PS00211 ABC transporters family signature.
31964008834	PS00017 ATP/GTP-binding site motif A (P-loop).
31964008835	HMMPfam hit to PF00005, ABC transporter, score 3.5e-07
31964008836	PS00211 ABC transporters family signature.
31964008837	PS00017 ATP/GTP-binding site motif A (P-loop).
31964008838	excinuclease ABC subunit B; Provisional; Region: PRK05298
31964008839	DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region; Region: DEXDc; cd00046
31964008840	Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may...; Region: HELICc; cd00079
31964008841	nucleotide binding region [chemical binding]; other site
31964008842	ATP-binding site [chemical binding]; other site
31964008843	Ultra-violet resistance protein B; Region: UvrB; pfam12344
31964008844	UvrB/uvrC motif; Region: UVR; pfam02151
31964008845	HMMPfam hit to PF02151, UvrB/UvrC protein, score 3e-10
31964008846	HMMPfam hit to PF00271, Helicase, C-terminal, score 3.4e-18
31964008847	PS00017 ATP/GTP-binding site motif A (P-loop).
31964008848	Dephospho-CoA kinase [Coenzyme metabolism]; Region: CoaE; COG0237
31964008849	Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.24) catalyzes the phosphorylation of dephosphocoenzyme A (dCoA) to yield CoA, which is the final step in CoA biosynthesis; Region: DPCK; cd02022
31964008850	CoA-binding site [chemical binding]; other site
31964008851	ATP-binding [chemical binding]; other site
31964008852	HMMPfam hit to PF01121, Dephospho-CoA kinase, score 2.7e-73
31964008853	PS01294 Uncharacterized protein family UPF0038 signature.
31964008854	PS00017 ATP/GTP-binding site motif A (P-loop).
31964008855	30S ribosomal protein S1; Reviewed; Region: rpsA; PRK07899
31964008856	S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture...; Region: S1_RPS1_repeat_ec1_hs1; cd05687
31964008857	RNA binding site [nucleotide binding]; other site
31964008858	S1_RPS1_repeat_ec2_hs2: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture...; Region: S1_RPS1_repeat_ec2_hs2; cd04465
31964008859	RNA binding site [nucleotide binding]; other site
31964008860	S1_like: Ribosomal protein S1-like RNA-binding domain. Found in a wide variety of RNA-associated proteins. Originally identified in S1 ribosomal protein. This superfamily also contains the Cold Shock Domain (CSD), which is a homolog of the S1 domain; Region: S1_like; cl09927
31964008861	RNA binding site [nucleotide binding]; other site
31964008862	S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain. PNPase  is a polyribonucleotide nucleotidyl transferase that degrades mRNA. It is a trimeric multidomain protein. The C-terminus contains the S1 domain which binds ssRNA; Region: S1_PNPase; cd04472
31964008863	RNA binding site [nucleotide binding]; other site
31964008864	domain interface; other site
31964008865	HMMPfam hit to PF00575, RNA binding S1, score 1.7e-26
31964008866	HMMPfam hit to PF00575, RNA binding S1, score 2e-32
31964008867	HMMPfam hit to PF00575, RNA binding S1, score 1.9e-18
31964008868	HMMPfam hit to PF00575, RNA binding S1, score 2.5e-18
31964008869	Bacterial protein of unknown function (DUF885); Region: DUF885; pfam05960
31964008870	HMMPfam hit to PF05960, Bacterial protein of unknown function DUF885, score 2e-109
31964008871	PTS_IIA, PTS system, fructose/mannitol specific IIA subunit. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. This...; Region: PTS_IIA_fru; cd00211
31964008872	active site
31964008873	phosphorylation site [posttranslational modification]
31964008874	HMMPfam hit to PF00359,Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2, score 3.2e-17
31964008875	PS00626 Regulator of chromosome condensation (RCC1) signature 2.
31964008876	PS00372 PTS EIIA domains phosphorylation site signature 2.
31964008877	DNA polymerase I; Provisional; Region: PRK05755
31964008878	PIN domain of the 5'-3' exonuclease of Taq DNA polymerase I and homologs; Region: PIN_53EXO; cd09859
31964008879	active site
31964008880	metal binding site 1 [ion binding]; metal-binding site
31964008881	putative 5' ssDNA interaction site; other site
31964008882	metal binding site 3; metal-binding site
31964008883	metal binding site 2 [ion binding]; metal-binding site
31964008884	H3TH domain of the 5'-3' exonuclease of Taq DNA polymerase I and homologs; Region: H3TH_53EXO; cd09898
31964008885	putative DNA binding site [nucleotide binding]; other site
31964008886	putative metal binding site [ion binding]; other site
31964008887	inactive DEDDy 3'-5' exonuclease domain of Bacillus stearothermophilus DNA polymerase I and similar family-A DNA polymerases; Region: DNA_polA_I_Bacillus_like_exo; cd06140
31964008888	Polymerase I functions primarily to fill DNA gaps that arise during DNA repair, recombination and replication; Region: DNA_pol_A_pol_I_C; cd08637
31964008889	active site
31964008890	DNA binding site [nucleotide binding]
31964008891	catalytic site [active]
31964008892	HMMPfam hit to PF00476, DNA-directed DNA polymerase, score 9e-158
31964008893	PS00447 DNA polymerase family A signature.
31964008894	HMMPfam hit to PF01367, 5'-3' exonuclease, score 2.7e-29
31964008895	HMMPfam hit to PF02739, 5'-3' exonuclease, score 3.8e-73
31964008896	PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria.  Although orthologs of PaaI exist in archaea and eukaryotes, their function has not...; Region: PaaI_thioesterase; cd03443
31964008897	CoenzymeA binding site [chemical binding]; other site
31964008898	subunit interaction site [polypeptide binding]; other site
31964008899	PHB binding site; other site
31964008900	HMMPfam hit to PF03061, Thioesterase superfamily,score 1.5e-12
31964008901	Homeodomain-like domain; Region: HTH_23; cl17451
31964008902	Winged helix-turn helix; Region: HTH_29; pfam13551
31964008903	Integrase core domain; Region: rve; pfam00665
31964008904	Integrase core domain; Region: rve_3; pfam13683
31964008905	Predicted helix-turn-helix motif with score 1316.000, SD 3.67 at aa 25-46, sequence WPVRRAAERFQCSPATASRWAR
31964008906	HMMPfam hit to PF00665, Integrase, catalytic region, score 3.7e-42
31964008907	Homeodomain-like domain; Region: HTH_23; cl17451
31964008908	Winged helix-turn helix; Region: HTH_29; pfam13551
31964008909	Integrase core domain; Region: rve; pfam00665
31964008910	Integrase core domain; Region: rve_3; pfam13683
31964008911	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.6e-38
31964008912	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964008913	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964008914	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964008915	Response regulator with putative antiterminator output domain [Signal transduction mechanisms]; Region: AmiR; COG3707
31964008916	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
31964008917	active site
31964008918	phosphorylation site [posttranslational modification]
31964008919	intermolecular recognition site; other site
31964008920	dimerization interface [polypeptide binding]; other site
31964008921	ANTAR domain; Region: ANTAR; pfam03861
31964008922	HMMPfam hit to PF03861, ANTAR, score 2.8e-22
31964008923	HMMPfam hit to PF00072, Response regulator receiver, score 9.9e-32
31964008924	pyruvate kinase; Provisional; Region: PRK06247
31964008925	Pyruvate kinase (PK):  Large allosteric enzyme that regulates glycolysis through binding of the substrate, phosphoenolpyruvate, and one or more allosteric effectors. Like other allosteric enzymes, PK has a high substrate affinity R state and a low...; Region: Pyruvate_Kinase; cl17342
31964008926	domain interfaces; other site
31964008927	active site
31964008928	HMMPfam hit to PF02887, Pyruvate kinase, score 4.3e-13
31964008929	PS00215 Mitochondrial energy transfer proteins signature.
31964008930	HMMPfam hit to PF00224, Pyruvate kinase, score 1.1e-140
31964008931	PS00110 Pyruvate kinase active site signature.
31964008932	glutamate synthase subunit beta; Reviewed; Region: gltD; PRK12810
31964008933	NAD(P)-binding Rossmann-like domain; Region: NAD_binding_8; pfam13450
31964008934	HMMPfam hit to PF00070, FAD-dependent pyridine nucleotide-disulphide oxidoreductase, score 1.8e-24
31964008935	PS00445 FGGY family of carbohydrate kinases signature 2.
31964008936	glutamate synthase subunit alpha; Provisional; Region: gltB; PRK11750
31964008937	Glutamine amidotransferases class-II (Gn-AT), glutamate synthase (GltS)-type. GltS is a homodimer that synthesizes L-glutamate from 2-oxoglutarate and L-glutamine, an important step in ammonia assimilation in bacteria, cyanobacteria and plants. The...; Region: GltS; cd00713
31964008938	active site
31964008939	dimer interface [polypeptide binding]; other site
31964008940	Glutamate synthase central domain; Region: Glu_syn_central; pfam04898
31964008941	Glutamate synthase (GltS) FMN-binding domain.  GltS is a complex iron-sulfur flavoprotein that catalyzes the reductive synthesis of L-glutamate from 2-oxoglutarate and L-glutamine via intramolecular channelling of ammonia, a reaction in the plant, yeast...; Region: GltS_FMN; cd02808
31964008942	active site
31964008943	FMN binding site [chemical binding]; other site
31964008944	substrate binding site [chemical binding]; other site
31964008945	3Fe-4S cluster binding site [ion binding]; other site
31964008946	gltb_C. This domain is found at the C-terminus of the large subunit (gltB) of glutamate synthase (GltS). GltS encodes a complex iron-sulfur flavoprotein that catalyzes the synthesis of L-glutamate from L-glutamine and 2-oxoglutarate. It requires the...; Region: gltB_C; cd00982
31964008947	domain interface; other site
31964008948	HMMPfam hit to PF01493, Glutamate synthase, alpha subunit, C-terminal, score 2.6e-77
31964008949	HMMPfam hit to PF01645, Ferredoxin-dependent glutamate synthase, score 1.4e-211
31964008950	HMMPfam hit to PF04898, Glutamate synthase,central, score 6.6e-167
31964008951	HMMPfam hit to PF04897, Glutamate synthase,amidotransferase region, score 6.8e-272
31964008952	prolipoprotein diacylglyceryl transferase; Reviewed; Region: PRK00052
31964008953	HMMPfam hit to PF01790, Prolipoprotein diacylglyceryl transferase, score 5.7e-67
31964008954	7 probable transmembrane helices predicted for CMS2007 by TMHMM2.0 at aa 33-55, 68-90, 105-127, 134-156,195-217, 224-243 and 253-275
31964008955	Ttryptophan synthase (TRPS) alpha subunit (TSA). TPRS is a bifunctional tetrameric enzyme (2 alpha and 2 beta subunits) that catalyzes the last two steps of L-tryptophan biosynthesis. Alpha and beta subunit catalyze two distinct reactions which are both...; Region: Tryptophan_synthase_alpha; cd04724
31964008956	substrate binding site [chemical binding]; other site
31964008957	active site
31964008958	catalytic residues [active]
31964008959	heterodimer interface [polypeptide binding]; other site
31964008960	HMMPfam hit to PF00290, Tryptophan synthase, alpha chain, score 5.2e-77
31964008961	tryptophan synthase, beta subunit; Region: trpB; TIGR00263
31964008962	Tryptophan synthase-beta:  Trptophan synthase is a bifunctional enzyme that catalyses the last two steps in the biosynthesis of L-tryptophan via its alpha and beta reactions. In the alpha reaction, indole 3-glycerol phosphate is cleaved reversibly to...; Region: Trp-synth_B; cd06446
31964008963	pyridoxal 5'-phosphate binding site [chemical binding]; other site
31964008964	catalytic residue [active]
31964008965	HMMPfam hit to PF00291,Pyridoxal-5'-phosphate-dependent enzyme, beta subunit,score 2.7e-119
31964008966	PS00168 Tryptophan synthase beta chain pyridoxal-phosphate attachment site.
31964008967	Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the...; Region: IGPS; cd00331
31964008968	active site
31964008969	ribulose/triose binding site [chemical binding]; other site
31964008970	phosphate binding site [ion binding]; other site
31964008971	substrate (anthranilate) binding pocket [chemical binding]; other site
31964008972	product (indole) binding pocket [chemical binding]; other site
31964008973	HMMPfam hit to PF00218, Indole-3-glycerol phosphate synthase, score 1.8e-80
31964008974	PS00614 Indole-3-glycerol phosphate synthase signature.
31964008975	2 probable transmembrane helices predicted for CMS2011 by TMHMM2.0 at aa 15-37 and 42-59
31964008976	Tryptophan-associated transmembrane protein (Trp_oprn_chp); Region: Trp_oprn_chp; cl17850
31964008977	4 probable transmembrane helices predicted for CMS2012 by TMHMM2.0 at aa 9-28, 48-70, 77-99 and 133-155
31964008978	anthranilate synthase component I; Provisional; Region: PRK13571
31964008979	Anthranilate synthase component I, N terminal region; Region: Anth_synt_I_N; pfam04715
31964008980	chorismate binding enzyme; Region: Chorismate_bind; pfam00425
31964008981	HMMPfam hit to PF00425, Anthranilate synthase component I and chorismate binding protein, score 1.6e-137
31964008982	HMMPfam hit to PF04715, Anthranilate synthase component I, N-terminal, score 4.5e-31
31964008983	phosphoribosyl-AMP cyclohydrolase; Reviewed; Region: hisI; PRK00051
31964008984	HMMPfam hit to PF01502, Phosphoribosyl-AMP cyclohydrolase, score 3.5e-42
31964008985	The cyclase subunit of imidazoleglycerol phosphate synthase (HisF). Imidazole glycerol phosphate synthase (IGPS) catalyzes the fifth step of histidine biosynthesis, the formation of the imidazole ring. IGPS converts N1-(5'-phosphoribulosyl)...; Region: HisF; cd04731
31964008986	Histidine biosynthesis protein; Region: His_biosynth; pfam00977
31964008987	substrate binding site [chemical binding]; other site
31964008988	glutamase interaction surface [polypeptide binding]; other site
31964008989	HMMPfam hit to PF00977, Histidine biosynthesis protein, score 1.7e-115
31964008990	ATP phosphoribosyltransferase; Reviewed; Region: hisG; PRK00489
31964008991	ATP phosphoribosyltransferase; Region: hisG; TIGR00070
31964008992	ATP phosphoribosyltransferase, C-terminal domain; Region: HisG_C-term; TIGR03455
31964008993	HMMPfam hit to PF01634, ATP phosphoribosyltransferase, score 1.2e-52
31964008994	PS01316 ATP phosphoribosyltransferase signature.
31964008995	Nucleoside Triphosphate Pyrophosphohydrolase (EC 3.6.1.8) MazG-like domain found in Mycobacterium tuberculosis phosphoribosyl-ATP pyrophosphohydrolase (HisE or PRATP-PH) and its bacterial homologs; Region: NTP-PPase_HisE; cd11547
31964008996	homodimer interface [polypeptide binding]; other site
31964008997	putative metal binding site [ion binding]; other site
31964008998	HMMPfam hit to PF01503, Phosphoribosyl-ATP pyrophosphohydrolase, score 1.7e-07
31964008999	HMMPfam hit to PF00254, Peptidylprolyl isomerase,FKBP-type, score 0.0014
31964009000	PS00454 FKBP-type peptidyl-prolyl cis-trans isomerase signature 2.
31964009001	Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism]; Region: Rpe; COG0036
31964009002	Ribulose-5-phosphate 3-epimerase (RPE). This enzyme catalyses the interconversion of D-ribulose 5-phosphate (Ru5P) into D-xylulose 5-phosphate, as part of the Calvin cycle (reductive pentose phosphate pathway) in chloroplasts and in the oxidative pentose...; Region: RPE; cd00429
31964009003	substrate binding site [chemical binding]; other site
31964009004	hexamer interface [polypeptide binding]; other site
31964009005	metal binding site [ion binding]; metal-binding site
31964009006	HMMPfam hit to PF00834, Ribulose-phosphate 3-epimerase, score 1.9e-105
31964009007	PS01086 Ribulose-phosphate 3-epimerase family signature 2.
31964009008	PS01085 Ribulose-phosphate 3-epimerase family signature 1.
31964009009	RNA binding domain of NusB (N protein-Utilization Substance B) and Sun (also known as RrmB or Fmu) proteins. This family includes two orthologous groups exemplified by the transcription termination factor NusB and the N-terminal domain of the...; Region: NusB_Sun; cl00223
31964009010	putative RNA binding site [nucleotide binding]; other site
31964009011	16S rRNA methyltransferase B; Provisional; Region: PRK14902
31964009012	NOL1/NOP2/sun family putative RNA methylase; Region: nop2p; TIGR00446
31964009013	HMMPfam hit to PF01189, Bacterial Fmu (Sun)/eukaryotic nucleolar NOL1/Nop2p, score 3.3e-42
31964009014	PS01153 NOL1/NOP2/sun family signature.
31964009015	HMMPfam hit to PF01029, Antitermination protein NusB, score 1.5e-27
31964009016	methionyl-tRNA formyltransferase; Reviewed; Region: fmt; PRK00005
31964009017	Methionyl-tRNA formyltransferase, N-terminal hydrolase domain; Region: FMT_core_Met-tRNA-FMT_N; cd08646
31964009018	putative active site [active]
31964009019	substrate binding site [chemical binding]; other site
31964009020	putative cosubstrate binding site; other site
31964009021	catalytic site [active]
31964009022	C-terminal domain of Formyltransferase and other enzymes; Region: Met_tRNA_FMT_C; cd08704
31964009023	substrate binding site [chemical binding]; other site
31964009024	HMMPfam hit to PF02911, Formyl transferase,C-terminal, score 4.8e-26
31964009025	HMMPfam hit to PF00551, Formyl transferase,N-terminal, score 5.3e-31
31964009026	primosome assembly protein PriA; Provisional; Region: PRK14873
31964009027	S-adenosylmethionine synthetase; Validated; Region: PRK05250
31964009028	S-adenosylmethionine synthetase, N-terminal domain; Region: S-AdoMet_synt_N; pfam00438
31964009029	S-adenosylmethionine synthetase, central domain; Region: S-AdoMet_synt_M; pfam02772
31964009030	S-adenosylmethionine synthetase, C-terminal domain; Region: S-AdoMet_synt_C; pfam02773
31964009031	HMMPfam hit to PF02773, S-adenosylmethionine synthetase, score 2.6e-79
31964009032	PS00377 S-adenosylmethionine synthetase signature 2.
31964009033	HMMPfam hit to PF02772, S-adenosylmethionine synthetase, score 7.4e-54
31964009034	PS00376 S-adenosylmethionine synthetase signature 1.
31964009035	HMMPfam hit to PF00438, S-adenosylmethionine synthetase, score 1e-50
31964009036	Flavoprotein; Region: Flavoprotein; pfam02441
31964009037	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated; Region: PRK05579
31964009038	DNA / pantothenate metabolism flavoprotein; Region: DFP; pfam04127
31964009039	HMMPfam hit to PF04127, DNA/pantothenate metabolism flavoprotein, C-terminal, score 5e-33
31964009040	HMMPfam hit to PF02441, Flavoprotein, score 1.4e-37
31964009041	DNA-directed RNA polymerase subunit omega; Reviewed; Region: rpoZ; PRK00392
31964009042	HMMPfam hit to PF01192, RNA polymerase Rpb6, score 6e-13
31964009043	Guanylate kinase [Nucleotide transport and metabolism]; Region: Gmk; COG0194
31964009044	Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), also known as guanylate kinase (GKase), catalyzes the reversible phosphoryl transfer from adenosine triphosphate (ATP) to guanosine monophosphate (GMP) to yield adenosine diphosphate (ADP) and guanosine...; Region: GMPK; cd00071
31964009045	catalytic site [active]
31964009046	G-X2-G-X-G-K; other site
31964009047	HMMPfam hit to PF00625, Guanylate kinase, score 1.2e-33
31964009048	PS00856 Guanylate kinase signature.
31964009049	Orotidine 5'-phosphate decarboxylase (ODCase) is a dimeric enzyme that decarboxylates orotidine 5'-monophosphate (OMP) to form uridine 5'-phosphate (UMP), an essential step in the pyrimidine biosynthetic pathway. In mammals, UMP synthase...; Region: OMP_decarboxylase_like; cd04725
31964009050	active site
31964009051	dimer interface [polypeptide binding]; other site
31964009052	HMMPfam hit to PF00215, Orotidine 5'-phosphate decarboxylase, score 1.4e-34
31964009053	PS00156 Orotidine 5'-phosphate decarboxylase active site.
31964009054	carbamoyl phosphate synthase large subunit; Reviewed; Region: carB; PRK05294
31964009055	Carbamoyl-phosphate synthase L chain, N-terminal domain; Region: CPSase_L_chain; pfam00289
31964009056	ATP-grasp domain; Region: ATP-grasp_4; cl17255
31964009057	Carbamoyl-phosphate synthetase large chain, oligomerisation domain; Region: CPSase_L_D3; pfam02787
31964009058	Carbamoyl-phosphate synthase L chain, N-terminal domain; Region: CPSase_L_chain; pfam00289
31964009059	ATP-grasp domain; Region: ATP-grasp_4; cl17255
31964009060	Methylglyoxal synthase-like domain from type II glutamine-dependent carbamoyl phosphate synthetase (CSP). CSP, a CarA and CarB heterodimer, catalyzes the production of carbamoyl phosphate which is subsequently employed in the metabolic pathways...; Region: MGS_CPS_II; cd01424
31964009061	IMP binding site; other site
31964009062	dimer interface [polypeptide binding]; other site
31964009063	interdomain contacts; other site
31964009064	partial ornithine binding site; other site
31964009065	HMMPfam hit to PF02142, Methylglyoxal synthase-like, score 3e-23
31964009066	HMMPfam hit to PF02786, Carbamoyl-phosphate synthase L chain, ATP-binding, score 1.1e-13
31964009067	PS00867 Carbamoyl-phosphate synthase subdomain signature 2.
31964009068	PS00866 Carbamoyl-phosphate synthase subdomain signature 1.
31964009069	HMMPfam hit to PF00289, Carbamoyl-phosphate synthetase large chain, N-terminal, score 1e-18
31964009070	HMMPfam hit to PF02787, Carbamoyl-phosphate synthetase large chain, oligomerisation, score 1.7e-47
31964009071	HMMPfam hit to PF02786, Carbamoyl-phosphate synthase L chain, ATP-binding, score 7.4e-112
31964009072	PS00867 Carbamoyl-phosphate synthase subdomain signature 2.
31964009073	PS00866 Carbamoyl-phosphate synthase subdomain signature 1.
31964009074	HMMPfam hit to PF00289, Carbamoyl-phosphate synthetase large chain, N-terminal, score 2.8e-55
31964009075	carbamoyl phosphate synthase small subunit; Reviewed; Region: PRK12564
31964009076	Carbamoyl-phosphate synthase small chain, CPSase domain; Region: CPSase_sm_chain; smart01097
31964009077	Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II; Region: GATase1_CPSase; cd01744
31964009078	catalytic site [active]
31964009079	subunit interface [polypeptide binding]; other site
31964009080	HMMPfam hit to PF00117, Glutamine amidotransferase class-I, score 7.8e-46
31964009081	PS00442 Glutamine amidotransferases class-I active site.
31964009082	HMMPfam hit to PF00988, Carbamoyl-phosphate synthase, small chain, score 2.3e-71
31964009083	1 probable transmembrane helix predicted for CMS2031 by TMHMM2.0 at aa 4-26
31964009084	dihydroorotase; Validated; Region: pyrC; PRK09357
31964009085	Superfamily of metallo-dependent hydrolases (also called amidohydrolase superfamily) is a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site. The vast majority of the members have a...; Region: metallo-dependent_hydrolases; cl00281
31964009086	Dihydroorotase (DHOase), subgroup IIa; DHOases catalyze the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in pyrimidine biosynthesis. This subgroup also contains proteins that lack the active site, like unc-33, a C; Region: DHOase_IIa; cd01317
31964009087	active site
31964009088	HMMPfam hit to PF01979, Amidohydrolase, score 4.5e-14
31964009089	PS00483 Dihydroorotase signature 2.
31964009090	PS00482 Dihydroorotase signature 1.
31964009091	aspartate carbamoyltransferase catalytic subunit; Provisional; Region: pyrB; PRK00856
31964009092	Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain; Region: OTCace_N; pfam02729
31964009093	Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain; Region: OTCace; pfam00185
31964009094	HMMPfam hit to PF00185, Aspartate/ornithine carbamoyltransferase, Asp/Orn-binding region, score 7.8e-12
31964009095	HMMPfam hit to PF02729, Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain, score 8.8e-51
31964009096	PS00097 Aspartate and ornithine carbamoyltransferases signature.
31964009097	Pyrimidine operon attenuation protein/uracil phosphoribosyltransferase [Nucleotide transport and metabolism]; Region: PyrR; COG2065
31964009098	Phosphoribosyl transferase (PRT)-type I domain; Region: PRTases_typeI; cd06223
31964009099	active site
31964009100	HMMPfam hit to PF00156, Phosphoribosyltransferase,score 2.1e-10
31964009101	acetyl-CoA synthetase; Provisional; Region: PRK00174
31964009102	Adenylate forming domain, Class I; Region: AFD_class_I; cl17068
31964009103	acyl-activating enzyme (AAE) consensus motif; other site
31964009104	AMP binding site [chemical binding]; other site
31964009105	active site
31964009106	CoA binding site [chemical binding]; other site
31964009107	HMMPfam hit to PF00501, AMP-dependent synthetase and ligase, score 1.2e-122
31964009108	PS00455  AMP-binding domain signature.
31964009109	ABC-type nitrate/sulfonate/bicarbonate transport system, permease component [Inorganic ion transport and metabolism]; Region: TauC; COG0600
31964009110	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964009111	dimer interface [polypeptide binding]; other site
31964009112	conserved gate region; other site
31964009113	putative PBP binding loops; other site
31964009114	ABC-ATPase subunit interface; other site
31964009115	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 4.6e-22
31964009116	7 probable transmembrane helices predicted for CMS2036 by TMHMM2.0 at aa 49-71, 104-126, 138-160,165-187, 200-222, 227-249 and 261-283
31964009117	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964009118	ABC transporter, substrate-binding protein, aliphatic sulfonates family; Region: SsuA_fam; TIGR01728
31964009119	Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of  substrates, such as, amino acids, peptides, sugars, vitamins and inorganic...; Region: PBPb; cd00134
31964009120	substrate binding pocket [chemical binding]; other site
31964009121	membrane-bound complex binding site; other site
31964009122	hinge residues; other site
31964009123	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
31964009124	Walker A/P-loop; other site
31964009125	ATP binding site [chemical binding]; other site
31964009126	ABC transporter; Region: ABC_tran; pfam00005
31964009127	Q-loop/lid; other site
31964009128	ABC transporter signature motif; other site
31964009129	Walker B; other site
31964009130	D-loop; other site
31964009131	H-loop/switch region; other site
31964009132	HMMPfam hit to PF00005, ABC transporter, score 3.2e-57
31964009133	PS00211 ABC transporters family signature.
31964009134	PS00017 ATP/GTP-binding site motif A (P-loop).
31964009135	Lamin Tail Domain; Region: LTD; pfam00932
31964009136	1 probable transmembrane helix predicted for CMS2039 by TMHMM2.0 at aa 478-500
31964009137	transcription antitermination factor NusB; Region: nusB; TIGR01951
31964009138	putative RNA binding site [nucleotide binding]; other site
31964009139	HMMPfam hit to PF01029, Antitermination protein NusB, score 2.5e-34
31964009140	elongation factor P; Validated; Region: PRK00529
31964009141	Elongation factor P (EF-P) KOW-like domain; Region: EFP_N; pfam08207
31964009142	S1_EF-P_repeat_1: Translation elongation factor P (EF-P), S1-like RNA-binding domain, repeat 1. EF-P stimulates the peptidyltransferase activity in the prokaryotic 70S ribosome. EF-P enhances the synthesis of certain dipeptides with...; Region: S1_EF-P_repeat_1; cd04470
31964009143	RNA binding site [nucleotide binding]; other site
31964009144	S1_EF-P_repeat_2: Translation elongation factor P (EF-P), S1-like RNA-binding domain, repeat 1. EF-P stimulates the peptidyltransferase activity in the prokaryotic 70S ribosome. EF-P enhances the synthesis of certain dipeptides with...; Region: S1_EF-P_repeat_2; cd05794
31964009145	RNA binding site [nucleotide binding]; other site
31964009146	HMMPfam hit to PF01132, Elongation factor P (EF-P),score 2.1e-99
31964009147	PS01275 Elongation factor P signature.
31964009148	Dehydroquinase class II; Region: DHquinase_II; pfam01220
31964009149	Dehydroquinase (DHQase), type II. Dehydroquinase (or 3-dehydroquinate dehydratase) catalyzes the reversible dehydration of 3-dehydroquinate to form 3-dehydroshikimate. This reaction is part of two metabolic pathways: the biosynthetic shikimate pathway...; Region: DHQase_II; cd00466
31964009150	trimer interface [polypeptide binding]; other site
31964009151	active site
31964009152	dimer interface [polypeptide binding]; other site
31964009153	HMMPfam hit to PF01220, Dehydroquinase, class II,score 3.1e-62
31964009154	PS01029 Dehydroquinase class II signature.
31964009155	Homeodomain-like domain; Region: HTH_23; cl17451
31964009156	Winged helix-turn helix; Region: HTH_29; pfam13551
31964009157	Integrase core domain; Region: rve; pfam00665
31964009158	Integrase core domain; Region: rve_3; pfam13683
31964009159	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.6e-38
31964009160	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964009161	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964009162	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964009163	thiamine monophosphate kinase; Provisional; Region: PRK05731
31964009164	ThiL (Thiamine-monophosphate kinase) plays a dual role in de novo biosynthesis and in salvage of exogenous thiamine. Thiamine salvage occurs in two steps, with thiamine kinase catalyzing the formation of thiamine phosphate, and ThiL catalyzing the...; Region: ThiL; cd02194
31964009165	ATP binding site [chemical binding]; other site
31964009166	dimerization interface [polypeptide binding]; other site
31964009167	Protein of unknown function (DUF3515); Region: DUF3515; pfam12028
31964009168	1 probable transmembrane helix predicted for CMS2045 by TMHMM2.0 at aa 12-34
31964009169	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964009170	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold; Region: Glyco_tranf_GTA_type; cd00761
31964009171	active site
31964009172	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold; Region: Glyco_tranf_GTA_type; cl11394
31964009173	HMMPfam hit to PF00535, Glycosyl transferase,family 2, score 3.7e-25
31964009174	D-alanyl-alanine synthetase A; Reviewed; Region: ddl; PRK01966
31964009175	D-ala D-ala ligase N-terminus; Region: Dala_Dala_lig_N; pfam01820
31964009176	ATP-grasp domain; Region: ATP-grasp_4; cl17255
31964009177	HMMPfam hit to PF07478, D-alanine--D-alanine ligase, C-terminal, score 6.2e-95
31964009178	PS00844 D-alanine--D-alanine ligase signature 2.
31964009179	HMMPfam hit to PF01820, D-alanine--D-alanine ligase, N-terminal, score 2.9e-49
31964009180	PS00843 D-alanine--D-alanine ligase signature 1.
31964009181	NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated; Region: gpsA; PRK00094
31964009182	NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; Region: NAD_Gly3P_dh_N; pfam01210
31964009183	NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus; Region: NAD_Gly3P_dh_C; pfam07479
31964009184	HMMPfam hit to PF07479, NAD-dependent glycerol-3-phosphate dehydrogenase, C-terminal, score 2.1e-62
31964009185	HMMPfam hit to PF01210, NAD-dependent glycerol-3-phosphate dehydrogenase, N-terminal, score 7.1e-67
31964009186	1-acyl-sn-glycerol-3-phosphate acyltransferase [Lipid metabolism]; Region: PlsC; COG0204
31964009187	Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: AGPAT-like; Region: LPLAT_AGPAT-like; cd07989
31964009188	putative acyl-acceptor binding pocket; other site
31964009189	HMMPfam hit to PF01553, Phospholipid/glycerol acyltransferase, score 4.3e-37
31964009190	UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Region: murA; TIGR01072
31964009191	UDP-N-acetylglucosamine enolpyruvyl transferase catalyzes enolpyruvyl transfer as part of the first step in the biosynthesis of peptidoglycan, a component of the bacterial cell wall. The reaction is phosphoenolpyruvate + UDP-N-acetyl-D-glucosamine =...; Region: UdpNAET; cd01555
31964009192	hinge; other site
31964009193	active site
31964009194	HMMPfam hit to PF00275, EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase), score 1.4e-65
31964009195	isopropylmalate isomerase small subunit; Provisional; Region: leuD; PRK01641
31964009196	Aconatase-like swivel domain of 3-isopropylmalate dehydratase and related uncharacterized proteins. 3-isopropylmalate dehydratase catalyzes the isomerization between 2-isopropylmalate and 3-isopropylmalate, via the formation of 2-isopropylmaleate...; Region: IPMI_Swivel; cd01577
31964009197	substrate binding site [chemical binding]; other site
31964009198	HMMPfam hit to PF00694, Aconitate hydratase,C-terminal, score 2.4e-36
31964009199	3-isopropylmalate dehydratase large subunit; Reviewed; Region: PRK00402
31964009200	3-isopropylmalate dehydratase catalyzes the isomerization between 2-isopropylmalate and 3-isopropylmalate; Region: IPMI; cd01583
31964009201	substrate binding site [chemical binding]; other site
31964009202	ligand binding site [chemical binding]; other site
31964009203	HMMPfam hit to PF00330, Aconitate hydratase,N-terminal, score 2.3e-233
31964009204	PS01244 Aconitase family signature 2.
31964009205	PS00450 Aconitase family signature 1.
31964009206	Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence...; Region: PP2Cc; cd00143
31964009207	active site
31964009208	HMMPfam hit to PF00481, Protein phosphatase 2C-like, score 0.0011
31964009209	integral membrane protein, TerC family; Region: R_switched_Alx; TIGR03718
31964009210	9 probable transmembrane helices predicted for CMS2054 by TMHMM2.0 at aa 10-29, 42-64, 70-92, 105-125,130-147, 191-209, 224-246, 253-275 and 295-317
31964009211	HMMPfam hit to PF03741, Integral membrane protein TerC, score 2.2e-72
31964009212	Transcriptional regulator [Transcription]; Region: AcrR; COG1309
31964009213	Bacterial regulatory proteins, tetR family; Region: TetR_N; pfam00440
31964009214	HMMPfam hit to PF00440, Bacterial regulatory protein, TetR, score 9.1e-14
31964009215	Predicted helix-turn-helix motif with score 1214.000, SD 3.32 at aa 58-79, sequence VSARRIAAAAGVDPSLVRYYFG
31964009216	Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only]; Region: COG4221
31964009217	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
31964009218	NAD(P) binding site [chemical binding]; other site
31964009219	active site
31964009220	HMMPfam hit to PF00106, Short-chain dehydrogenase/reductase SDR, score 2.7e-46
31964009221	PS00061 Short-chain dehydrogenases/reductases family signature.
31964009222	O-acetylhomoserine aminocarboxypropyltransferase; Validated; Region: PRK07812
31964009223	CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis. This pathway is unique to microorganisms and plants, rendering the enzyme an attractive target for the development of...; Region: CGS_like; cd00614
31964009224	homodimer interface [polypeptide binding]; other site
31964009225	substrate-cofactor binding pocket; other site
31964009226	pyridoxal 5'-phosphate binding site [chemical binding]; other site
31964009227	catalytic residue [active]
31964009228	HMMPfam hit to PF01053, Cys/Met metabolism pyridoxal-phosphate-dependent enzymes, score 1.2e-210
31964009229	PS00868 Cys/Met metabolism enzymes pyridoxal-phosphate attachment site.
31964009230	homoserine O-acetyltransferase; Provisional; Region: metX; PRK00175
31964009231	homoserine O-acetyltransferase; Region: homoserO_Ac_trn; TIGR01392
31964009232	HMMPfam hit to PF00561, Alpha/beta hydrolase fold,score 7.2e-16
31964009233	Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription]; Region: CitB; COG2197
31964009234	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
31964009235	active site
31964009236	phosphorylation site [posttranslational modification]
31964009237	intermolecular recognition site; other site
31964009238	dimerization interface [polypeptide binding]; other site
31964009239	Sigma-70, region 4; Region: Sigma70_r4_2; pfam08281
31964009240	HMMPfam hit to PF00072, Response regulator receiver, score 9.5e-07
31964009241	Predicted helix-turn-helix motif with score 1576.000, SD 4.55 at aa 195-216, sequence RSVRDVAEAMSTTEETVKSYIK
31964009242	Signal transduction histidine kinase [Signal transduction mechanisms]; Region: COG4585
31964009243	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; Region: HATPase_c; pfam02518
31964009244	ATP binding site [chemical binding]; other site
31964009245	Mg2+ binding site [ion binding]; other site
31964009246	G-X-G motif; other site
31964009247	6 probable transmembrane helices predicted for CMS2060 by TMHMM2.0 at aa 54-76, 80-99, 106-125, 130-149,156-178 and 183-205
31964009248	HMMPfam hit to PF02518, ATP-binding region,ATPase-like, score 0.0054
31964009249	5 probable transmembrane helices predicted for CMS2061 by TMHMM2.0 at aa 29-51, 64-86, 96-118, 131-153 and 168-186
31964009250	Homeodomain-like domain; Region: HTH_23; cl17451
31964009251	Winged helix-turn helix; Region: HTH_29; pfam13551
31964009252	Integrase core domain; Region: rve; pfam00665
31964009253	Integrase core domain; Region: rve_3; pfam13683
31964009254	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964009255	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964009256	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964009257	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.6e-38
31964009258	Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription]; Region: CitB; COG2197
31964009259	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cl17736
31964009260	active site
31964009261	dimerization interface [polypeptide binding]; other site
31964009262	C-terminal DNA-binding domain of LuxR-like proteins. This domain contains a helix-turn-helix motif and binds DNA. Proteins belonging to this group are response regulators; some act as transcriptional activators, others as transcriptional repressors. Many...; Region: LuxR_C_like; cd06170
31964009263	DNA binding residues [nucleotide binding]
31964009264	dimerization interface [polypeptide binding]; other site
31964009265	HMMPfam hit to PF00072, Response regulator receiver, score 1.5e-06
31964009266	HMMPfam hit to PF00196, Bacterial regulatory protein, LuxR, score 6.4e-06
31964009267	Predicted helix-turn-helix motif with score 1171.000, SD 3.18 at aa 152-173, sequence EPVKSVAYSLGISEETAKSYLK
31964009268	Arabinose efflux permease [Carbohydrate transport and metabolism]; Region: AraJ; COG2814
31964009269	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
31964009270	putative substrate translocation pore; other site
31964009271	11 probable transmembrane helices predicted for CMS2064 by TMHMM2.0 at aa 41-63, 70-89, 94-116, 129-151,156-178, 199-221, 236-258, 265-284, 289-311, 332-354 and 358-377
31964009272	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964009273	Domain of unknown function DUF77; Region: DUF77; pfam01910
31964009274	HMMPfam hit to PF01910, Protein of unknown function DUF77, score 1.4e-22
31964009275	YceI-like domain; Region: YceI; pfam04264
31964009276	1 probable transmembrane helix predicted for CMS2066 by TMHMM2.0 at aa 7-26
31964009277	B.subtilis YXKO protein of unknown function and related proteins. Based on the conservation of the ATP binding site, the substrate binding site and the Mg2+binding site and structural homology this group is a member of the ribokinase-like superfamily; Region: YXKO-related; cd01171
31964009278	putative substrate binding site [chemical binding]; other site
31964009279	putative ATP binding site [chemical binding]; other site
31964009280	HMMPfam hit to PF01256, Protein of unknown function UPF0031, score 6.2e-30
31964009281	NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion]; Region: NemA; COG1902
31964009282	Old yellow enzyme (OYE) YqjM-like FMN binding domain. YqjM is involved in the oxidative stress response of Bacillus subtilis.  Like the other OYE members, each monomer of YqjM contains FMN as a non-covalently bound cofactor and uses NADPH as a reducing...; Region: OYE_YqiM_FMN; cd02932
31964009283	active site
31964009284	FMN binding site [chemical binding]; other site
31964009285	substrate binding site [chemical binding]; other site
31964009286	homotetramer interface [polypeptide binding]; other site
31964009287	catalytic residue [active]
31964009288	HMMPfam hit to PF00724, NADH:flavin oxidoreductase/NADH oxidase, score 4.3e-84
31964009289	Hemolysins and related proteins containing CBS domains [General function prediction only]; Region: TlyC; COG1253
31964009290	Domain of unknown function DUF21; Region: DUF21; pfam01595
31964009291	This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain. CorC_HlyC is a transporter associated domain. This small domain is found in Na+/H+ antiporters, in proteins involved in...; Region: CBS_pair_CorC_HlyC_assoc; cd04590
31964009292	HMMPfam hit to PF00571, CBS, score 0.018
31964009293	HMMPfam hit to PF00571, CBS, score 8.7e-09
31964009294	HMMPfam hit to PF01595, Protein of unknown function DUF21, score 1.4e-57
31964009295	2 probable transmembrane helices predicted for CMS2069 by TMHMM2.0 at aa 45-67 and 87-109
31964009296	Hemolysins and related proteins containing CBS domains [General function prediction only]; Region: TlyC; COG1253
31964009297	Domain of unknown function DUF21; Region: DUF21; pfam01595
31964009298	This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain. CorC_HlyC is a transporter associated domain. This small domain is found in Na+/H+ antiporters, in proteins involved in...; Region: CBS_pair_CorC_HlyC_assoc; cd04590
31964009299	Transporter associated domain; Region: CorC_HlyC; smart01091
31964009300	HMMPfam hit to PF03471, Transporter-associated region, score 8.1e-18
31964009301	HMMPfam hit to PF00571, CBS, score 8.7e-08
31964009302	HMMPfam hit to PF00571, CBS, score 2.7e-07
31964009303	HMMPfam hit to PF01595, Protein of unknown function DUF21, score 3e-56
31964009304	3 probable transmembrane helices predicted for CMS2070 by TMHMM2.0 at aa 5-27, 64-86 and 98-120
31964009305	HMMPfam hit to PF00478, IMP dehydrogenase/GMP reductase, score 1.8e-117
31964009306	alpha-ketoglutarate decarboxylase; Reviewed; Region: kgd; PRK12270
31964009307	2-oxoacid dehydrogenases acyltransferase (catalytic domain); Region: 2-oxoacid_dh; pfam00198
31964009308	Thiamine pyrophosphate (TPP) family, E1 of OGDC-like subfamily, TPP-binding module; composed of proteins similar to the E1 component of the 2-oxoglutarate dehydrogenase multienzyme complex (OGDC). OGDC catalyzes the oxidative decarboxylation of...; Region: TPP_E1_OGDC_like; cd02016
31964009309	TPP-binding site [chemical binding]; other site
31964009310	Transketolase, pyrimidine binding domain; Region: Transket_pyr; pfam02779
31964009311	HMMPfam hit to PF00198, Catalytic domain of components of various dehydrogenase complexes, score 2e-58
31964009312	HMMPfam hit to PF00676, Dehydrogenase, E1 component, score 1.1e-43
31964009313	HMMPfam hit to PF02779, Transketolase, central region, score 2.7e-61
31964009314	Acetyltransferase (GNAT) family; Region: Acetyltransf_1; pfam00583
31964009315	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 1.3e-11
31964009316	mycothiol system anti-sigma-R factor; Region: antisig_RsrA; cl15806
31964009317	RNA polymerase sigma-70 factor, TIGR02947 family; Region: SigH_actino
31964009318	Sigma-70 region 2; Region: Sigma70_r2; pfam04542
31964009319	Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs). A SF is a dissociable subunit of RNA polymerase, it directs bacterial or...; Region: Sigma70_r4; cd06171
31964009320	DNA binding residues [nucleotide binding]
31964009321	HMMPfam hit to PF04545, Sigma-70 region 4, score 6.3e-14
31964009322	Predicted helix-turn-helix motif with score 1199.000, SD 3.27 at aa 168-189, sequence FSYQEIADIMKTPVGTVMSRLH
31964009323	HMMPfam hit to PF04542, Sigma-70 region 2, score 4.5e-18
31964009324	PS01063 Sigma-70 factors ECF subfamily signature.
31964009325	3-phosphoshikimate 1-carboxyvinyltransferase; Provisional; Region: PRK02427
31964009326	EPSP synthase domain. 3-phosphoshikimate 1-carboxyvinyltransferase (5-enolpyruvylshikimate-3-phosphate synthase) (EC 2.5.1.19) catalyses the reaction between shikimate-3-phosphate (S3P) and phosphoenolpyruvate (PEP) to form...; Region: EPSP_synthase; cd01556
31964009327	hinge; other site
31964009328	active site
31964009329	HMMPfam hit to PF00275, EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase), score 1.8e-107
31964009330	Predicted GTPases [General function prediction only]; Region: COG1162
31964009331	Ribosomal interacting GTPase YjeQ/EngC, a circularly permuted subfamily of the Ras GTPases; Region: YjeQ_EngC; cd01854
31964009332	GTPase/Zn-binding domain interface [polypeptide binding]; other site
31964009333	GTP/Mg2+ binding site [chemical binding]; other site
31964009334	G4 box; other site
31964009335	G5 box; other site
31964009336	G1 box; other site
31964009337	Switch I region; other site
31964009338	G2 box; other site
31964009339	G3 box; other site
31964009340	Switch II region; other site
31964009341	HMMPfam hit to PF03193, Protein of unknown function DUF258, score 1.5e-61
31964009342	PS00017 ATP/GTP-binding site motif A (P-loop).
31964009343	Archaeal fructose-1,6-bisphosphatase and related enzymes of inositol monophosphatase family [Carbohydrate transport and metabolism]; Region: SuhB; COG0483
31964009344	FIG, FBPase/IMPase/glpX-like domain. A superfamily of metal-dependent phosphatases with various substrates. Fructose-1,6-bisphospatase (both the major and the glpX-encoded variant) hydrolyze fructose-1,6,-bisphosphate to fructose-6-phosphate in...; Region: FIG; cl00289
31964009345	active site
31964009346	HMMPfam hit to PF00459, Inositol monophosphatase,score 1.3e-60
31964009347	PS00629 Inositol monophosphatase family signature 1.
31964009348	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964009349	2-aminoethylphosphonate ABC transporter substrate-binding protein; Provisional; Region: PRK15046
31964009350	Bacterial extracellular solute-binding protein; Region: SBP_bac_6; pfam13343
31964009351	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964009352	ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]; Region: PotA; COG3842
31964009353	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
31964009354	Walker A/P-loop; other site
31964009355	ATP binding site [chemical binding]; other site
31964009356	Q-loop/lid; other site
31964009357	ABC transporter signature motif; other site
31964009358	Walker B; other site
31964009359	D-loop; other site
31964009360	H-loop/switch region; other site
31964009361	TOBE domain; Region: TOBE; pfam03459
31964009362	HMMPfam hit to PF00005, ABC transporter, score 4.7e-67
31964009363	PS00017 ATP/GTP-binding site motif A (P-loop).
31964009364	PS00211 ABC transporters family signature.
31964009365	HMMPfam hit to PF03459, TOBE, score 1.1e-10
31964009366	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 5.2e-06
31964009367	Small protein B (SmpB) is a component of the trans-translation system in prokaryotes for releasing stalled ribosome from damaged messenger RNAs; Region: SmpB; cd09294
31964009368	SmpB-tmRNA interface; other site
31964009369	HMMPfam hit to PF01668, SmpB protein, score 2.7e-37
31964009370	PS01317 Protein smpB signature.
31964009371	Cell division protein [Cell division and chromosome partitioning]; Region: FtsX; COG2177
31964009372	FtsX-like permease family; Region: FtsX; pfam02687
31964009373	HMMPfam hit to PF02687, Protein of unknown function DUF214, score 6e-25
31964009374	4 probable transmembrane helices predicted for CMS2084 by TMHMM2.0 at aa 5-27, 166-188, 216-238 and 258-280
31964009375	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
31964009376	Predicted ATPase involved in cell division [Cell division and chromosome partitioning]; Region: FtsE; COG2884
31964009377	Walker A/P-loop; other site
31964009378	ATP binding site [chemical binding]; other site
31964009379	Q-loop/lid; other site
31964009380	ABC transporter signature motif; other site
31964009381	Walker B; other site
31964009382	D-loop; other site
31964009383	H-loop/switch region; other site
31964009384	HMMPfam hit to PF00005, ABC transporter, score 2.8e-60
31964009385	PS00211 ABC transporters family signature.
31964009386	PS00430 TonB-dependent receptor proteins signature 1.
31964009387	PS00017 ATP/GTP-binding site motif A (P-loop).
31964009388	peptide chain release factor 2; Validated; Region: prfB; PRK00578
31964009389	This domain is found in peptide chain release factors; Region: PCRF; smart00937
31964009390	RF-1 domain; Region: RF-1; pfam00472
31964009391	HMMPfam hit to PF00472, Class I peptide chain release factor, score 6.5e-61
31964009392	PS00745 Prokaryotic-type class I peptide chain release factors signature.
31964009393	HMMPfam hit to PF03462, PCRF, score 4.4e-44
31964009394	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
31964009395	Major Facilitator Superfamily; Region: MFS_1; pfam07690
31964009396	9 probable transmembrane helices predicted for CMS2087 by TMHMM2.0 at aa 10-32, 37-59, 74-96, 101-123,169-188, 268-290, 305-327, 339-361 and 397-419
31964009397	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964009398	1 probable transmembrane helix predicted for CMS2088 by TMHMM2.0 at aa 27-49
31964009399	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964009400	1 probable transmembrane helix predicted for CMS2089 by TMHMM2.0 at aa 15-37
31964009401	PS00178 Aminoacyl-transfer RNA synthetases class-I signature.
31964009402	1 probable transmembrane helix predicted for CMS2091 by TMHMM2.0 at aa 28-50
31964009403	HMMPfam hit to PF00482, Bacterial type II secretion system protein, score 2e-12
31964009404	Type II secretion system (T2SS), protein F; Region: T2SF; pfam00482
31964009405	4 probable transmembrane helices predicted for CMS2093 by TMHMM2.0 at aa 40-62, 66-85, 207-229 and 239-261
31964009406	HMMPfam hit to PF00482, Bacterial type II secretion system protein, score 1.1e-07
31964009407	Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion]; Region: VirB11; COG0630
31964009408	Type IV secretory pathway component VirB11, and related ATPases. The homohexamer, VirB11 is one of eleven Vir proteins, which are required for T-pilus biogenesis and virulence in the transfer of T-DNA from the Ti (tumor-inducing) plasmid of bacterial to...; Region: VirB11-like_ATPase; cd01130
31964009409	ATP binding site [chemical binding]; other site
31964009410	Walker A motif; other site
31964009411	hexamer interface [polypeptide binding]; other site
31964009412	Walker B motif; other site
31964009413	HMMPfam hit to PF00437, Bacterial type II secretion system protein E, score 4.1e-56
31964009414	PS00017 ATP/GTP-binding site motif A (P-loop).
31964009415	Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily; Region: NBD_sugar-kinase_HSP70_actin; cl17037
31964009416	D-xylulose kinase; Region: XylB; TIGR01312
31964009417	nucleotide binding site [chemical binding]; other site
31964009418	HMMPfam hit to PF02782, Carbohydrate kinase, FGGY,score 6.1e-31
31964009419	HMMPfam hit to PF00370, Carbohydrate kinase, FGGY,score 3.3e-59
31964009420	D-cysteine desulfhydrase; Validated; Region: PRK03910
31964009421	Tryptophan synthase beta superfamily (fold type II); this family of pyridoxal phosphate (PLP)-dependent enzymes catalyzes beta-replacement and beta-elimination reactions. This CD corresponds to aminocyclopropane-1-carboxylate deaminase (ACCD), tryptophan...; Region: Trp-synth-beta_II; cl00342
31964009422	pyridoxal 5'-phosphate binding pocket [chemical binding]; other site
31964009423	catalytic residue [active]
31964009424	Uncharacterized membrane-associated protein [Function unknown]; Region: DedA; COG0586
31964009425	SNARE associated Golgi protein; Region: SNARE_assoc; cl00429
31964009426	5 probable transmembrane helices predicted for CMS2097 by TMHMM2.0 at aa 20-42, 63-85, 111-129, 150-172 and 182-204
31964009427	HMMPfam hit to PF00597, DedA, score 9.4e-18
31964009428	Co/Zn/Cd efflux system component [Inorganic ion transport and metabolism]; Region: CzcD; COG1230
31964009429	HMMPfam hit to PF01545, Cation efflux protein,score 1.3e-79
31964009430	6 probable transmembrane helices predicted for CMS2098 by TMHMM2.0 at aa 43-65, 85-107, 120-142, 157-176,188-210 and 220-237
31964009431	NTPase/HAM1.  This family consists of the HAM1 protein and pyrophosphate-releasing xanthosine/ inosine triphosphatase. HAM1 protects the cell against mutagenesis by the base analog 6-N-hydroxylaminopurine (HAP) in E. Coli and S. cerevisiae. A...; Region: HAM1; cd00515
31964009432	dimerization interface [polypeptide binding]; other site
31964009433	active site
31964009434	HMMPfam hit to PF01725, Ham1-like protein, score 3.3e-26
31964009435	ribonuclease PH; Reviewed; Region: rph; PRK00173
31964009436	Ribonuclease PH; Region: RNase_PH_bact; cd11362
31964009437	hexamer interface [polypeptide binding]; other site
31964009438	active site
31964009439	HMMPfam hit to PF03725, 3' exoribonuclease, score 1.3e-20
31964009440	HMMPfam hit to PF01138, 3' exoribonuclease, score 2.9e-43
31964009441	PS01277 Ribonuclease PH signature.
31964009442	glutamate racemase; Provisional; Region: PRK00865
31964009443	HMMPfam hit to PF01177, Asp/Glu racemase, score 9.6e-82
31964009444	PS00924 Aspartate and glutamate racemases signature 2.
31964009445	PS00923 Aspartate and glutamate racemases signature 1.
31964009446	Uncharacterized protein related to deoxyribodipyrimidine photolyase [General function prediction only]; Region: COG3046
31964009447	Deoxyribodipyrimidine photo-lyase-related protein; Region: DPRP; pfam04244
31964009448	HMMPfam hit to PF04244, Deoxyribodipyrimidine photolyase-related protein, score 3.7e-104
31964009449	nicotinate phosphoribosyltransferase; Validated; Region: PRK09243
31964009450	Nicotinate phosphoribosyltransferase (NAPRTase), subgroup A. Nicotinate phosphoribosyltransferase catalyses the formation of NAMN and PPi from 5-phosphoribosy -1-pyrophosphate (PRPP) and nicotinic acid, this is the first, and also rate limiting, reaction...; Region: NAPRTase_A; cd01570
31964009451	active site
31964009452	HMMPfam hit to PF04095, Nicotinate phosphoribosyltransferase and related, score 1.1e-07
31964009453	Protein of unknown function (DUF3039); Region: DUF3039; pfam11238
31964009454	14 probable transmembrane helices predicted for CMS2105 by TMHMM2.0 at aa 24-46, 56-78, 99-121, 131-153,174-196, 206-228, 233-255, 275-297, 304-323, 327-346,375-397, 402-424, 455-477 and 481-503
31964009455	ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism]; Region: NatA; COG4555
31964009456	ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A; Region: ABC_DR_subfamily_A; cd03230
31964009457	Walker A/P-loop; other site
31964009458	ATP binding site [chemical binding]; other site
31964009459	Q-loop/lid; other site
31964009460	ABC transporter signature motif; other site
31964009461	Walker B; other site
31964009462	D-loop; other site
31964009463	H-loop/switch region; other site
31964009464	HMMPfam hit to PF00005, ABC transporter, score 3.5e-52
31964009465	PS00017 ATP/GTP-binding site motif A (P-loop).
31964009466	Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline; Region: PC_cytidylyltransferase; cd02523
31964009467	active site
31964009468	metal-binding site
31964009469	ABC-2 type transporter; Region: ABC2_membrane; cl17235
31964009470	6 probable transmembrane helices predicted for CMS2108 by TMHMM2.0 at aa 44-66, 81-103, 124-146, 161-183,196-218 and 238-260
31964009471	HMMPfam hit to PF01061, ABC-2, score 2.2e-12
31964009472	ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane]; Region: TagH; COG1134
31964009473	ATP-binding cassette component of polysaccharide transport system; Region: ABC_KpsT_Wzt; cd03220
31964009474	Walker A/P-loop; other site
31964009475	ATP binding site [chemical binding]; other site
31964009476	Q-loop/lid; other site
31964009477	ABC transporter signature motif; other site
31964009478	Walker B; other site
31964009479	D-loop; other site
31964009480	H-loop/switch region; other site
31964009481	HMMPfam hit to PF00005, ABC transporter, score 2.7e-31
31964009482	PS00017 ATP/GTP-binding site motif A (P-loop).
31964009483	PS00211 ABC transporters family signature.
31964009484	Predicted transcriptional regulators [Transcription]; Region: HipB; COG1396
31964009485	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
31964009486	non-specific DNA binding site [nucleotide binding]; other site
31964009487	salt bridge; other site
31964009488	sequence-specific DNA binding site [nucleotide binding]; other site
31964009489	HMMPfam hit to PF01381, Helix-turn-helix motif,score 1e-14
31964009490	Predicted helix-turn-helix motif with score 1283.000, SD 3.56 at aa 25-46, sequence ISQETLAELSGIHWTALGKIER
31964009491	PS00339 Aminoacyl-transfer RNA synthetases class-II signature 2.
31964009492	Putative glycosyl/glycerophosphate transferases involved in teichoic acid biosynthesis TagF/TagB/EpsJ/RodC [Cell envelope biogenesis, outer membrane]; Region: TagB; COG1887
31964009493	Glycosyltransferases involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane]; Region: WcaA; COG0463
31964009494	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold; Region: Glyco_tranf_GTA_type; cl11394
31964009495	active site
31964009496	HMMPfam hit to PF00535, Glycosyl transferase,family 2, score 1.2e-06
31964009497	CDP-alcohol phosphatidyltransferase; Region: CDP-OH_P_transf; pfam01066
31964009498	4 probable transmembrane helices predicted for CMS2115 by TMHMM2.0 at aa 66-88, 152-171, 213-235 and 245-267
31964009499	HMMPfam hit to PF01066, CDP-alcohol phosphatidyltransferase, score 0.0034
31964009500	ExoA is involved in the biosynthesis of succinoglycan; Region: Succinoglycan_BP_ExoA; cd02525
31964009501	Glycosyltransferase like family 2; Region: Glyco_tranf_2_3; pfam13641
31964009502	Ligand binding site; other site
31964009503	3 probable transmembrane helices predicted for CMS2116 by TMHMM2.0 at aa 235-257, 270-292 and 299-321
31964009504	HMMPfam hit to PF00535, Glycosyl transferase,family 2, score 0.0027
31964009505	Trypsin-like peptidase domain; Region: Trypsin_2; pfam13365
31964009506	Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. Alignment contains also inactive enzymes that have substitutions of the catalytic triad...; Region: Tryp_SPc; cl00149
31964009507	PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis. May be responsible for substrate recognition and/or binding, as most PDZ domains bind...; Region: PDZ_serine_protease; cd00987
31964009508	protein binding site [polypeptide binding]; other site
31964009509	HMMPfam hit to PF00595, PDZ/DHR/GLGF, score 2.3e-09
31964009510	HMMPfam hit to PF00089, Peptidase S1, chymotrypsin,score 2.8e-08
31964009511	1 probable transmembrane helix predicted for CMS2117 by TMHMM2.0 at aa 111-133
31964009512	aminotransferase; Validated; Region: PRK07777
31964009513	Aspartate aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). Pyridoxal phosphate combines with an alpha-amino acid to form a compound called a Schiff base or aldimine...; Region: AAT_like; cd00609
31964009514	pyridoxal 5'-phosphate binding site [chemical binding]; other site
31964009515	homodimer interface [polypeptide binding]; other site
31964009516	catalytic residue [active]
31964009517	HMMPfam hit to PF00155, Aminotransferase, class I and II, score 3.2e-26
31964009518	ABC-type multidrug transport system, ATPase component [Defense mechanisms]; Region: CcmA; COG1131
31964009519	ATP-binding cassette domain of the bacitracin-resistance transporter; Region: ABC_BcrA_bacitracin_resist; cd03268
31964009520	Walker A/P-loop; other site
31964009521	ATP binding site [chemical binding]; other site
31964009522	Q-loop/lid; other site
31964009523	ABC transporter signature motif; other site
31964009524	Walker B; other site
31964009525	D-loop; other site
31964009526	H-loop/switch region; other site
31964009527	HMMPfam hit to PF00005, ABC transporter, score 4.5e-39
31964009528	PS00017 ATP/GTP-binding site motif A (P-loop).
31964009529	6 probable transmembrane helices predicted for CMS2122 by TMHMM2.0 at aa 37-59, 79-101, 128-150, 170-192,199-221 and 252-274
31964009530	Histidine kinase; Region: HisKA_3; pfam07730
31964009531	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; Region: HATPase_c; pfam02518
31964009532	7 probable transmembrane helices predicted for CMS2123 by TMHMM2.0 at aa 7-29, 34-53, 58-75, 79-96,101-120, 124-146 and 192-214
31964009533	HMMPfam hit to PF07730, Histidine kinase
31964009534	HMMPfam hit to PF02518, ATP-binding region,ATPase-like, score 3.9e-16
31964009535	Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription]; Region: CitB; COG2197
31964009536	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
31964009537	active site
31964009538	phosphorylation site [posttranslational modification]
31964009539	intermolecular recognition site; other site
31964009540	dimerization interface [polypeptide binding]; other site
31964009541	C-terminal DNA-binding domain of LuxR-like proteins. This domain contains a helix-turn-helix motif and binds DNA. Proteins belonging to this group are response regulators; some act as transcriptional activators, others as transcriptional repressors. Many...; Region: LuxR_C_like; cd06170
31964009542	DNA binding residues [nucleotide binding]
31964009543	dimerization interface [polypeptide binding]; other site
31964009544	HMMPfam hit to PF00072, Response regulator receiver, score 9.5e-28
31964009545	HMMPfam hit to PF00196, Bacterial regulatory protein, LuxR, score 2e-25
31964009546	PS00622 Bacterial regulatory proteins, luxR family signature.
31964009547	Predicted helix-turn-helix motif with score 1294.000, SD 3.59 at aa 163-184, sequence LTNQEIAGRLFLSESTVKTHVG
31964009548	ATP-dependent Clp protease adaptor protein ClpS; Region: ClpS; cl00933
31964009549	HMMPfam hit to PF02617, ATP-dependent Clp protease adaptor protein ClpS, score 1.6e-20
31964009550	Domain of unknown function (DUF2017); Region: DUF2017; pfam09438
31964009551	Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]; Region: WcaG; COG0451
31964009552	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
31964009553	NAD(P) binding site [chemical binding]; other site
31964009554	active site
31964009555	A new structural DNA glycosylase; Region: AlkD_like; cl11434
31964009556	active site
31964009557	Putative neutral zinc metallopeptidase; Region: Zn_peptidase; pfam04228
31964009558	HMMPfam hit to PF04228, Protein of unknown function Zinc binding 2, score 1.3e-67
31964009559	1 probable transmembrane helix predicted for CMS2129 by TMHMM2.0 at aa 26-48
31964009560	PS00142 Neutral zinc metallopeptidases,zinc-binding region signature.
31964009561	leucine-zipper of insertion element IS481; Region: LZ_Tnp_IS481; pfam13011
31964009562	Winged helix-turn helix; Region: HTH_29; pfam13551
31964009563	Integrase core domain; Region: rve; pfam00665
31964009564	Integrase core domain; Region: rve_3; pfam13683
31964009565	HMMPfam hit to PF00665, Integrase, catalytic region, score 6.7e-38
31964009566	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964009567	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964009568	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964009569	Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription]; Region: OmpR; COG0745
31964009570	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
31964009571	active site
31964009572	phosphorylation site [posttranslational modification]
31964009573	intermolecular recognition site; other site
31964009574	dimerization interface [polypeptide binding]; other site
31964009575	Effector domain of response regulator. Bacteria and certain eukaryotes like protozoa and higher plants use two-component signal transduction systems to detect and respond to changes in the environment. The system consists of a sensor histidine kinase and...; Region: trans_reg_C; cd00383
31964009576	DNA binding site [nucleotide binding]
31964009577	HMMPfam hit to PF00072, Response regulator receiver, score 6.2e-36
31964009578	HMMPfam hit to PF00486, Transcriptional regulatory protein, C-terminal, score 7.1e-26
31964009579	Signal transduction histidine kinase [Signal transduction mechanisms]; Region: BaeS; COG0642
31964009580	Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via...; Region: HisKA; cd00082
31964009581	dimer interface [polypeptide binding]; other site
31964009582	phosphorylation site [posttranslational modification]
31964009583	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
31964009584	ATP binding site [chemical binding]; other site
31964009585	Mg2+ binding site [ion binding]; other site
31964009586	G-X-G motif; other site
31964009587	2 probable transmembrane helices predicted for CMS2133 by TMHMM2.0 at aa 24-46 and 179-201
31964009588	HMMPfam hit to PF00672, Histidine kinase, HAMP region, score 1e-13
31964009589	HMMPfam hit to PF00512, Histidine kinase A,N-terminal, score 3.3e-19
31964009590	HMMPfam hit to PF02518, ATP-binding region,ATPase-like, score 4.7e-30
31964009591	Domain of unknown function (DUF4411); Region: DUF4411; pfam14367
31964009592	Domain of unknown function (DUF955); Region: DUF955; cl01076
31964009593	HMMPfam hit to PF06114, Protein of unknown function DUF955, score 1.2e-15
31964009594	PS00142 Neutral zinc metallopeptidases,zinc-binding region signature.
31964009595	Alpha/beta hydrolase family; Region: Abhydrolase_6; pfam12697
31964009596	HMMPfam hit to PF00561, Alpha/beta hydrolase fold,score 6e-06
31964009597	Sensors of blue-light using FAD; Region: BLUF; pfam04940
31964009598	HMMPfam hit to PF04940, BLUF, score 4.4e-19
31964009599	Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates...; Region: NK; cl17190
31964009600	AAA domain; Region: AAA_18; pfam13238
31964009601	active site
31964009602	PS00017 ATP/GTP-binding site motif A (P-loop).
31964009603	Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily; Region: Glyoxalase; pfam00903
31964009604	This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins; Region: Glo_EDI_BRP_like; cd06587
31964009605	active site
31964009606	HMMPfam hit to PF00903, Glyoxalase/bleomycin resistance protein/dioxygenase, score 4.6e-09
31964009607	MarR family; Region: MarR_2; cl17246
31964009608	helix_turn_helix multiple antibiotic resistance protein; Region: HTH_MARR; smart00347
31964009609	HMMPfam hit to PF01047, Bacterial regulatory protein, MarR, score 4.6e-11
31964009610	Adenylosuccinate synthetase; Region: Adenylsucc_synt; smart00788
31964009611	Adenylosuccinate synthetase (AdSS) catalyzes the first step in the de novo biosynthesis of AMP. IMP and L-aspartate are conjugated in a two-step reaction accompanied by the hydrolysis of GTP to GDP in the presence of Mg2+. In the first step, the...; Region: AdSS; cd03108
31964009612	GDP-binding site [chemical binding]; other site
31964009613	ACT binding site; other site
31964009614	IMP binding site; other site
31964009615	HMMPfam hit to PF00709, Adenylosuccinate synthetase, score 5.4e-213
31964009616	PS00017 ATP/GTP-binding site motif A (P-loop).
31964009617	PS00513 Adenylosuccinate synthetase active site.
31964009618	PS01266 Adenylosuccinate synthetase GTP-binding site.
31964009619	Protein of unknown function (DUF3151); Region: DUF3151; pfam11349
31964009620	Mre11 nuclease, N-terminal metallophosphatase domain; Region: MPP_Mre11_N; cd00840
31964009621	active site
31964009622	metal binding site [ion binding]; metal-binding site
31964009623	DNA binding site [nucleotide binding]
31964009624	Type 5 capsule protein repressor C-terminal domain; Region: SbcD_C; pfam12320
31964009625	HMMPfam hit to PF00149, Metallophosphoesterase,score 9.3e-21
31964009626	PS00133 Zinc carboxypeptidases, zinc-binding region 2 signature.
31964009627	ATPase involved in DNA repair [DNA replication, recombination, and repair]; Region: SbcC; COG0419
31964009628	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
31964009629	Walker A/P-loop; other site
31964009630	ATP binding site [chemical binding]; other site
31964009631	Q-loop/lid; other site
31964009632	ATPase involved in DNA repair [DNA replication, recombination, and repair]; Region: SbcC; COG0419
31964009633	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
31964009634	ABC transporter signature motif; other site
31964009635	Walker B; other site
31964009636	D-loop; other site
31964009637	H-loop/switch region; other site
31964009638	PS00017 ATP/GTP-binding site motif A (P-loop).
31964009639	2 probable transmembrane helices predicted for CMS2146 by TMHMM2.0 at aa 7-26 and 31-53
31964009640	HMMPfam hit to PF00165, Helix-turn-helix, AraC type, score 0.00084
31964009641	Predicted helix-turn-helix motif with score 1042.000, SD 2.74 at aa 19-40, sequence ITPAEAAAAAGISTRVLQLALR
31964009642	PS00041 Bacterial regulatory proteins, araC family signature.
31964009643	HMMPfam hit to PF00165, Helix-turn-helix, AraC type, score 0.05
31964009644	Transcriptional regulator [Transcription]; Region: AcrR; COG1309
31964009645	Bacterial regulatory proteins, tetR family; Region: TetR_N; pfam00440
31964009646	HMMPfam hit to PF00440, Bacterial regulatory protein, TetR, score 9.1e-08
31964009647	Predicted helix-turn-helix motif with score 1387.000, SD 3.91 at aa 35-56, sequence ASLETIAAAAGLSRRAVYGHFA
31964009648	YhgE/Pip N-terminal domain; Region: pip_yhgE_Nterm; TIGR03061
31964009649	Predicted membrane protein [Function unknown]; Region: COG1511
31964009650	YhgE/Pip C-terminal domain; Region: pip_yhgE_Cterm; TIGR03062
31964009651	6 probable transmembrane helices predicted for CMS2151 by TMHMM2.0 at aa 22-41, 503-525, 546-568,578-600, 607-629 and 662-684
31964009652	HMMPfam hit to PF01061, ABC-2, score 0.00084
31964009653	2 probable transmembrane helices predicted for CMS2152 by TMHMM2.0 at aa 12-34 and 54-76
31964009654	Metal dependent phosphohydrolases with conserved 'HD' motif; Region: HDc; cd00077
31964009655	Zn2+ binding site [ion binding]; other site
31964009656	Mg2+ binding site [ion binding]; other site
31964009657	Bacillus subtilis YvnB and related proteins, metallophosphatase domain; Region: MPP_YvnB; cd07399
31964009658	Predicted phosphohydrolases [General function prediction only]; Region: Icc; COG1409
31964009659	putative active site [active]
31964009660	putative metal binding site [ion binding]; other site
31964009661	Concanavalin A-like lectin/glucanases superfamily; Region: Laminin_G_3; pfam13385
31964009662	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
31964009663	non-specific DNA binding site [nucleotide binding]; other site
31964009664	salt bridge; other site
31964009665	sequence-specific DNA binding site [nucleotide binding]; other site
31964009666	HMMPfam hit to PF01381, Helix-turn-helix motif,score 2.9e-11
31964009667	PS00017 ATP/GTP-binding site motif A (P-loop).
31964009668	HipA N-terminal domain; Region: Couple_hipA; pfam13657
31964009669	HipA-like N-terminal domain; Region: HipA_N; pfam07805
31964009670	HipA-like C-terminal domain; Region: HipA_C; pfam07804
31964009671	Flavin reductase like domain; Region: Flavin_Reduct; smart00903
31964009672	HMMPfam hit to PF01613, Flavin reductase-like,score 2.1e-31
31964009673	Ferredoxin [Energy production and conversion]; Region: COG1146
31964009674	4Fe-4S binding domain; Region: Fer4; pfam00037
31964009675	HMMPfam hit to PF00037, 4Fe-4S ferredoxin,iron-sulfur binding, score 3.8e-08
31964009676	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
31964009677	redox-sensitive transcriptional activator SoxR; Region: SoxR; TIGR01950
31964009678	Helix-Turn-Helix DNA binding domain of transcription regulators from the MerR superfamily; Region: HTH_MerR-SF; cl02600
31964009679	DNA binding residues [nucleotide binding]
31964009680	HMMPfam hit to PF00376, Bacterial regulatory protein, MerR, score 5.6e-06
31964009681	Homeodomain-like domain; Region: HTH_23; cl17451
31964009682	Winged helix-turn helix; Region: HTH_29; pfam13551
31964009683	Integrase core domain; Region: rve; pfam00665
31964009684	Integrase core domain; Region: rve_3; pfam13683
31964009685	HMMPfam hit to PF00665, Integrase, catalytic region, score 5.9e-38
31964009686	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964009687	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964009688	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964009689	DEAD-box helicases. A diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker  B motif; Region: DEADc; cd00268
31964009690	DEAD-like helicases superfamily; Region: DEXDc; smart00487
31964009691	ATP binding site [chemical binding]; other site
31964009692	Mg++ binding site [ion binding]; other site
31964009693	motif III; other site
31964009694	Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may...; Region: HELICc; cd00079
31964009695	nucleotide binding region [chemical binding]; other site
31964009696	ATP-binding site [chemical binding]; other site
31964009697	HMMPfam hit to PF00271, Helicase, C-terminal, score 3.5e-29
31964009698	HMMPfam hit to PF00270, DEAD/DEAH box helicase,N-terminal, score 1.2e-51
31964009699	PS00017 ATP/GTP-binding site motif A (P-loop).
31964009700	HMMPfam hit to PF00873, Acriflavin resistance protein, score 1.2e-208
31964009701	5 probable transmembrane helices predicted for CMS2163 by TMHMM2.0 at aa 45-62, 369-391, 401-423, 462-484 and 499-521
31964009702	Uncharacterized protein conserved in bacteria (DUF2256); Region: DUF2256; pfam10013
31964009703	Protein of unknown function (DUF3253); Region: DUF3253; pfam11625
31964009704	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964009705	Fusaric acid resistance protein-like; Region: FUSC_2; pfam13515
31964009706	8 probable transmembrane helices predicted for CMS2166 by TMHMM2.0 at aa 13-35, 45-67, 74-96, 123-145,175-197, 235-257, 264-286 and 301-323
31964009707	Homeodomain-like domain; Region: HTH_23; cl17451
31964009708	Winged helix-turn helix; Region: HTH_29; pfam13551
31964009709	Integrase core domain; Region: rve; pfam00665
31964009710	Integrase core domain; Region: rve_3; pfam13683
31964009711	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.6e-38
31964009712	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964009713	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964009714	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964009715	Bacterial regulatory helix-turn-helix protein, lysR family; Region: HTH_1; pfam00126
31964009716	The substrate binding domain of LysR-type transcriptional regulators (LTTRs), a member of the type 2 periplasmic binding fold protein superfamily; Region: PBP2_LTTR_substrate; cl11398
31964009717	dimerization interface [polypeptide binding]; other site
31964009718	HMMPfam hit to PF03466, LysR, substrate-binding,score 1.8e-09
31964009719	HMMPfam hit to PF00126, Bacterial regulatory protein, LysR, score 1e-10
31964009720	Predicted helix-turn-helix motif with score 1383.000, SD 3.90 at aa 26-47, sequence LHFARAAKALNVSRIAVSRSIL
31964009721	Predicted membrane protein [Function unknown]; Region: COG3463
31964009722	Predicted membrane protein (DUF2079); Region: DUF2079; pfam09852
31964009723	9 probable transmembrane helices predicted for CMS2170 by TMHMM2.0 at aa 5-27, 81-103, 110-129, 134-156,169-191, 195-217, 255-277, 292-314 and 327-349
31964009724	H+/citrate symporter [Energy production and conversion]; Region: CitM; cl17620
31964009725	Citrate transporter; Region: CitMHS; pfam03600
31964009726	H+/citrate symporter [Energy production and conversion]; Region: CitM; cl17620
31964009727	Citrate transporter; Region: CitMHS; pfam03600
31964009728	10 probable transmembrane helices predicted for CMS2171 by TMHMM2.0 at aa 15-32, 39-61, 71-93, 151-173,188-210, 300-317, 321-338, 350-372, 392-414 and 477-499
31964009729	HMMPfam hit to PF03600, Citrate transporter, score 1.2e-146
31964009730	PS00211 ABC transporters family signature.
31964009731	Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms]; Region: CitA; COG3290
31964009732	PAS domain; Region: PAS; smart00091
31964009733	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
31964009734	ATP binding site [chemical binding]; other site
31964009735	Mg2+ binding site [ion binding]; other site
31964009736	G-X-G motif; other site
31964009737	2 probable transmembrane helices predicted for CMS2172 by TMHMM2.0 at aa 37-59 and 222-244
31964009738	HMMPfam hit to PF02518, ATP-binding region,ATPase-like, score 2.2e-08
31964009739	Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms]; Region: CitB; COG4565
31964009740	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
31964009741	active site
31964009742	phosphorylation site [posttranslational modification]
31964009743	intermolecular recognition site; other site
31964009744	dimerization interface [polypeptide binding]; other site
31964009745	HMMPfam hit to PF00072, Response regulator receiver, score 3e-28
31964009746	Predicted helix-turn-helix motif with score 1658.000, SD 4.83 at aa 169-190, sequence LSAPEIAERVGVSRATAQRYLG
31964009747	ASC-1 homology domain, subfamily similar to Escherichia coli Yqfb. The ASCH domain, a small beta-barrel domain found in all three kingdoms of life, resembles the RNA-binding PUA domain and may also interact with RNA. ASCH has been proposed to function as...; Region: ASCH_yqfb_like; cd06552
31964009748	Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+...; Region: Nudix_Hydrolase; cl00447
31964009749	nudix motif; other site
31964009750	HMMPfam hit to PF00293, NUDIX hydrolase, score 2.7e-18
31964009751	PS00893 mutT domain signature.
31964009752	HMMPfam hit to PF00202, Aminotransferase class-III,score 1.3e-66
31964009753	Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only]; Region: MhpC; COG0596
31964009754	homoserine O-acetyltransferase; Provisional; Region: metX; cl17114
31964009755	HMMPfam hit to PF00561, Alpha/beta hydrolase fold,score 1.2e-32
31964009756	Probable polygalacturonase At3g15720; Region: PLN03003; cl14103
31964009757	HMMPfam hit to PF00295, Glycoside hydrolase, family 28, score 5.2e-14
31964009758	PS00142 Neutral zinc metallopeptidases,zinc-binding region signature.
31964009759	HMMPfam hit to PF02985, HEAT, score 2.2
31964009760	HMMPfam hit to PF02985, HEAT, score 0.4
31964009761	Ferritin-CCC1, N-terminal ferritin-like diiron-binding domain; Region: Ferritin_CCC1_N; cd01044
31964009762	diiron binding motif [ion binding]; other site
31964009763	Nodulin-21 and CCC1-related protein family; Region: Nodulin-21_like_2; cd02433
31964009764	4 probable transmembrane helices predicted for CMS2181 by TMHMM2.0 at aa 222-244, 336-358, 363-385 and 398-415
31964009765	HMMPfam hit to PF01988, Protein of unknown function DUF125, score 3.7e-57
31964009766	4 probable transmembrane helices predicted for CMS2182 by TMHMM2.0 at aa 4-26, 39-61, 81-103 and 264-286
31964009767	helix_turn_helix multiple antibiotic resistance protein; Region: HTH_MARR; smart00347
31964009768	MarR family; Region: MarR; pfam01047
31964009769	HMMPfam hit to PF01047, Bacterial regulatory protein, MarR, score 3.5e-19
31964009770	Predicted phosphatases [General function prediction only]; Region: Gph; COG0546
31964009771	Haloacid dehalogenase-like hydrolases. The haloacid dehalogenase-like (HAD) superfamily includes L-2-haloacid dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, and many others; Region: HAD_like; cd01427
31964009772	motif II; other site
31964009773	HMMPfam hit to PF00702, Haloacid dehalogenase-like hydrolase, score 1.7e-05
31964009774	1 probable transmembrane helix predicted for CMS2185 by TMHMM2.0 at aa 22-44
31964009775	Predicted nuclease of the RecB family [DNA replication, recombination, and repair]; Region: COG1637
31964009776	hypothetical protein; Provisional; Region: PRK03298
31964009777	HMMPfam hit to PF01939, Protein of unknown function DUF91, score 1e-102
31964009778	PS00017 ATP/GTP-binding site motif A (P-loop).
31964009779	PS00142 Neutral zinc metallopeptidases,zinc-binding region signature.
31964009780	Ribbon-helix-helix protein, copG family; Region: RHH_1; pfam01402
31964009781	HMMPfam hit to PF01402, Helix-turn-helix protein,CopG, score 0.00058
31964009782	EamA-like transporter family; Region: EamA; pfam00892
31964009783	HMMPfam hit to PF00892, Protein of unknown function DUF6, score 1.4e-18
31964009784	9 probable transmembrane helices predicted for CMS2188 by TMHMM2.0 at aa 61-83, 93-112, 119-141, 146-168,181-200, 215-234, 247-269, 279-301 and 313-335
31964009785	HMMPfam hit to PF00892, Protein of unknown function DUF6, score 1.1e-22
31964009786	PS00216 Sugar transport proteins signature 1.
31964009787	Acetyltransferase (GNAT) domain; Region: Acetyltransf_3; pfam13302
31964009788	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 0.0045
31964009789	Winged helix-turn helix; Region: HTH_29; pfam13551
31964009790	leucine-zipper of insertion element IS481; Region: LZ_Tnp_IS481; pfam13011
31964009791	Integrase core domain; Region: rve; pfam00665
31964009792	Integrase core domain; Region: rve_3; pfam13683
31964009793	HMMPfam hit to PF00665, Integrase, catalytic region, score 2.1e-37
31964009794	Predicted helix-turn-helix motif with score 1638.000, SD 4.77 at aa 25-46, sequence RPVSHVARELGVSRQCAHRWVA
31964009795	Homeodomain-like domain; Region: HTH_23; cl17451
31964009796	Integrase core domain; Region: rve; pfam00665
31964009797	Integrase core domain; Region: rve_3; pfam13683
31964009798	Predicted helix-turn-helix motif with score 1316.000, SD 3.67 at aa 25-46, sequence WPVRRAAERFQCSPATASRWAR
31964009799	HMMPfam hit to PF00665, Integrase, catalytic region, score 3.7e-42
31964009800	OsmC-like protein; Region: OsmC; cl00767
31964009801	4-aminobutyrate aminotransferase; Provisional; Region: PRK06058
31964009802	Acetyl ornithine aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD correspond to ornithine aminotransferase, acetylornithine aminotransferase; Region: OAT_like; cd00610
31964009803	inhibitor-cofactor binding pocket; inhibition site
31964009804	pyridoxal 5'-phosphate binding site [chemical binding]; other site
31964009805	catalytic residue [active]
31964009806	HMMPfam hit to PF00202, Aminotransferase class-III,score 2.3e-142
31964009807	PS00600 Aminotransferases class-III pyridoxal-phosphate attachment site.
31964009808	L-asparaginase II; Region: Asparaginase_II; pfam06089
31964009809	HMMPfam hit to PF06089, L-asparaginase II, score 1e-83
31964009810	FtsK/SpoIIIE family; Region: FtsK_SpoIIIE; pfam01580
31964009811	FtsK/SpoIIIE family; Region: FtsK_SpoIIIE; pfam01580
31964009812	HMMPfam hit to PF01580, Cell divisionFtsK/SpoIIIE protein, score 7.5e-31
31964009813	PS00017 ATP/GTP-binding site motif A (P-loop).
31964009814	Transglutaminase-like superfamily; Region: Transglut_core; pfam01841
31964009815	8 probable transmembrane helices predicted for CMS2197 by TMHMM2.0 at aa 30-52, 56-78, 85-107, 141-163,170-187, 202-219, 254-276 and 679-701
31964009816	Protein of unknown function DUF58; Region: DUF58; pfam01882
31964009817	HMMPfam hit to PF01882, Protein of unknown function DUF58, score 2.8e-20
31964009818	3 probable transmembrane helices predicted for CMS2198 by TMHMM2.0 at aa 34-56, 69-91 and 101-123
31964009819	MoxR-like ATPases [General function prediction only]; Region: COG0714
31964009820	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
31964009821	Walker A motif; other site
31964009822	ATP binding site [chemical binding]; other site
31964009823	Walker B motif; other site
31964009824	arginine finger; other site
31964009825	HMMPfam hit to PF07728, ATPase family associated with various cellular activities (AAA)
31964009826	HMMPfam hit to PF07726, ATPase family associated with various cellular activities (AAA)
31964009827	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all...; Region: FN3; cd00063
31964009828	Interdomain contacts; other site
31964009829	Cytokine receptor motif; other site
31964009830	PS00343 Gram-positive cocci surface proteins 'anchoring' hexapeptide.
31964009831	HMMPfam hit to PF00041, Fibronectin, type III,score 0.024
31964009832	HMMPfam hit to PF00041, Fibronectin, type III,score 0.00043
31964009833	1 probable transmembrane helix predicted for CMS2200 by TMHMM2.0 at aa 13-32
31964009834	1 probable transmembrane helix predicted for CMS2201 by TMHMM2.0 at aa 17-39
31964009835	HMMPfam hit to PF00069, Protein kinase, score 1.1e-21
31964009836	Escherichia coli (Ec) citrate synthase (CS) GltA_like. CS catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the citric acid cycle (TCA or Krebs cycle). The overall CS...; Region: EcCS_like; cd06114
31964009837	dimer interface [polypeptide binding]; other site
31964009838	Citrate synthase; Region: Citrate_synt; pfam00285
31964009839	active site
31964009840	citrylCoA binding site [chemical binding]; other site
31964009841	NADH binding [chemical binding]; other site
31964009842	cationic pore residues; other site
31964009843	oxalacetate/citrate binding site [chemical binding]; other site
31964009844	coenzyme A binding site [chemical binding]; other site
31964009845	catalytic triad [active]
31964009846	HMMPfam hit to PF00285, Citrate synthase, score 1.4e-188
31964009847	PS00480 Citrate synthase signature.
31964009848	N-succinyldiaminopimelate aminotransferase; Reviewed; Region: PRK07865
31964009849	Aspartate aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). Pyridoxal phosphate combines with an alpha-amino acid to form a compound called a Schiff base or aldimine...; Region: AAT_like; cd00609
31964009850	pyridoxal 5'-phosphate binding site [chemical binding]; other site
31964009851	homodimer interface [polypeptide binding]; other site
31964009852	catalytic residue [active]
31964009853	HMMPfam hit to PF00155, Aminotransferase, class I and II, score 8.9e-07
31964009854	PS00105 Aminotransferases class-I pyridoxal-phosphate attachment site.
31964009855	Ferredoxin [Energy production and conversion]; Region: COG1146
31964009856	4Fe-4S binding domain; Region: Fer4; pfam00037
31964009857	HMMPfam hit to PF00037, 4Fe-4S ferredoxin,iron-sulfur binding, score 3.8e-08
31964009858	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
31964009859	GlcNAc-PI de-N-acetylase; Region: PIG-L; cl00929
31964009860	4 probable transmembrane helices predicted for CMS2206 by TMHMM2.0 at aa 309-331, 341-363, 370-387 and 402-421
31964009861	HMMPfam hit to PF02585, LmbE-like protein, score 1.5e-37
31964009862	Iron permease FTR1 family; Region: FTR1; cl00475
31964009863	HMMPfam hit to PF03239, Iron permease FTR1, score 1e-68
31964009864	7 probable transmembrane helices predicted for CMS2207 by TMHMM2.0 at aa 5-27, 39-61, 71-91, 103-125,145-167, 179-198 and 241-263
31964009865	Predicted periplasmic lipoprotein involved in iron transport [Inorganic ion transport and metabolism]; Region: COG2822
31964009866	Imelysin; Region: Peptidase_M75; pfam09375
31964009867	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964009868	HMMPfam hit to PF04302, Protein of unknown function DUF451, score 2.7e-84
31964009869	Dyp-type peroxidase family; Region: Dyp_perox; cl01067
31964009870	HMMPfam hit to PF04261, Dyp-type peroxidase, score 5.9e-130
31964009871	Tyrosine phosphorylated protein A (TypA)/BipA family belongs to ribosome-binding GTPases; Region: TypA_BipA; cd01891
31964009872	GTP-binding protein TypA/BipA; Region: TypA_BipA; TIGR01394
31964009873	G1 box; other site
31964009874	putative GEF interaction site [polypeptide binding]; other site
31964009875	GTP/Mg2+ binding site [chemical binding]; other site
31964009876	Switch I region; other site
31964009877	G2 box; other site
31964009878	G3 box; other site
31964009879	Switch II region; other site
31964009880	G4 box; other site
31964009881	G5 box; other site
31964009882	BipA_TypA_II: domain II of BipA (also called TypA) having homology to domain II of the elongation factors (EFs) EF-G and EF-Tu.  BipA is a highly conserved protein with global regulatory properties in Escherichia coli. BipA is phosphorylated on a...; Region: BipA_TypA_II; cd03691
31964009883	BipA_TypA_C: a C-terminal portion of BipA or TypA having homology to the C terminal domains of the elongation factors EF-G and EF-2. A member of the ribosome binding GTPase superfamily, BipA is widely distributed in bacteria and plants.  BipA is a highly...; Region: BipA_TypA_C; cd03710
31964009884	HMMPfam hit to PF00679, Elongation factor G,C-terminal, score 1e-31
31964009885	HMMPfam hit to PF03144, Elongation factor Tu,domain 2, score 9.6e-14
31964009886	HMMPfam hit to PF00009, Protein synthesis factor,GTP-binding, score 7.5e-63
31964009887	PS00301 GTP-binding elongation factors signature.
31964009888	PS00017 ATP/GTP-binding site motif A (P-loop).
31964009889	The substrate-binding domain of mycobacterial lipoprotein Lpqw contains type 2 periplasmic binding fold; Region: PBP2_Lpqw; cd08501
31964009890	Bacterial extracellular solute-binding proteins, family 5 Middle; Region: SBP_bac_5; pfam00496
31964009891	HMMPfam hit to PF00496, Bacterial extracellular solute-binding protein, family 5, score 4.2e-21
31964009892	ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]; Region: COG1123
31964009893	ATP-binding cassette domain of nickel/oligopeptides specific transporters; Region: ABC_NikE_OppD_transporters; cd03257
31964009894	Walker A/P-loop; other site
31964009895	ATP binding site [chemical binding]; other site
31964009896	Q-loop/lid; other site
31964009897	ABC transporter signature motif; other site
31964009898	Walker B; other site
31964009899	D-loop; other site
31964009900	H-loop/switch region; other site
31964009901	Oligopeptide/dipeptide transporter, C-terminal region; Region: oligo_HPY; cl07097
31964009902	ATP-binding cassette domain of nickel/oligopeptides specific transporters; Region: ABC_NikE_OppD_transporters; cd03257
31964009903	Walker A/P-loop; other site
31964009904	ATP binding site [chemical binding]; other site
31964009905	Q-loop/lid; other site
31964009906	ABC transporter signature motif; other site
31964009907	Walker B; other site
31964009908	D-loop; other site
31964009909	H-loop/switch region; other site
31964009910	Oligopeptide/dipeptide transporter, C-terminal region; Region: oligo_HPY; pfam08352
31964009911	HMMPfam hit to PF00005, ABC transporter, score 2.1e-66
31964009912	PS00211 ABC transporters family signature.
31964009913	PS00017 ATP/GTP-binding site motif A (P-loop).
31964009914	HMMPfam hit to PF00005, ABC transporter, score 3.4e-55
31964009915	PS00211 ABC transporters family signature.
31964009916	PS00017 ATP/GTP-binding site motif A (P-loop).
31964009917	Protein of unknown function (DUF2581); Region: DUF2581; pfam10756
31964009918	1 probable transmembrane helix predicted for CMS2214 by TMHMM2.0 at aa 20-42
31964009919	oligopeptide ABC transporter permease OppC; Provisional; Region: PRK15406
31964009920	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964009921	ABC-ATPase subunit interface; other site
31964009922	putative PBP binding loops; other site
31964009923	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 2.4e-44
31964009924	6 probable transmembrane helices predicted for CMS2215 by TMHMM2.0 at aa 21-43, 103-125, 132-154,158-180, 211-233 and 268-290
31964009925	ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism]; Region: DppB; COG0601
31964009926	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cl00427
31964009927	ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism]; Region: DppB; COG0601
31964009928	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964009929	putative PBP binding loops; other site
31964009930	dimer interface [polypeptide binding]; other site
31964009931	ABC-ATPase subunit interface; other site
31964009932	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 2.7e-30
31964009933	12 probable transmembrane helices predicted for CMS2216 by TMHMM2.0 at aa 5-23, 100-122, 135-157, 167-189,196-215, 225-247, 252-274, 279-301, 308-330, 367-389,423-445 and 474-496
31964009934	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964009935	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 0.0041
31964009936	HMMPfam hit to PF00496, Bacterial extracellular solute-binding protein, family 5, score 7.6e-06
31964009937	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964009938	CAAX protease self-immunity; Region: Abi; pfam02517
31964009939	7 probable transmembrane helices predicted for CMS2219 by TMHMM2.0 at aa 27-49, 75-97, 118-140, 155-172,191-213, 217-239 and 244-266
31964009940	HMMPfam hit to PF02517, Abortive infection protein,score 9.2e-05
31964009941	Protein of unknown function, DUF485; Region: DUF485; pfam04341
31964009942	HMMPfam hit to PF04341, Protein of unknown function DUF485, score 4.9e-43
31964009943	2 probable transmembrane helices predicted for CMS2220 by TMHMM2.0 at aa 36-55 and 70-92
31964009944	Uncharacterized bacterial solute carrier 5 subfamily; putative solute-binding domain; Region: SLC5sbd_u4; cd11480
31964009945	Na binding site [ion binding]; other site
31964009946	13 probable transmembrane helices predicted for CMS2221 by TMHMM2.0 at aa 20-42, 64-86, 91-113, 133-155,170-192, 199-221, 258-280, 293-315, 344-366, 392-411,421-443, 450-472 and 487-509
31964009947	HMMPfam hit to PF00474, Na+/solute symporter, score 5.4e-101
31964009948	glycine dehydrogenase; Provisional; Region: PRK05367
31964009949	Glycine cleavage system P-protein, alpha- and beta-subunits. This family consists of Glycine cleavage system P-proteins EC:1.4.4.2 from bacterial, mammalian and plant sources. The P protein is part of the glycine decarboxylase multienzyme complex EC:2.1; Region: GDC-P; cd00613
31964009950	tetramer interface [polypeptide binding]; other site
31964009951	pyridoxal 5'-phosphate binding site [chemical binding]; other site
31964009952	catalytic residue [active]
31964009953	Glycine cleavage system P-protein, alpha- and beta-subunits. This family consists of Glycine cleavage system P-proteins EC:1.4.4.2 from bacterial, mammalian and plant sources. The P protein is part of the glycine decarboxylase multienzyme complex EC:2.1; Region: GDC-P; cd00613
31964009954	tetramer interface [polypeptide binding]; other site
31964009955	pyridoxal 5'-phosphate binding site [chemical binding]; other site
31964009956	catalytic residue [active]
31964009957	HMMPfam hit to PF02347, Glycine cleavage system P-protein, score 3.7e-206
31964009958	Glycine cleavage H-protein. Glycine cleavage H-proteins are part of the glycine cleavage system (GCS) found in bacteria, archea and the mitochondria of eukaryotes. GCS is a multienzyme complex consisting of 4 different components (P-, H-, T- and...; Region: GCS_H; cd06848
31964009959	lipoyl attachment site [posttranslational modification]; other site
31964009960	HMMPfam hit to PF01597, Glycine cleavage H-protein,score 1.7e-46
31964009961	PS00189 2-oxo acid dehydrogenases acyltransferase component lipoyl binding site.
31964009962	glycine cleavage system aminomethyltransferase T; Reviewed; Region: gcvT; PRK00389
31964009963	Glycine cleavage T-protein C-terminal barrel domain; Region: GCV_T_C; pfam08669
31964009964	HMMPfam hit to PF01571, Glycine cleavage T protein (aminomethyl transferase), score 2.4e-96
31964009965	PS00430 TonB-dependent receptor proteins signature 1.
31964009966	Penicillinase repressor; Region: Pencillinase_R; cl17580
31964009967	leucine-zipper of insertion element IS481; Region: LZ_Tnp_IS481; pfam13011
31964009968	Winged helix-turn helix; Region: HTH_29; pfam13551
31964009969	Integrase core domain; Region: rve; pfam00665
31964009970	Integrase core domain; Region: rve_3; pfam13683
31964009971	HMMPfam hit to PF00665, Integrase, catalytic region, score 6.7e-38
31964009972	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964009973	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964009974	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964009975	Predicted epimerase, PhzC/PhzF homolog [General function prediction only]; Region: COG0384
31964009976	HMMPfam hit to PF02567, Phenazine biosynthesis PhzC/PhzF protein, score 8e-38
31964009977	PS00178 Aminoacyl-transfer RNA synthetases class-I signature.
31964009978	Domain of Unknown Function (DUF1206); Region: DUF1206; pfam06724
31964009979	HMMPfam hit to PF06724, Protein of unknown function DUF1206, score 1.3e-14
31964009980	6 probable transmembrane helices predicted for CMS2229 by TMHMM2.0 at aa 21-43, 63-85, 106-125, 145-167,196-218 and 233-255
31964009981	HMMPfam hit to PF06724, Protein of unknown function DUF1206, score 5e-12
31964009982	HMMPfam hit to PF06724, Protein of unknown function DUF1206, score 8.3e-15
31964009983	Predicted permease, member of the PurR regulon [General function prediction only]; Region: yhhT; COG0628
31964009984	HMMPfam hit to PF01594, Protein of unknown function UPF0118, score 1.9e-55
31964009985	8 probable transmembrane helices predicted for CMS2230 by TMHMM2.0 at aa 20-37, 42-61, 74-96, 153-175,215-237, 247-269, 276-298 and 308-330
31964009986	Nodulation protein A (NodA); Region: NodA; cl17421
31964009987	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 9.1e-05
31964009988	Acetyltransferases [General function prediction only]; Region: RimI; COG0456
31964009989	Acetyltransferase (GNAT) family; Region: Acetyltransf_1; pfam00583
31964009990	Coenzyme A binding pocket [chemical binding]; other site
31964009991	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 1.8e-08
31964009992	PS00387 Inorganic pyrophosphatase signature.
31964009993	1 probable transmembrane helix predicted for CMS2233 by TMHMM2.0 at aa 20-42
31964009994	Pectate lyase; Region: Pectate_lyase; pfam03211
31964009995	1 probable transmembrane helix predicted for CMS2234 by TMHMM2.0 at aa 21-43
31964009996	HMMPfam hit to PF03211, Pectate lyase, score 5.4e-36
31964009997	Catalase [Inorganic ion transport and metabolism]; Region: KatE; COG0753
31964009998	Clade 3 of the heme-binding enzyme catalase; Region: catalase_clade_3; cd08156
31964009999	tetramer interface [polypeptide binding]; other site
31964010000	heme binding pocket [chemical binding]; other site
31964010001	NADPH binding site [chemical binding]; other site
31964010002	HMMPfam hit to PF00199, Catalase, score 4.9e-264
31964010003	PS00437 Catalase proximal heme-ligand signature.
31964010004	PS00438 Catalase proximal active site signature.
31964010005	Ferric uptake regulator(Fur) and related metalloregulatory proteins; typically iron-dependent, DNA-binding repressors and activators; Region: Fur_like; cd07153
31964010006	metal binding site 2 [ion binding]; metal-binding site
31964010007	putative DNA binding helix; other site
31964010008	metal binding site 1 [ion binding]; metal-binding site
31964010009	dimer interface [polypeptide binding]; other site
31964010010	structural Zn2+ binding site [ion binding]; other site
31964010011	HMMPfam hit to PF01475, Ferric-uptake regulator,score 2.2e-14
31964010012	Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols. AKRs are present in all phyla and are of importance to both health and industrial...; Region: Aldo_ket_red; cd06660
31964010013	Aldo/keto reductase family; Region: Aldo_ket_red; pfam00248
31964010014	active site
31964010015	catalytic tetrad [active]
31964010016	HMMPfam hit to PF00248, Aldo/keto reductase, score 2.2e-63
31964010017	Formate/glycerate dehydrogenases, D-specific 2-hydroxy acid dehydrogenases and related dehydrogenases; Region: FDH_GDH_like; cl17240
31964010018	Formate/glycerate dehydrogenases, D-specific 2-hydroxy acid dehydrogenases and related dehydrogenases; Region: FDH_GDH_like; cl17240
31964010019	NAD binding site [chemical binding]; other site
31964010020	Oxidoreductase family, NAD-binding Rossmann fold; Region: GFO_IDH_MocA; pfam01408
31964010021	Predicted dehydrogenases and related proteins [General function prediction only]; Region: MviM; COG0673
31964010022	Oxidoreductase family, NAD-binding Rossmann fold; Region: GFO_IDH_MocA; pfam01408
31964010023	HMMPfam hit to PF01408, Oxidoreductase, N-terminal,score 5.5e-11
31964010024	B12 binding domain (B12-BD). Most of the members bind different cobalamid derivates, like B12 (adenosylcobamide) or methylcobalamin or methyl-Co(III) 5-hydroxybenzimidazolylcobamide. This domain is found in several enzymes, such as glutamate mutase; Region: B12-binding_like; cl00293
31964010025	B12 binding site [chemical binding]; other site
31964010026	Elongator protein 3, MiaB family, Radical SAM; Region: Elp3; smart00729
31964010027	Radical SAM superfamily. Enzymes of this family generate radicals by combining a 4Fe-4S cluster and S-adenosylmethionine (SAM) in close proximity. They are characterized by a conserved CxxxCxxC motif, which coordinates the conserved iron-sulfur cluster; Region: Radical_SAM; cd01335
31964010028	FeS/SAM binding site; other site
31964010029	HMMPfam hit to PF04055, Radical SAM, score 1.7e-05
31964010030	PS00190 Cytochrome c family heme-binding site signature.
31964010031	12 probable transmembrane helices predicted for CMS2243 by TMHMM2.0 at aa 12-33, 43-65, 72-91, 101-123,136-158, 163-185, 205-224, 234-256, 263-282, 286-308,317-339 and 349-371
31964010032	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964010033	Predicted amidohydrolase [General function prediction only]; Region: COG0388
31964010034	Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases); Region: nitrilase_3; cd07581
31964010035	putative active site [active]
31964010036	catalytic triad [active]
31964010037	putative dimer interface [polypeptide binding]; other site
31964010038	HMMPfam hit to PF00795, Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase, score 7.5e-38
31964010039	Transcriptional regulators [Transcription]; Region: FadR; COG2186
31964010040	Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators; Region: WHTH_GntR; cl17414
31964010041	DNA-binding site [nucleotide binding]; DNA binding site
31964010042	FCD domain; Region: FCD; pfam07729
31964010043	HMMPfam hit to PF00392, Bacterial regulatory protein, GntR, score 6.4e-12
31964010044	Predicted helix-turn-helix motif with score 1121.000, SD 3.00 at aa 40-61, sequence LNEQELAERIGVSRTPVREALL
31964010045	HMMPfam hit to PF07729, FCD domain, score 3.8e-19
31964010046	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
31964010047	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
31964010048	HMMPfam hit to PF00083, General substrate transporter, score 2.4e-38
31964010049	10 probable transmembrane helices predicted for CMS2246 by TMHMM2.0 at aa 86-105, 110-132, 144-166,244-263, 302-324, 334-356, 363-382, 392-414, 426-448 and 452-471
31964010050	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964010051	Protein of unknown function (DUF2848); Region: DUF2848; pfam11010
31964010052	phosphoribosylformylglycinamidine synthase subunit PurS; Reviewed; Region: PRK05974
31964010053	phosphoribosylformylglycinamidine synthase I; Provisional; Region: PRK03619
31964010054	Type 1 glutamine amidotransferase (GATase1)-like domain found in Formylglycinamide ribonucleotide amidotransferase; Region: GATase1_FGAR_AT; cd01740
31964010055	putative active site [active]
31964010056	catalytic triad [active]
31964010057	HMMPfam hit to PF07685, CobB/CobQ-like glutamine amidotransferase domain
31964010058	PS00442 Glutamine amidotransferases class-I active site.
31964010059	phosphoribosylformylglycinamidine synthase II; Provisional; Region: PRK01213
31964010060	PurL subunit of the formylglycinamide ribonucleotide amidotransferase (FGAR-AT), first repeat. FGAR-AT catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to formylglycinamidine ribonucleotide (FGAM), ADP; Region: PurL_repeat1; cd02203
31964010061	dimerization interface [polypeptide binding]; other site
31964010062	ATP binding site [chemical binding]; other site
31964010063	PurL subunit of the formylglycinamide ribonucleotide amidotransferase (FGAR-AT), second repeat. FGAR-AT catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to formylglycinamidine ribonucleotide (FGAM), ADP; Region: PurL_repeat2; cd02204
31964010064	dimerization interface [polypeptide binding]; other site
31964010065	ATP binding site [chemical binding]; other site
31964010066	HMMPfam hit to PF00586, AIR synthase related protein, score 1.7e-49
31964010067	HMMPfam hit to PF02769, AIR synthase related protein, C-terminal, score 1.3e-37
31964010068	HMMPfam hit to PF00586, AIR synthase related protein, score 1.1e-37
31964010069	HMMPfam hit to PF02769, AIR synthase related protein, C-terminal, score 3.7e-21
31964010070	Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism]; Region: COG0412
31964010071	BAAT / Acyl-CoA thioester hydrolase C terminal; Region: BAAT_C; pfam08840
31964010072	HMMPfam hit to PF01738, Dienelactone hydrolase,score 6.6e-38
31964010073	Exonuclease-Endonuclease-Phosphatase domain; uncharacterized family 1; Region: EEP-1; cd09083
31964010074	putative catalytic site [active]
31964010075	putative metal binding site [ion binding]; other site
31964010076	putative phosphate binding site [ion binding]; other site
31964010077	HMMPfam hit to PF03372,Endonuclease/exonuclease/phosphatase, score 2.1e-16
31964010078	GDSL-like Lipase/Acylhydrolase family; Region: Lipase_GDSL_2; pfam13472
31964010079	active site
31964010080	catalytic triad [active]
31964010081	oxyanion hole [active]
31964010082	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964010083	HMMPfam hit to PF00657, Lipolytic enzyme, G-D-S-L,score 2.4e-05
31964010084	Predicted acyltransferases [Lipid metabolism]; Region: COG1835
31964010085	HMMPfam hit to PF01757, Acyltransferase 3, score 1.3e-15
31964010086	10 probable transmembrane helices predicted for CMS2254 by TMHMM2.0 at aa 13-31, 46-68, 81-102, 122-144,157-179, 183-202, 209-231, 241-259, 266-285 and 296-318
31964010087	Predicted acyltransferases [Lipid metabolism]; Region: COG1835
31964010088	10 probable transmembrane helices predicted for CMS2255 by TMHMM2.0 at aa 31-53, 74-96, 146-161, 174-196,211-233, 240-257, 261-283, 296-318, 328-347 and 375-394
31964010089	HMMPfam hit to PF01757, Acyltransferase 3, score 1.3e-60
31964010090	Chain length determinant protein; Region: Wzz; cl15801
31964010091	capsular exopolysaccharide family; Region: eps_fam; TIGR01007
31964010092	The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain. Functionally, proteins in this superfamily use the energy from hydrolysis of NTP to transfer electron or ion; Region: Fer4_NifH; cl17203
31964010093	HMMPfam hit to PF02706, Lipopolysaccharide biosynthesis, score 3.8e-13
31964010094	2 probable transmembrane helices predicted for CMS2256 by TMHMM2.0 at aa 7-29 and 167-186
31964010095	PS00217 Sugar transport proteins signature 2.
31964010096	Low molecular weight phosphatase family; Region: LMWPc; cl00105
31964010097	Protein-tyrosine-phosphatase [Signal transduction mechanisms]; Region: Wzb; COG0394
31964010098	active site
31964010099	HMMPfam hit to PF01451, Low molecular weight phosphotyrosine protein phosphatase, score 6.8e-07
31964010100	exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase; Region: EPS_sugtrans; TIGR03025
31964010101	Bacterial sugar transferase; Region: Bac_transf; pfam02397
31964010102	4 probable transmembrane helices predicted for CMS2258 by TMHMM2.0 at aa 22-44, 65-80, 85-107 and 262-283
31964010103	HMMPfam hit to PF02397, Bacterial sugar transferase, score 1.4e-72
31964010104	This family is most closely related to the GT1 family of glycosyltransferases.  wbaZ in Salmonella enterica has been shown to possess the mannosyl transferase activity. The members of this family are found in certain bacteria and Archaea; Region: GT1_wbaZ_like; cd03804
31964010105	putative ADP-binding pocket [chemical binding]; other site
31964010106	Glycosyltransferase [Cell envelope biogenesis, outer membrane]; Region: RfaG; COG0438
31964010107	HMMPfam hit to PF00534, Glycosyl transferase, group 1, score 7.2e-18
31964010108	This family is most closely related to the GT1 family of glycosyltransferases. mtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the...; Region: GT1_mtfB_like; cd03809
31964010109	Glycosyltransferase [Cell envelope biogenesis, outer membrane]; Region: RfaG; COG0438
31964010110	HMMPfam hit to PF00534, Glycosyl transferase, group 1, score 5e-07
31964010111	8 probable transmembrane helices predicted for CMS2261 by TMHMM2.0 at aa 7-29, 44-66, 79-101, 156-178,271-290, 305-324, 336-358 and 362-384
31964010112	Polysaccharide pyruvyl transferase; Region: PS_pyruv_trans; pfam04230
31964010113	3 probable transmembrane helices predicted for CMS2263 by TMHMM2.0 at aa 10-32, 45-67 and 90-112
31964010114	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964010115	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964010116	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964010117	HMMPfam hit to PF00665, Integrase, catalytic region, score 5.7e-38
31964010118	8 probable transmembrane helices predicted for CMS2265 by TMHMM2.0 at aa 13-35, 50-69, 81-103, 123-144,194-211, 255-277, 284-301 and 305-327
31964010119	Protein of unknown function (DUF4012); Region: DUF4012; pfam13196
31964010120	1 probable transmembrane helix predicted for CMS2266 by TMHMM2.0 at aa 54-76
31964010121	YdcF-like. YdcF-like is a large family of mainly bacterial proteins, with a few members found in fungi, plants, and archaea. Escherichia coli YdcF has been shown to bind S-adenosyl-L-methionine (AdoMet), but a biochemical function has not been...; Region: YdcF-like; cd06259
31964010122	putative active site [active]
31964010123	1 probable transmembrane helix predicted for CMS2267 by TMHMM2.0 at aa 20-42
31964010124	Exonuclease-Endonuclease-Phosphatase domain; uncharacterized family 1; Region: EEP-1; cd09083
31964010125	putative catalytic site [active]
31964010126	putative metal binding site [ion binding]; other site
31964010127	putative phosphate binding site [ion binding]; other site
31964010128	HMMPfam hit to PF03372,Endonuclease/exonuclease/phosphatase, score 5.6e-12
31964010129	Lysine biosynthesis enzyme LysX; Region: LysX_arch; TIGR02144
31964010130	ATP-grasp domain; Region: ATP-grasp_4; cl17255
31964010131	submitted with no further information
31964010132	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
31964010133	D-galactonate transporter; Region: 2A0114; TIGR00893
31964010134	putative substrate translocation pore; other site
31964010135	Phosphoribosyl transferase (PRT)-type I domain; Region: PRTases_typeI; cd06223
31964010136	active site
31964010137	Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism]; Region: Rpe; COG0036
31964010138	TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure. Specific for this family is the conserved phosphate binding site at the edges of strands 7 and 8. The phosphate...; Region: TIM_phosphate_binding; cl17186
31964010139	phosphate binding site [ion binding]; other site
31964010140	HMMPfam hit to PF00834, Ribulose-phosphate 3-epimerase, score 9.7e-16
31964010141	PS00017 ATP/GTP-binding site motif A (P-loop).
31964010142	Phosphoribosylpyrophosphate synthetase [Nucleotide transport and metabolism / Amino acid transport and metabolism]; Region: PrsA; COG0462
31964010143	N-terminal domain of ribose phosphate pyrophosphokinase; Region: Pribosyltran_N; pfam13793
31964010144	Phosphoribosyl transferase (PRT)-type I domain; Region: PRTases_typeI; cd06223
31964010145	active site
31964010146	Phosphoserine phosphatase [Amino acid transport and metabolism]; Region: SerB; COG0560
31964010147	haloacid dehalogenase-like hydrolase; Region: HAD; cl17202
31964010148	HMMPfam hit to PF00702, Haloacid dehalogenase-like hydrolase, score 2.3e-10
31964010149	HMMPfam hit to PF00532, Periplasmic binding protein/LacI transcriptional regulator, score 0.0017
31964010150	chorismate mutase; Provisional; Region: PRK09239
31964010151	HMMPfam hit to PF01817, Chorismate mutase, score 6.2e-14
31964010152	peroxiredoxin, Ohr subfamily; Region: organ_hyd_perox; TIGR03561
31964010153	HMMPfam hit to PF02566, OsmC-like protein, score 2.5e-41
31964010154	Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription]; Region: CitB; COG2197
31964010155	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
31964010156	active site
31964010157	phosphorylation site [posttranslational modification]
31964010158	intermolecular recognition site; other site
31964010159	dimerization interface [polypeptide binding]; other site
31964010160	C-terminal DNA-binding domain of LuxR-like proteins. This domain contains a helix-turn-helix motif and binds DNA. Proteins belonging to this group are response regulators; some act as transcriptional activators, others as transcriptional repressors. Many...; Region: LuxR_C_like; cd06170
31964010161	DNA binding residues [nucleotide binding]
31964010162	dimerization interface [polypeptide binding]; other site
31964010163	HMMPfam hit to PF00196, Bacterial regulatory protein, LuxR, score 3.5e-13
31964010164	PS00622 Bacterial regulatory proteins, luxR family signature.
31964010165	HMMPfam hit to PF00072, Response regulator receiver, score 8.2e-34
31964010166	Histidine kinase; Region: HisKA_3; pfam07730
31964010167	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; Region: HATPase_c; pfam02518
31964010168	HMMPfam hit to PF02518, ATP-binding region,ATPase-like, score 9.5e-10
31964010169	HMMPfam hit to PF07730, Histidine kinase
31964010170	6 probable transmembrane helices predicted for CMS2284 by TMHMM2.0 at aa 48-70, 80-99, 106-123, 128-147,152-174 and 194-216
31964010171	Beta-lactamase; Region: Beta-lactamase; pfam00144
31964010172	Beta-lactamase class C and other penicillin binding proteins [Defense mechanisms]; Region: AmpC; COG1680
31964010173	3 probable transmembrane helices predicted for CMS2285 by TMHMM2.0 at aa 21-43, 547-569 and 646-668
31964010174	HMMPfam hit to PF00144, Beta-lactamase, score 5.8e-70
31964010175	This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins; Region: Glo_EDI_BRP_like; cl14632
31964010176	active site
31964010177	metal binding site [ion binding]; metal-binding site
31964010178	HMMPfam hit to PF00903, Glyoxalase/bleomycin resistance protein/dioxygenase, score 0.00042
31964010179	Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis]; Region: RimL; COG1670
31964010180	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 0.0022
31964010181	PS00041 Bacterial regulatory proteins, araC family signature.
31964010182	leucine-zipper of insertion element IS481; Region: LZ_Tnp_IS481; pfam13011
31964010183	Winged helix-turn helix; Region: HTH_29; pfam13551
31964010184	Integrase core domain; Region: rve; pfam00665
31964010185	Integrase core domain; Region: rve_3; pfam13683
31964010186	HMMPfam hit to PF00665, Integrase, catalytic region, score 3.5E-36
31964010187	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964010188	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964010189	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964010190	CopC domain; Region: CopC; pfam04234
31964010191	1 probable transmembrane helix predicted for CMS2291 by TMHMM2.0 at aa 183-205
31964010192	HMMPfam hit to PF04234, Copper resistance protein CopC, score 2.4e-09
31964010193	Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones]; Region: csdA; COG0520
31964010194	Cysteine desulfurase (SufS)-like. This family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD correspond to cysteine desulfurase (SufS) and selenocysteine lyase. SufS...; Region: SufS_like; cd06453
31964010195	pyridoxal 5'-phosphate binding pocket [chemical binding]; other site
31964010196	catalytic residue [active]
31964010197	HMMPfam hit to PF00266, Aminotransferase, class V,score 2.6e-08
31964010198	PS00595 Aminotransferases class-V pyridoxal-phosphate attachment site.
31964010199	NifU homolog involved in Fe-S cluster formation [Energy production and conversion]; Region: IscU; COG0822
31964010200	Iron-sulfur cluster scaffold-like proteins; Region: IscU_like; cd06664
31964010201	trimerization site [polypeptide binding]; other site
31964010202	active site
31964010203	HMMPfam hit to PF01592, Nitrogen-fixing NifU-like,N-terminal, score 1.1e-13
31964010204	ChaB; Region: ChaB; pfam06150
31964010205	Rho termination factor, N-terminal domain; Region: Rho_N; cl06505
31964010206	Acetyltransferase (GNAT) domain; Region: Acetyltransf_3; pfam13302
31964010207	Acetyltransferase (GNAT) family; Region: Acetyltransf_1; pfam00583
31964010208	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 2.4e-12
31964010209	1 probable transmembrane helix predicted for CMS2298 by TMHMM2.0 at aa 7-29
31964010210	Amino acid permease; Region: AA_permease_2; pfam13520
31964010211	HMMPfam hit to PF00324, Amino acid permease-associated region, score 1.9e-09
31964010212	12 probable transmembrane helices predicted for CMS2300 by TMHMM2.0 at aa 26-48, 52-74, 95-117, 132-154,161-183, 203-225, 246-268, 288-310, 343-365, 380-402,422-439 and 444-461
31964010213	Usp: Universal stress protein family. The universal stress protein Usp is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. Usp enhances the rate of cell survival during prolonged exposure to...; Region: USP_Like; cd00293
31964010214	Ligand Binding Site [chemical binding]; other site
31964010215	HMMPfam hit to PF00582, UspA, score 9.5e-11
31964010216	Homeodomain-like domain; Region: HTH_23; cl17451
31964010217	Winged helix-turn helix; Region: HTH_29; pfam13551
31964010218	Integrase core domain; Region: rve; pfam00665
31964010219	Integrase core domain; Region: rve_3; pfam13683
31964010220	Predicted helix-turn-helix motif with score 1316.000, SD 3.67 at aa 25-46, sequence WPVRRAAERFQCSPATASRWAR
31964010221	HMMPfam hit to PF00665, Integrase, catalytic region, score 1e-41
31964010222	Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only]; Region: RhaT; COG0697
31964010223	EamA-like transporter family; Region: EamA; pfam00892
31964010224	HMMPfam hit to PF00892, Protein of unknown function DUF6, score 1.6e-07
31964010225	8 probable transmembrane helices predicted for CMS2304 by TMHMM2.0 at aa 17-36, 41-60, 72-91, 101-120,127-146, 156-178, 185-207 and 212-234
31964010226	HMMPfam hit to PF00892, Protein of unknown function DUF6, score 1.8e-17
31964010227	4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional; Region: PRK03188
31964010228	GHMP kinases C terminal; Region: GHMP_kinases_C; pfam08544
31964010229	HMMPfam hit to PF00288, GHMP kinase, score 1.9e-24
31964010230	16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed; Region: ksgA; PRK00274
31964010231	Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis]; Region: KsgA; COG0030
31964010232	HMMPfam hit to PF00398, Ribosomal RNA adenine methylase transferase, score 1.5e-40
31964010233	PS01131 Ribosomal RNA adenine dimethylases signature.
31964010234	TatD like proteins;  E.coli TatD is a cytoplasmic protein, shown to have magnesium dependent DNase activity; Region: TatD_DNAse; cd01310
31964010235	active site
31964010236	HMMPfam hit to PF01026, TatD-related deoxyribonuclease, score 4.8e-86
31964010237	methionyl-tRNA synthetase; Reviewed; Region: PRK11893
31964010238	catalytic core domain of methioninyl-tRNA synthetases; Region: MetRS_core; cd00814
31964010239	active site
31964010240	HIGH motif; other site
31964010241	KMSKS motif; other site
31964010242	Anticodon-binding domain of methionyl tRNA synthetases; Region: Anticodon_Ia_Met; cd07957
31964010243	tRNA binding surface [nucleotide binding]; other site
31964010244	anticodon binding site; other site
31964010245	HMMPfam hit to PF00133, Aminoacyl-tRNA synthetase,class Ia, score 2.6e-09
31964010246	citrate synthase; Provisional; Region: PRK14033
31964010247	Citrate synthase (CS), citryl-CoA lyase (CCL), the C-terminal portion of the single-subunit type ATP-citrate lyase (ACL) and the C-terminal portion of the large subunit of the two-subunit type ACL. CS catalyzes the condensation of acetyl coenzyme A; Region: CS_ACL-C_CCL; cl00416
31964010248	oxalacetate binding site [chemical binding]; other site
31964010249	citrylCoA binding site [chemical binding]; other site
31964010250	coenzyme A binding site [chemical binding]; other site
31964010251	catalytic triad [active]
31964010252	HMMPfam hit to PF00285, Citrate synthase, score 8e-138
31964010253	PS00480 Citrate synthase signature.
31964010254	Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion]; Region: Lpd; COG1249
31964010255	NAD(P)-binding Rossmann-like domain; Region: NAD_binding_8; cl17500
31964010256	Pyridine nucleotide-disulphide oxidoreductase; Region: Pyr_redox; pfam00070
31964010257	Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain; Region: Pyr_redox_dim; pfam02852
31964010258	HMMPfam hit to PF00070, FAD-dependent pyridine nucleotide-disulphide oxidoreductase, score 2.6e-61
31964010259	PS00076 Pyridine nucleotide-disulphide oxidoreductases class-I active site.
31964010260	HMMPfam hit to PF02852, Pyridine nucleotide-disulphide oxidoreductase dimerisation region,score 2.7e-27
31964010261	HMMPfam hit to PF02525, NAD(P)H dehydrogenase (quinone), score 3.6e-29
31964010262	Protein of unknown function (DUF3021); Region: DUF3021; pfam11457
31964010263	4 probable transmembrane helices predicted for CMS2315 by TMHMM2.0 at aa 21-40, 50-67, 79-101 and 106-128
31964010264	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964010265	RNA repair, ligase-Pnkp-associating, region of Hen1; Region: Hen1_L; pfam12623
31964010266	3' terminal RNA ribose 2'-O-methyltransferase Hen1; Region: bacter_Hen1; TIGR04074
31964010267	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
31964010268	S-adenosylmethionine binding site [chemical binding]; other site
31964010269	polynucleotide kinase-phosphatase; Region: bacter_Pnkp; TIGR04075
31964010270	metallophosphatase superfamily, metallophosphatase domain; Region: MPP_superfamily; cl13995
31964010271	active site
31964010272	metal binding site [ion binding]; metal-binding site
31964010273	PS00017 ATP/GTP-binding site motif A (P-loop).
31964010274	HMMPfam hit to PF00149, Metallophosphoesterase,score 3.6e-14
31964010275	Phosphoenolpyruvate phosphomutase; Region: PEP_mutase; pfam13714
31964010276	Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage. Known members are phosphoenolpyruvate mutase (PEPM), phosphonopyruvate hydrolase (PPH), carboxyPEP mutase (CPEP mutase), oxaloacetate hydrolase (OAH), isocitrate...; Region: ICL_PEPM; cd00377
31964010277	tetramer interface [polypeptide binding]; other site
31964010278	active site
31964010279	Mg2+/Mn2+ binding site [ion binding]; other site
31964010280	PS00161 Isocitrate lyase signature.
31964010281	Uncharacterized protein involved in propionate catabolism [General function prediction only]; Region: PrpD; COG2079
31964010282	HMMPfam hit to PF03972, MmgE/PrpD, score 1.2e-124
31964010283	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cd04301
31964010284	Coenzyme A binding pocket [chemical binding]; other site
31964010285	Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis]; Region: RimL; COG1670
31964010286	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cd04301
31964010287	Coenzyme A binding pocket [chemical binding]; other site
31964010288	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 5e-17
31964010289	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 3.8e-10
31964010290	5 probable transmembrane helices predicted for CMS2322 by TMHMM2.0 at aa 20-42, 52-74, 94-113, 118-140 and 152-169
31964010291	Tyrosine phosphatase family; Region: Y_phosphatase3; pfam13350
31964010292	Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways. The depth of the active site cleft renders the enzyme specific for phosphorylated Tyr; Region: PTPc; cl00053
31964010293	active site
31964010294	Tyrosine phosphatase family C-terminal region; Region: Y_phosphatase3C; pfam13348
31964010295	Cadherin-like beta sandwich domain; Region: Cadherin-like; pfam12733
31964010296	PS00383 Tyrosine specific protein phosphatases active site.
31964010297	1 probable transmembrane helix predicted for CMS2323 by TMHMM2.0 at aa 526-548
31964010298	Sortases are cysteine transpeptidases, found in gram-positive bacteria, that anchor surface proteins to peptidoglycans of the bacterial cell wall envelope. They do so by catalyzing a transpeptidation reaction in which the surface protein substrate is...; Region: Sortase; cl09098
31964010299	active site
31964010300	catalytic site [active]
31964010301	1 probable transmembrane helix predicted for CMS2324 by TMHMM2.0 at aa 13-35
31964010302	Predicted membrane protein [Function unknown]; Region: COG4129
31964010303	5 probable transmembrane helices predicted for CMS2325 by TMHMM2.0 at aa 24-46, 51-70, 77-99, 114-136 and 143-165
31964010304	Carboxylate/Amino Acid/Amine Transporter; Region: 2A78; TIGR00950
31964010305	HMMPfam hit to PF00892, Protein of unknown function DUF6, score 1.3e-10
31964010306	9 probable transmembrane helices predicted for CMS2326 by TMHMM2.0 at aa 15-37, 49-71, 75-97, 104-123,133-152, 164-186, 201-223, 230-252 and 257-275
31964010307	HMMPfam hit to PF00892, Protein of unknown function DUF6, score 3.5e-13
31964010308	Protein of unknown function (DUF1470); Region: DUF1470; pfam07336
31964010309	CGNR zinc finger; Region: zf-CGNR; pfam11706
31964010310	HMMPfam hit to PF07336, Protein of unknown function DUF1470, score 2.2e-16
31964010311	Homeodomain-like domain; Region: HTH_23; cl17451
31964010312	Winged helix-turn helix; Region: HTH_29; pfam13551
31964010313	Integrase core domain; Region: rve; pfam00665
31964010314	Integrase core domain; Region: rve_3; pfam13683
31964010315	Predicted helix-turn-helix motif with score 1316.000, SD 3.67 at aa 25-46, sequence WPVRRAAERFQCSPATASRWAR
31964010316	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.6e-41
31964010317	Predicted methyltransferases [General function prediction only]; Region: COG0313
31964010318	Ribosomal RNA small subunit methyltransferase I, also known as rRNA (cytidine-2'-O-)-methyltransferase RsmI; Region: RsmI; cd11648
31964010319	putative SAM binding site [chemical binding]; other site
31964010320	putative homodimer interface [polypeptide binding]; other site
31964010321	HMMPfam hit to PF00590, Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase, score 2.2e-33
31964010322	PS01296 Uncharacterized protein family UPF0011 signature.
31964010323	2 probable transmembrane helices predicted for CMS2330 by TMHMM2.0 at aa 13-35 and 45-67
31964010324	Predicted membrane protein [Function unknown]; Region: COG2259
31964010325	HMMPfam hit to PF07681, , score 1e-30
31964010326	4 probable transmembrane helices predicted for CMS2332 by TMHMM2.0 at aa 78-95, 105-127, 136-158 and 173-195
31964010327	trehalose synthase, Pseudomonas stutzeri type; Region: TreS_stutzeri; TIGR02455
31964010328	Dolichyl-phosphate-mannose-protein mannosyltransferase; Region: PMT_2; cl17364
31964010329	HMMPfam hit to PF02366, Glycosyl transferase,family 39, score 4.7e-07
31964010330	10 probable transmembrane helices predicted for CMS2336 by TMHMM2.0 at aa 166-188, 195-214, 218-237,289-311, 331-353, 366-388, 448-465, 472-490, 500-519 and 531-553
31964010331	PS00038 Myc-type, 'helix-loop-helix' dimerization domain signature.
31964010332	Conserved hypothetical protein 698; Region: Cons_hypoth698; cl01075
31964010333	10 probable transmembrane helices predicted for CMS2337 by TMHMM2.0 at aa 10-32, 34-53, 73-95, 97-116,126-148, 160-182, 211-233, 253-275, 280-302 and 309-331
31964010334	HMMPfam hit to PF03601, Conserved hypothetical protein 698, score 7.9e-53
31964010335	PS00038 Myc-type, 'helix-loop-helix' dimerization domain signature.
31964010336	This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins; Region: Glo_EDI_BRP_like; cd06587
31964010337	active site
31964010338	metal binding site [ion binding]; metal-binding site
31964010339	Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily; Region: Glyoxalase; pfam00903
31964010340	HMMPfam hit to PF00903, Glyoxalase/bleomycin resistance protein/dioxygenase, score 9.1e-10
31964010341	Predicted transcriptional regulator [Transcription]; Region: COG2378
31964010342	HTH domain; Region: HTH_11; pfam08279
31964010343	WYL domain; Region: WYL; pfam13280
31964010344	Predicted helix-turn-helix motif with score 1336.000, SD 3.74 at aa 55-76, sequence RSARQLAERFEVSSRTIERDLS
31964010345	O-acetylhomoserine sulfhydrylase [Amino acid transport and metabolism]; Region: MET17; COG2873
31964010346	CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis. This pathway is unique to microorganisms and plants, rendering the enzyme an attractive target for the development of...; Region: CGS_like; cd00614
31964010347	homodimer interface [polypeptide binding]; other site
31964010348	substrate-cofactor binding pocket; other site
31964010349	pyridoxal 5'-phosphate binding site [chemical binding]; other site
31964010350	catalytic residue [active]
31964010351	Predicted CoA-binding protein [General function prediction only]; Region: COG1832
31964010352	HMMPfam hit to PF01053, Cys/Met metabolism pyridoxal-phosphate-dependent enzymes, score 8.5e-157
31964010353	PS00868 Cys/Met metabolism enzymes pyridoxal-phosphate attachment site.
31964010354	HMMPfam hit to PF02629, CoA-binding, score 6.4e-14
31964010355	leucine-zipper of insertion element IS481; Region: LZ_Tnp_IS481; pfam13011
31964010356	Winged helix-turn helix; Region: HTH_29; pfam13551
31964010357	Integrase core domain; Region: rve; pfam00665
31964010358	Integrase core domain; Region: rve_3; pfam13683
31964010359	HMMPfam hit to PF00665, Integrase, catalytic region, score 2.1e-37
31964010360	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964010361	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964010362	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964010363	Domain of unknown function (DUF427); Region: DUF427; pfam04248
31964010364	HMMPfam hit to PF04248, Protein of unknown function DUF427, score 8e-33
31964010365	3 probable transmembrane helices predicted for CMS2343 by TMHMM2.0 at aa 29-51, 58-80 and 90-112
31964010366	HMMPfam hit to PF04226, Transglycosylase-associated protein, score 4e-08
31964010367	6 probable transmembrane helices predicted for CMS2344 by TMHMM2.0 at aa 47-66, 81-100, 107-129, 144-166,173-195 and 200-222
31964010368	L-serine dehydratase, iron-sulfur-dependent, single chain form; Region: sda_mono; TIGR00720
31964010369	Serine dehydratase beta chain; Region: SDH_beta; pfam03315
31964010370	Serine dehydratase alpha chain; Region: SDH_alpha; pfam03313
31964010371	HMMPfam hit to PF03315, Serine dehydratase beta chain, score 9.4e-46
31964010372	HMMPfam hit to PF03313, Serine dehydratase alpha chain, score 4.6e-144
31964010373	SdpI/YhfL protein family; Region: SdpI; pfam13630
31964010374	3 probable transmembrane helices predicted for CMS2346 by TMHMM2.0 at aa 5-27, 57-79 and 83-100
31964010375	Homeodomain-like domain; Region: HTH_23; cl17451
31964010376	Winged helix-turn helix; Region: HTH_29; pfam13551
31964010377	Integrase core domain; Region: rve; pfam00665
31964010378	Integrase core domain; Region: rve_3; pfam13683
31964010379	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.6e-38
31964010380	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964010381	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964010382	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964010383	Transcriptional regulator [Transcription]; Region: IclR; COG1414
31964010384	IclR helix-turn-helix domain; Region: HTH_IclR; cl17605
31964010385	Bacterial transcriptional regulator; Region: IclR; pfam01614
31964010386	HMMPfam hit to PF01614, Bacterial regulatory proteins, IclR, score 4.9e-34
31964010387	Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]; Region: WcaG; COG0451
31964010388	extended (e) SDRs; Region: SDR_e; cd08946
31964010389	NAD(P) binding site [chemical binding]; other site
31964010390	active site
31964010391	substrate binding site [chemical binding]; other site
31964010392	PS00061 Short-chain dehydrogenases/reductases family signature.
31964010393	ABC-type sugar transport system, periplasmic component [Carbohydrate transport and metabolism]; Region: UgpB; COG1653
31964010394	Bacterial extracellular solute-binding protein; Region: SBP_bac_1; pfam01547
31964010395	HMMPfam hit to PF01547, Bacterial extracellular solute-binding protein, family 1, score 1.3e-31
31964010396	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964010397	ABC-type polysaccharide transport system, permease component [Carbohydrate transport and metabolism]; Region: LplB; COG4209
31964010398	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964010399	putative PBP binding loops; other site
31964010400	ABC-ATPase subunit interface; other site
31964010401	6 probable transmembrane helices predicted for CMS2352 by TMHMM2.0 at aa 37-59, 99-121, 128-150, 185-207,228-250 and 290-312
31964010402	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 4.7e-07
31964010403	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964010404	ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism]; Region: UgpE; COG0395
31964010405	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964010406	dimer interface [polypeptide binding]; other site
31964010407	conserved gate region; other site
31964010408	putative PBP binding loops; other site
31964010409	ABC-ATPase subunit interface; other site
31964010410	6 probable transmembrane helices predicted for CMS2353 by TMHMM2.0 at aa 37-59, 96-118, 127-149, 164-186,207-229 and 263-285
31964010411	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 1.1e-10
31964010412	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964010413	glucarate dehydratase; Region: glucar-dehydr; TIGR03247
31964010414	Enolase-superfamily, characterized by the presence of an enolate anion intermediate which is generated by abstraction of the alpha-proton of the carboxylate substrate by an active site residue and is stabilized by coordination to the essential Mg2+ ion; Region: enolase_like; cl17188
31964010415	metal binding site [ion binding]; metal-binding site
31964010416	substrate binding pocket [chemical binding]; other site
31964010417	HMMPfam hit to PF02746, Mandelate racemase/muconate lactonizing enzyme, score 0.0012
31964010418	HMMPfam hit to PF01188, Mandelate racemase/muconate lactonizing enzyme, score 7.9e-10
31964010419	5-dehydro-4-deoxyglucarate dehydratase; Provisional; Region: PRK03620
31964010420	Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane]; Region: DapA; COG0329
31964010421	catalytic residue [active]
31964010422	HMMPfam hit to PF00701, Dihydrodipicolinate synthetase, score 5e-55
31964010423	Homeodomain-like domain; Region: HTH_23; cl17451
31964010424	Winged helix-turn helix; Region: HTH_29; pfam13551
31964010425	Integrase core domain; Region: rve; pfam00665
31964010426	Integrase core domain; Region: rve_3; pfam13683
31964010427	Predicted helix-turn-helix motif with score 1316.000, SD 3.67 at aa 25-46, sequence WPVRRAAERFQCSPATASRWAR
31964010428	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.6e-41
31964010429	Highly conserved protein containing a thioredoxin domain [Posttranslational modification, protein turnover, chaperones]; Region: COG1331
31964010430	TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif. The human/rat protein; Region: SSP411; cd02955
31964010431	catalytic residues [active]
31964010432	HMMPfam hit to PF03190, Protein of unknown function DUF255, score 2.1e-41
31964010433	Mg2+ and Co2+ transporters [Inorganic ion transport and metabolism]; Region: CorA; COG0598
31964010434	Mycobacterium tuberculosis CorA-like subfamily; Region: MtCorA-like; cd12830
31964010435	oligomer interface [polypeptide binding]; other site
31964010436	metal binding site [ion binding]; metal-binding site
31964010437	metal binding site [ion binding]; metal-binding site
31964010438	putative Cl binding site [ion binding]; other site
31964010439	basic sphincter; other site
31964010440	hydrophobic gate; other site
31964010441	periplasmic entrance; other site
31964010442	HMMPfam hit to PF01544, Mg2+ transporter protein,CorA-like, score 6.6e-47
31964010443	2 probable transmembrane helices predicted for CMS2358 by TMHMM2.0 at aa 331-350 and 360-382
31964010444	HMMPfam hit to PF00248, Aldo/keto reductase, score 1.3e-106
31964010445	long-chain-fatty-acid--CoA ligase; Validated; Region: PRK07656
31964010446	Prokaryotic long-chain fatty acid CoA synthetases similar to Escherichia coli FadD; Region: FC-FACS_FadD_like; cd05936
31964010447	acyl-activating enzyme (AAE) consensus motif; other site
31964010448	putative AMP binding site [chemical binding]; other site
31964010449	putative active site [active]
31964010450	putative CoA binding site [chemical binding]; other site
31964010451	HMMPfam hit to PF00501, AMP-dependent synthetase and ligase, score 1.4e-125
31964010452	PS00455  AMP-binding domain signature.
31964010453	ATP-dependent RNA helicase HrpA; Provisional; Region: PRK11131
31964010454	DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region; Region: DEXDc; cd00046
31964010455	ATP binding site [chemical binding]; other site
31964010456	putative Mg++ binding site [ion binding]; other site
31964010457	Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may...; Region: HELICc; cd00079
31964010458	nucleotide binding region [chemical binding]; other site
31964010459	ATP-binding site [chemical binding]; other site
31964010460	Helicase associated domain (HA2); Region: HA2; pfam04408
31964010461	Oligonucleotide/oligosaccharide-binding (OB)-fold; Region: OB_NTP_bind; pfam07717
31964010462	Domain of unknown function (DUF3418); Region: DUF3418; pfam11898
31964010463	HMMPfam hit to PF00270, DEAD/DEAH box helicase,N-terminal, score 1e-09
31964010464	PS00017 ATP/GTP-binding site motif A (P-loop).
31964010465	HMMPfam hit to PF00271, Helicase, C-terminal, score 2e-10
31964010466	HMMPfam hit to PF04408, Helicase-associated region,score 1.4e-21
31964010467	HMMPfam hit to PF07717, DUF1605, score 1.1e-18
31964010468	Solute carrier families 5 and 6-like; solute binding domain; Region: SLC5-6-like_sbd; cl00456
31964010469	12 probable transmembrane helices predicted for CMS2362 by TMHMM2.0 at aa 51-73, 86-108, 121-143, 158-180,193-215, 225-247, 268-287, 326-348, 369-388, 398-420,441-463 and 468-490
31964010470	Transcriptional regulators [Transcription]; Region: FadR; COG2186
31964010471	Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators; Region: WHTH_GntR; cd07377
31964010472	DNA-binding site [nucleotide binding]; DNA binding site
31964010473	FCD domain; Region: FCD; pfam07729
31964010474	HMMPfam hit to PF00392, Bacterial regulatory protein, GntR, score 5.3e-13
31964010475	PS00043 Bacterial regulatory proteins, gntR family signature.
31964010476	HMMPfam hit to PF07729, FCD domain, score 1.2e-14
31964010477	urea carboxylase; Region: urea_carbox; TIGR02712
31964010478	Carbamoyl-phosphate synthase L chain, N-terminal domain; Region: CPSase_L_chain; pfam00289
31964010479	ATP-grasp domain; Region: ATP-grasp_4; cl17255
31964010480	Biotin carboxylase C-terminal domain; Region: Biotin_carb_C; pfam02785
31964010481	Allophanate hydrolase subunit 2; Region: AHS2; smart00797
31964010482	Allophanate hydrolase subunit 1 [Amino acid transport and metabolism]; Region: DUR1; cl00896
31964010483	The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase; Region: biotinyl_domain; cd06850
31964010484	carboxyltransferase (CT) interaction site; other site
31964010485	biotinylation site [posttranslational modification]; other site
31964010486	HMMPfam hit to PF00289, Carbamoyl-phosphate synthetase large chain, N-terminal, score 1.8e-37
31964010487	HMMPfam hit to PF02786, Carbamoyl-phosphate synthase L chain, ATP-binding, score 4.8e-78
31964010488	PS00866 Carbamoyl-phosphate synthase subdomain signature 1.
31964010489	PS00867 Carbamoyl-phosphate synthase subdomain signature 2.
31964010490	HMMPfam hit to PF02785, Biotin carboxylase,C-terminal, score 1e-37
31964010491	HMMPfam hit to PF02626, Urea amidolyase-related,score 1.2e-78
31964010492	HMMPfam hit to PF02682, Protein of unknown function DUF213, score 0.0024
31964010493	HMMPfam hit to PF00364, Biotin/lipoyl attachment,score 7.7e-13
31964010494	allophanate hydrolase; Provisional; Region: PRK08186
31964010495	Amidase; Region: Amidase; cl11426
31964010496	HMMPfam hit to PF01425, Amidase, score 3.3e-83
31964010497	PS00017 ATP/GTP-binding site motif A (P-loop).
31964010498	Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates...; Region: NK; cl17190
31964010499	AAA domain; Region: AAA_18; pfam13238
31964010500	active site
31964010501	PS00017 ATP/GTP-binding site motif A (P-loop).
31964010502	Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism]; Region: SseA; COG2897
31964010503	Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein. The cysteine containing enzymatically active version of the domain is also found in the Cdc25 class of protein phosphatases and a variety of proteins...; Region: RHOD; cl00125
31964010504	active site residue [active]
31964010505	Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein. The cysteine containing enzymatically active version of the domain is also found in the Cdc25 class of protein phosphatases and a variety of proteins...; Region: RHOD; cl00125
31964010506	active site residue [active]
31964010507	HMMPfam hit to PF00581, Rhodanese-like, score 9e-08
31964010508	HMMPfam hit to PF00581, Rhodanese-like, score 6.9e-06
31964010509	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cd04301
31964010510	Coenzyme A binding pocket [chemical binding]; other site
31964010511	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 2.6e-16
31964010512	Ribonucleotide Reductase, R2/beta subunit, ferritin-like diiron-binding domain; Region: RNRR2; cd01049
31964010513	dimer interface [polypeptide binding]; other site
31964010514	putative radical transfer pathway; other site
31964010515	diiron center [ion binding]; other site
31964010516	tyrosyl radical; other site
31964010517	HMMPfam hit to PF00268, Ribonucleotide reductase,score 7.4e-31
31964010518	1 probable transmembrane helix predicted for CMS2369 by TMHMM2.0 at aa 167-189
31964010519	ribonucleotide-diphosphate reductase subunit alpha; Validated; Region: PRK06539
31964010520	ATP cone domain; Region: ATP-cone; pfam03477
31964010521	Class I ribonucleotide reductase; Region: RNR_I; cd01679
31964010522	active site
31964010523	dimer interface [polypeptide binding]; other site
31964010524	catalytic residues [active]
31964010525	effector binding site; other site
31964010526	R2 peptide binding site; other site
31964010527	HMMPfam hit to PF02867, Ribonucleotide reductase large subunit, score 5.5e-137
31964010528	PS00089 Ribonucleotide reductase large subunit signature.
31964010529	HMMPfam hit to PF00317, Ribonucleotide reductase large subunit, score 3.3e-11
31964010530	HMMPfam hit to PF03477, ATP-cone, score 7.5e-12
31964010531	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
31964010532	Major Facilitator Superfamily; Region: MFS_1; pfam07690
31964010533	putative substrate translocation pore; other site
31964010534	12 probable transmembrane helices predicted for CMS2373 by TMHMM2.0 at aa 12-34, 44-66, 73-95, 105-127,148-165, 169-191, 212-234, 244-266, 278-300, 304-323,330-352 and 356-378
31964010535	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964010536	Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols. AKRs are present in all phyla and are of importance to both health and industrial...; Region: Aldo_ket_red; cd06660
31964010537	Aldo/keto reductase family; Region: Aldo_ket_red; pfam00248
31964010538	active site
31964010539	catalytic tetrad [active]
31964010540	HMMPfam hit to PF00248, Aldo/keto reductase, score 7.8e-25
31964010541	2 probable transmembrane helices predicted for CMS2376 by TMHMM2.0 at aa 5-27 and 47-69
31964010542	Trypsin-like peptidase domain; Region: Trypsin_2; pfam13365
31964010543	PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis. May be responsible for substrate recognition and/or binding, as most PDZ domains bind...; Region: PDZ_serine_protease; cd00987
31964010544	1 probable transmembrane helix predicted for CMS2377 by TMHMM2.0 at aa 46-68
31964010545	HMMPfam hit to PF00089, Peptidase S1, chymotrypsin,score 2.6e-10
31964010546	HMMPfam hit to PF00595, PDZ/DHR/GLGF, score 1.1e-07
31964010547	Helix-turn-helix domain; Region: HTH_38; pfam13936
31964010548	Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair]; Region: Tra8; COG2826
31964010549	Integrase core domain; Region: rve; pfam00665
31964010550	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.8e-28
31964010551	PS01043 Transposases, IS30 family, signature.
31964010552	Predicted helix-turn-helix motif with score 1119.000, SD 3.00 at aa 43-64, sequence MSRRVAASRVGVHERTAQDWDR
31964010553	PS00017 ATP/GTP-binding site motif A (P-loop).
31964010554	Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators; Region: WHTH_GntR; cd07377
31964010555	Transcriptional regulators [Transcription]; Region: GntR; COG1802
31964010556	DNA-binding site [nucleotide binding]; DNA binding site
31964010557	FCD domain; Region: FCD; pfam07729
31964010558	HMMPfam hit to PF07729, FCD domain, score 2.7e-18
31964010559	HMMPfam hit to PF00392, Bacterial regulatory protein, GntR, score 7.7e-05
31964010560	Triosephosphate isomerase (TIM) is a glycolytic enzyme that catalyzes the interconversion of dihydroxyacetone phosphate and D-glyceraldehyde-3-phosphate. The reaction is very efficient and requires neither cofactors nor metal ions. TIM, usually...; Region: TIM; cd00311
31964010561	substrate binding site [chemical binding]; other site
31964010562	dimer interface [polypeptide binding]; other site
31964010563	catalytic triad [active]
31964010564	HMMPfam hit to PF00121, Triosephosphate isomerase,score 1.1e-14
31964010565	Ribose/Galactose Isomerase; Region: LacAB_rpiB; pfam02502
31964010566	HMMPfam hit to PF02502, Ribose/galactose isomerase,score 2.7e-26
31964010567	dihydroxyacetone kinase; Provisional; Region: PRK14479
31964010568	dihydroxyacetone kinase subunit DhaK; Provisional; Region: PRK14481; cl10557
31964010569	DAK2 domain; Region: Dak2; pfam02734
31964010570	HMMPfam hit to PF02734, Dak phosphatase, score 1.5e-38
31964010571	HMMPfam hit to PF02733, Dak kinase, score 2.2e-104
31964010572	Transcriptional regulators [Transcription]; Region: PhnF; COG2188
31964010573	Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators; Region: WHTH_GntR; cd07377
31964010574	DNA-binding site [nucleotide binding]; DNA binding site
31964010575	UTRA domain; Region: UTRA; pfam07702
31964010576	HMMPfam hit to PF07702, UbiC transcription regulator-associated, score 7.5e-47
31964010577	HMMPfam hit to PF00392, Bacterial regulatory protein, GntR, score 5.1e-15
31964010578	Predicted helix-turn-helix motif with score 1631.000, SD 4.74 at aa 27-48, sequence ENEIALGNRLGLSRPTIRRAIQ
31964010579	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
31964010580	urea ABC transporter, ATP-binding protein UrtE; Region: urea_trans_UrtE; TIGR03410
31964010581	Walker A/P-loop; other site
31964010582	ATP binding site [chemical binding]; other site
31964010583	Q-loop/lid; other site
31964010584	ABC transporter signature motif; other site
31964010585	Walker B; other site
31964010586	D-loop; other site
31964010587	H-loop/switch region; other site
31964010588	HMMPfam hit to PF00005, ABC transporter, score 2.7e-47
31964010589	PS00211 ABC transporters family signature.
31964010590	PS00017 ATP/GTP-binding site motif A (P-loop).
31964010591	Branched-chain amino acid transport system / permease component; Region: BPD_transp_2; pfam02653
31964010592	Transmembrane subunit (TM) of Escherichia coli AraH and related proteins. E. coli AraH is the TM of a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of the monosaccharide arabinose. This group...; Region: TM_PBP1_transp_AraH_like; cd06579
31964010593	TM-ABC transporter signature motif; other site
31964010594	8 probable transmembrane helices predicted for CMS2387 by TMHMM2.0 at aa 30-52, 67-98, 105-127, 137-159,179-201, 240-262, 274-305 and 320-339
31964010595	HMMPfam hit to PF02653, Bacterial inner-membrane translocator, score 4.9e-68
31964010596	leucine-zipper of insertion element IS481; Region: LZ_Tnp_IS481; pfam13011
31964010597	Winged helix-turn helix; Region: HTH_29; pfam13551
31964010598	Integrase core domain; Region: rve; pfam00665
31964010599	Integrase core domain; Region: rve_3; pfam13683
31964010600	HMMPfam hit to PF00665, Integrase, catalytic region, score 2.5e-37
31964010601	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 10-31, sequence AGPARLAPVTGVPSRTISRILR
31964010602	Uncharacterized subfamily of the multidrug and toxic compound extrusion (MATE) proteins; Region: MATE_tuaB_like; cd13127
31964010603	11 probable transmembrane helices predicted for CMS2389 by TMHMM2.0 at aa 63-85, 98-120, 130-147, 167-189,193-212, 311-333, 343-365, 372-391, 395-417, 430-452 and 462-484
31964010604	HMMPfam hit to PF01943, Polysaccharide biosynthesis protein, score 1.6e-50
31964010605	Glycosyltransferase [Cell envelope biogenesis, outer membrane]; Region: RfaG; COG0438
31964010606	Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate...; Region: Glycosyltransferase_GTB_type; cl10013
31964010607	Predicted glycosyltransferases [General function prediction only]; Region: COG1216
31964010608	Subfamily of Glycosyltransferase Family GT2 of unknown function; Region: GT_2_like_c; cd04186
31964010609	Probable Catalytic site; other site
31964010610	metal-binding site
31964010611	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold; Region: Glyco_tranf_GTA_type; cl11394
31964010612	active site
31964010613	HMMPfam hit to PF00535, Glycosyl transferase,family 2, score 0.0023
31964010614	HMMPfam hit to PF00535, Glycosyl transferase,family 2, score 1e-17
31964010615	1 probable transmembrane helix predicted for CMS2392 by TMHMM2.0 at aa 29-51
31964010616	FAD binding domain of DNA photolyase; Region: FAD_binding_7; pfam03441
31964010617	PS00017 ATP/GTP-binding site motif A (P-loop).
31964010618	Predicted transcriptional regulators [Transcription]; Region: HipB; COG1396
31964010619	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
31964010620	non-specific DNA binding site [nucleotide binding]; other site
31964010621	salt bridge; other site
31964010622	sequence-specific DNA binding site [nucleotide binding]; other site
31964010623	HMMPfam hit to PF01381, Helix-turn-helix motif,score 4.4e-13
31964010624	Predicted helix-turn-helix motif with score 1820.000, SD 5.39 at aa 29-50, sequence WTQERLAKTSGITVRTVQRLEA
31964010625	2 probable transmembrane helices predicted for CMS2394 by TMHMM2.0 at aa 109-131 and 136-158
31964010626	Phosphoribosyl transferase (PRT)-type I domain; Region: PRTases_typeI; cd06223
31964010627	active site
31964010628	HMMPfam hit to PF00156, Phosphoribosyltransferase,score 2.9e-13
31964010629	Helix-turn-helix domain; Region: HTH_17; pfam12728
31964010630	Predicted helix-turn-helix motif with score 1537.000, SD 4.42 at aa 6-27, sequence ESVAEFAKRAGVSPRRVRALIE
31964010631	HMMPfam hit to PF00376, Bacterial regulatory protein, MerR, score 0.00057
31964010632	Chain length determinant protein; Region: Wzz; cl15801
31964010633	capsular exopolysaccharide family; Region: eps_fam; TIGR01007
31964010634	The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain. Functionally, proteins in this superfamily use the energy from hydrolysis of NTP to transfer electron or ion; Region: Fer4_NifH; cl17203
31964010635	HMMPfam hit to PF02706, Lipopolysaccharide biosynthesis, score 8.3e-18
31964010636	1 probable transmembrane helix predicted for CMS2399 by TMHMM2.0 at aa 13-35
31964010637	11 probable transmembrane helices predicted for CMS2400 by TMHMM2.0 at aa 10-30, 37-59, 64-81, 88-110,114-131, 144-166, 198-220, 233-255, 265-287, 345-367 and 382-404
31964010638	Homeodomain-like domain; Region: HTH_23; cl17451
31964010639	Winged helix-turn helix; Region: HTH_29; pfam13551
31964010640	Integrase core domain; Region: rve; pfam00665
31964010641	Integrase core domain; Region: rve_3; pfam13683
31964010642	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.6e-38
31964010643	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964010644	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964010645	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964010646	Gamma-aminobutyrate permease and related permeases [Amino acid transport and metabolism]; Region: AnsP; COG1113
31964010647	HMMPfam hit to PF00324, Amino acid permease-associated region, score 5.4e-133
31964010648	13 probable transmembrane helices predicted for CMS2403 by TMHMM2.0 at aa 15-37, 44-63, 78-97, 99-118,122-144, 151-173, 193-215, 235-257, 277-299, 326-348,353-372, 393-415 and 419-438
31964010649	PS00218 Amino acid permeases signature.
31964010650	Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction; Region: HP_PGM_like; cd07067
31964010651	catalytic core [active]
31964010652	HMMPfam hit to PF00300,Phosphoglycerate/bisphosphoglycerate mutase, score 1.1e-16
31964010653	Protein of unknown function (DUF3090); Region: DUF3090; pfam11290
31964010654	conserved hypothetical protein; Region: TIGR03843
31964010655	HMMPfam hit to PF00454, Phosphatidylinositol 3- and 4-kinase, score 8.4e-05
31964010656	submitted with no further information
31964010657	Predicted ATP-binding protein involved in virulence [General function prediction only]; Region: COG3950
31964010658	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
31964010659	ABC transporter signature motif; other site
31964010660	Walker B; other site
31964010661	D-loop; other site
31964010662	H-loop/switch region; other site
31964010663	PS00017 ATP/GTP-binding site motif A (P-loop).
31964010664	GTP-binding protein YchF; Reviewed; Region: PRK09601
31964010665	YchF GTPase; Region: YchF; cd01900
31964010666	G1 box; other site
31964010667	GTP/Mg2+ binding site [chemical binding]; other site
31964010668	Switch I region; other site
31964010669	G2 box; other site
31964010670	Switch II region; other site
31964010671	G3 box; other site
31964010672	G4 box; other site
31964010673	G5 box; other site
31964010674	TGS_YchF_C: This subfamily represents TGS domain-containing YchF GTP-binding protein, a universally conserved GTPase whose function is unknown. The N-terminal domain of the YchF protein belongs to the Obg-like family of GTPases, and some members of the...; Region: TGS_YchF_C; cd04867
31964010675	HMMPfam hit to PF06071, Conserved hypothetical protein 92, score 1.2e-58
31964010676	HMMPfam hit to PF01926, GTP-binding protein,HSR1-related, score 1.1e-34
31964010677	PS00017 ATP/GTP-binding site motif A (P-loop).
31964010678	an uncharacterized bacterial subgroup of the DEDDh 3'-5' exonuclease domain family with similarity to the epsilon subunit of DNA polymerase III; Region: DNA_pol_III_epsilon_like; cd06130
31964010679	active site
31964010680	catalytic site [active]
31964010681	substrate binding site [chemical binding]; other site
31964010682	HMMPfam hit to PF00929, Exonuclease, score 2.7e-19
31964010683	RmuC family; Region: RmuC; pfam02646
31964010684	1 probable transmembrane helix predicted for CMS2412 by TMHMM2.0 at aa 5-27
31964010685	HMMPfam hit to PF02646, Protein of unknown function DUF195, score 5.5e-65
31964010686	fructose-bisphosphate aldolase; Provisional; Region: PRK09197
31964010687	Fructose/tagarose-bisphosphate aldolase class II. This family includes fructose-1,6-bisphosphate (FBP) and tagarose 1,6-bisphosphate (TBP) aldolases. FBP-aldolase is homodimeric and used in gluconeogenesis and glycolysis; the enzyme controls the...; Region: FTBP_aldolase_II; cl17181
31964010688	active site
31964010689	intersubunit interface [polypeptide binding]; other site
31964010690	zinc binding site [ion binding]; other site
31964010691	Na+ binding site [ion binding]; other site
31964010692	HMMPfam hit to PF01116, Ketose-bisphosphate aldolase, class-II, score 2.3e-106
31964010693	PS00806 Fructose-bisphosphate aldolase class-II signature 2.
31964010694	3 probable transmembrane helices predicted for CMS2414 by TMHMM2.0 at aa 167-189, 214-236 and 248-270
31964010695	4-Hydroxy-3-methylbut-2-enyl diphosphate reductase IspH [Lipid metabolism]; Region: lytB; COG0761
31964010696	4-hydroxy-3-methylbut-2-enyl diphosphate reductase; Reviewed; Region: ispH; PRK01045
31964010697	HMMPfam hit to PF02401, LytB protein, score 4.5e-151
31964010698	PS00339 Aminoacyl-transfer RNA synthetases class-II signature 2.
31964010699	exodeoxyribonuclease VII large subunit; Reviewed; Region: xseA; PRK00286
31964010700	ExoVII_LU_OBF: A subfamily of OB folds corresponding to the N-terminal OB-fold domain of Escherichia coli exodeoxyribonuclease VII (ExoVII) large subunit. E. coli ExoVII is composed of two non-identical subunits. E. coli ExoVII is a...; Region: ExoVII_LU_OBF; cd04489
31964010701	generic binding surface II; other site
31964010702	generic binding surface I; other site
31964010703	HMMPfam hit to PF01336, OB-fold nucleic acid binding, score 0.0015
31964010704	HMMPfam hit to PF02601, Exonuclease VII, large subunit, score 1.1e-23
31964010705	exodeoxyribonuclease VII small subunit; Provisional; Region: PRK00977
31964010706	HMMPfam hit to PF02609, Exonuclease VII, small subunit, score 5.2e-19
31964010707	Protein of unknown function (DUF4245); Region: DUF4245; pfam14030
31964010708	1 probable transmembrane helix predicted for CMS2418 by TMHMM2.0 at aa 41-60
31964010709	Carbonic anhydrases (CA) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism in which the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide is followed by the regeneration of an...; Region: beta_CA; cl00391
31964010710	active site clefts [active]
31964010711	zinc binding site [ion binding]; other site
31964010712	dimer interface [polypeptide binding]; other site
31964010713	HMMPfam hit to PF00484, Carbonic anhydrase,prokaryotic and plant, score 4.6e-09
31964010714	PS00704 Prokaryotic-type carbonic anhydrases signature 1.
31964010715	PS00705 Prokaryotic-type carbonic anhydrases signature 2.
31964010716	fumarate hydratase; Reviewed; Region: fumC; PRK00485
31964010717	Class II fumarases; Region: Fumarase_classII; cd01362
31964010718	active site
31964010719	tetramer interface [polypeptide binding]; other site
31964010720	HMMPfam hit to PF00206, Fumarate lyase, score 4.4e-129
31964010721	PS00163 Fumarate lyases signature.
31964010722	NYN ribonuclease and ATPase of PhoH family domains [General    function prediction only]; Region: COG1875
31964010723	PIN domain of bacterial Smg6-like homologs with PhoH-like ATPase domains; Region: PIN_PhoHL-ATPase; cd09883
31964010724	putative active site [active]
31964010725	PhoH-like protein; Region: PhoH; pfam02562
31964010726	HMMPfam hit to PF02562, PhoH-like protein, score 7.6e-34
31964010727	PS00017 ATP/GTP-binding site motif A (P-loop).
31964010728	Cis (Z)-Isoprenyl Diphosphate Synthases (cis-IPPS); homodimers which catalyze the successive 1'-4 condensation of the isopentenyl diphosphate (IPP) molecule to trans,trans-farnesyl diphosphate (FPP) or to cis,trans-FPP to form long-chain polyprenyl...; Region: CIS_IPPS; cl00230
31964010729	Putative undecaprenyl diphosphate synthase; Region: Prenyltransf; pfam01255
31964010730	catalytic residue [active]
31964010731	putative FPP diphosphate  binding site; other site
31964010732	putative FPP binding hydrophobic cleft; other site
31964010733	dimer interface [polypeptide binding]; other site
31964010734	putative IPP diphosphate binding site; other site
31964010735	HMMPfam hit to PF01255,Di-trans-poly-cis-decaprenylcistransferase, score 1.1e-77
31964010736	PS01066 Undecaprenyl pyrophosphate synthetase family signature.
31964010737	Haemolysin-III related; Region: HlyIII; pfam03006
31964010738	HMMPfam hit to PF03006, Hly-III related proteins,score 2.9e-54
31964010739	7 probable transmembrane helices predicted for CMS2424 by TMHMM2.0 at aa 46-68, 75-97, 112-131, 136-158,163-181, 188-210 and 225-247
31964010740	Bacterial extracellular solute-binding protein; Region: SBP_bac_8; pfam13416
31964010741	Bacterial extracellular solute-binding protein; Region: SBP_bac_1; cl17199
31964010742	HMMPfam hit to PF01547, Bacterial extracellular solute-binding protein, family 1, score 2.2e-19
31964010743	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964010744	ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism]; Region: UgpE; COG0395
31964010745	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964010746	dimer interface [polypeptide binding]; other site
31964010747	conserved gate region; other site
31964010748	putative PBP binding loops; other site
31964010749	ABC-ATPase subunit interface; other site
31964010750	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 4.3e-09
31964010751	6 probable transmembrane helices predicted for CMS2426 by TMHMM2.0 at aa 13-35, 79-101, 106-123, 133-155,182-204 and 239-261
31964010752	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964010753	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964010754	dimer interface [polypeptide binding]; other site
31964010755	conserved gate region; other site
31964010756	ABC-ATPase subunit interface; other site
31964010757	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 1.2e-21
31964010758	6 probable transmembrane helices predicted for CMS2427 by TMHMM2.0 at aa 45-64, 109-131, 144-163,194-216, 237-259 and 300-322
31964010759	1 probable transmembrane helix predicted for CMS2429 by TMHMM2.0 at aa 31-53
31964010760	GlcNAc-PI de-N-acetylase; Region: PIG-L; cl00929
31964010761	HMMPfam hit to PF02585, LmbE-like protein, score 2.7e-39
31964010762	Domain of unknown function (DUF4307); Region: DUF4307; pfam14155
31964010763	1 probable transmembrane helix predicted for CMS2431 by TMHMM2.0 at aa 50-72
31964010764	transcription elongation factor GreA; Reviewed; Region: greA; PRK00226
31964010765	Transcription elongation factor, N-terminal; Region: GreA_GreB_N; pfam03449
31964010766	Transcription elongation factor, GreA/GreB, C-term; Region: GreA_GreB; pfam01272
31964010767	HMMPfam hit to PF03449, Prokaryotic transcription elongation factor GreA/GreB, score 4.6e-30
31964010768	HMMPfam hit to PF01272, Prokaryotic transcription elongation factor GreA/GreB, score 0.00016
31964010769	threonine dehydratase; Provisional; Region: PRK08198
31964010770	Threonine dehydratase: The first step in amino acid degradation is the removal of nitrogen. Although the nitrogen atoms of most amino acids are transferred to alpha-ketoglutarate before removal, the alpha-amino group of threonine can be directly...; Region: Thr-dehyd; cd01562
31964010771	tetramer interface [polypeptide binding]; other site
31964010772	pyridoxal 5'-phosphate binding site [chemical binding]; other site
31964010773	catalytic residue [active]
31964010774	C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains; Region: ACT_ThrD-II-like; cd04886
31964010775	HMMPfam hit to PF01842, Amino acid-binding ACT,score 1.6e-06
31964010776	HMMPfam hit to PF00291,Pyridoxal-5'-phosphate-dependent enzyme, beta subunit,score 9.8e-77
31964010777	PS00165 Serine/threonine dehydratases pyridoxal-phosphate attachment site.
31964010778	Predicted permease, member of the PurR regulon [General function prediction only]; Region: yhhT; COG0628
31964010779	HMMPfam hit to PF01594, Protein of unknown function UPF0118, score 7e-53
31964010780	8 probable transmembrane helices predicted for CMS2434 by TMHMM2.0 at aa 7-26, 30-52, 65-87, 155-177,207-229, 239-261, 268-290 and 305-327
31964010781	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG3214
31964010782	Protein of unknown function (DUF1006); Region: DUF1006; pfam06224
31964010783	HMMPfam hit to PF06224, Protein of unknown function DUF1006, score 9.2e-131
31964010784	GyrI-like small molecule binding domain; Region: GyrI-like; cl01368
31964010785	Uncharacterized conserved protein [Function unknown]; Region: LemA; COG1704
31964010786	HMMPfam hit to PF04011, LemA, score 3.7e-59
31964010787	1 probable transmembrane helix predicted for CMS2437 by TMHMM2.0 at aa 4-26
31964010788	Glycosyl hydrolase family 1; Region: Glyco_hydro_1; cl01046
31964010789	beta-galactosidase; Region: BGL; TIGR03356
31964010790	HMMPfam hit to PF00232, Glycoside hydrolase, family 1, score 5e-44
31964010791	8 probable transmembrane helices predicted for CMS2439 by TMHMM2.0 at aa 30-52, 418-440, 523-545,555-577, 634-656, 671-693, 705-727 and 731-753
31964010792	amino acid transporter; Region: 2A0306; TIGR00909
31964010793	C-terminus of AA_permease; Region: AA_permease_C; pfam13906
31964010794	13 probable transmembrane helices predicted for CMS2440 by TMHMM2.0 at aa 39-61, 68-90, 100-119, 124-146,166-185, 198-220, 225-247, 267-289, 313-335, 366-385,389-408, 421-443 and 447-464
31964010795	HMMPfam hit to PF00324, Amino acid permease-associated region, score 1.2e-36
31964010796	PS00038 Myc-type, 'helix-loop-helix' dimerization domain signature.
31964010797	Ferritin-like domain; Region: Ferritin_2; pfam13668
31964010798	1 probable transmembrane helix predicted for CMS2441 by TMHMM2.0 at aa 24-46
31964010799	Beta-mannanase [Carbohydrate transport and metabolism]; Region: ManB; COG4124
31964010800	OpgC protein; Region: OpgC_C; pfam10129
31964010801	Acyltransferase family; Region: Acyl_transf_3; pfam01757
31964010802	HMMPfam hit to PF01757, Acyltransferase 3, score 0.00063
31964010803	12 probable transmembrane helices predicted for CMS2442 by TMHMM2.0 at aa 20-42, 455-477, 498-515,525-547, 568-590, 645-667, 672-691, 701-720, 732-754,786-805, 812-834 and 849-866
31964010804	Histidine kinase-like ATPase domain; Region: HATPase_c_2; pfam13581
31964010805	Sulphate Transporter and Anti-Sigma factor antagonist) domain of anti-anti-sigma factors, key regulators of anti-sigma factors by phosphorylation; Region: STAS_anti-anti-sigma_factors; cd07043
31964010806	Sulfate permease and related transporters (MFS superfamily) [Inorganic ion transport and metabolism]; Region: SUL1; COG0659
31964010807	anti sigma factor interaction site; other site
31964010808	regulatory phosphorylation site [posttranslational modification]; other site
31964010809	HMMPfam hit to PF01740, Sulfate transporter/antisigma-factor antagonist STAS, score 2.3e-15
31964010810	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold; Region: Glyco_tranf_GTA_type; cl11394
31964010811	active site
31964010812	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold; Region: Glyco_tranf_GTA_type; cl11394
31964010813	7 probable transmembrane helices predicted for CMS2445 by TMHMM2.0 at aa 20-42, 49-71, 492-514, 524-543,556-575, 603-622 and 629-651
31964010814	HMMPfam hit to PF00535, Glycosyl transferase,family 2, score 3.4e-09
31964010815	FOG: GAF domain [Signal transduction mechanisms]; Region: FhlA; COG2203
31964010816	GAF domain; Region: GAF; pfam01590
31964010817	Stage II sporulation protein E (SpoIIE); Region: SpoIIE; pfam07228
31964010818	HMMPfam hit to PF07228, Stage II sporulation E,score 1.9e-25
31964010819	HMMPfam hit to PF01590, GAF, score 2.6e-18
31964010820	Predicted acyltransferases [Lipid metabolism]; Region: COG1835
31964010821	HMMPfam hit to PF01757, Acyltransferase 3, score 2.3e-06
31964010822	9 probable transmembrane helices predicted for CMS2447 by TMHMM2.0 at aa 28-50, 71-93, 131-153, 160-182,186-205, 212-231, 235-257, 278-300 and 310-332
31964010823	submitted with no further information
31964010824	Uncharacterized phage-associated protein [Function unknown]; Region: GepA; COG3600
31964010825	NADH dehydrogenase, FAD-containing subunit [Energy production and conversion]; Region: Ndh; COG1252
31964010826	Pyridine nucleotide-disulphide oxidoreductase; Region: Pyr_redox; pfam00070
31964010827	HMMPfam hit to PF00070, FAD-dependent pyridine nucleotide-disulphide oxidoreductase, score 1.4e-07
31964010828	Peptidase domain in the S8 and S53 families; Region: Peptidases_S8_S53; cl10459
31964010829	Peptidase domain in the S8 and S53 families; Region: Peptidases_S8_S53; cd00306
31964010830	active site
31964010831	catalytic residues [active]
31964010832	1 probable transmembrane helix predicted for CMS2453 by TMHMM2.0 at aa 379-401
31964010833	HMMPfam hit to PF00082, Peptidase S8 and S53,subtilisin, kexin, sedolisin, score 2.3e-37
31964010834	PS00138 Serine proteases, subtilase family, serine active site.
31964010835	PS00137 Serine proteases, subtilase family,histidine active site.
31964010836	PS00141 Eukaryotic and viral aspartyl proteases active site.
31964010837	Protein of unknown function (DUF501); Region: DUF501; pfam04417
31964010838	HMMPfam hit to PF04417, Protein of unknown function DUF501, score 1.9e-46
31964010839	PS00430 TonB-dependent receptor proteins signature 1.
31964010840	Septum formation initiator; Region: DivIC; pfam04977
31964010841	1 probable transmembrane helix predicted for CMS2455 by TMHMM2.0 at aa 43-65
31964010842	enolase; Provisional; Region: eno; PRK00077
31964010843	Enolase: Enolases are homodimeric enzymes that catalyse the reversible dehydration of 2-phospho-D-glycerate to phosphoenolpyruvate as part of the glycolytic and gluconeogenesis pathways. The reaction is facilitated by the presence of metal ions; Region: enolase; cd03313
31964010844	dimer interface [polypeptide binding]; other site
31964010845	metal binding site [ion binding]; metal-binding site
31964010846	substrate binding pocket [chemical binding]; other site
31964010847	HMMPfam hit to PF00113, Enolase, score 2.3e-168
31964010848	PS00164 Enolase signature.
31964010849	HMMPfam hit to PF03952, Enolase, score 9.7e-65
31964010850	histidyl-tRNA synthetase; Provisional; Region: PRK12420
31964010851	Class II Histidinyl-tRNA synthetase (HisRS)-like catalytic core domain. HisRS is a homodimer. It is responsible for the attachment of histidine to the 3' OH group of ribose of the appropriate tRNA. This domain is primarily responsible for...; Region: HisRS-like_core; cd00773
31964010852	dimer interface [polypeptide binding]; other site
31964010853	motif 1; other site
31964010854	active site
31964010855	motif 2; other site
31964010856	motif 3; other site
31964010857	HMMPfam hit to PF00587, tRNA synthetases, class-II (G, H, P and S), score 4.7e-18
31964010858	Transcriptional regulator [Transcription]; Region: AcrR; COG1309
31964010859	nucleoside triphosphate pyrophosphohydrolase; Reviewed; Region: PRK12334
31964010860	Nucleoside Triphosphate Pyrophosphohydrolase (EC 3.6.1.8) N-terminal tandem-domain of MazG proteins from Escherichia coli and bacterial homologs; Region: NTP-PPase_MazG_Nterm; cd11528
31964010861	homodimer interface [polypeptide binding]; other site
31964010862	metal binding site [ion binding]; metal-binding site
31964010863	Nucleoside Triphosphate Pyrophosphohydrolase (EC 3.6.1.8) MazG-like domain superfamily; Region: NTP-PPase; cl16941
31964010864	HMMPfam hit to PF03819, MazG nucleotide pyrophosphohydrolase, score 3e-36
31964010865	Na+/H+ antiporter 1; Region: Na_H_antiport_1; cl01133
31964010866	HMMPfam hit to PF06965, Na+/H+ antiporter NhaA,score 8.2e-77
31964010867	12 probable transmembrane helices predicted for CMS2460 by TMHMM2.0 at aa 36-58, 73-95, 108-130, 140-162,169-191, 196-218, 225-243, 247-266, 279-301, 305-327,339-361 and 376-398
31964010868	PS00041 Bacterial regulatory proteins, araC family signature.
31964010869	8 probable transmembrane helices predicted for CMS2461 by TMHMM2.0 at aa 15-37, 66-88, 103-125, 132-154,192-211, 218-240, 250-272 and 285-307
31964010870	Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription]; Region: Mfd; COG1197
31964010871	CarD-like/TRCF domain; Region: CarD_TRCF; smart01058
31964010872	DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region; Region: DEXDc; cd00046
31964010873	ATP binding site [chemical binding]; other site
31964010874	putative Mg++ binding site [ion binding]; other site
31964010875	Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may...; Region: HELICc; cd00079
31964010876	nucleotide binding region [chemical binding]; other site
31964010877	ATP-binding site [chemical binding]; other site
31964010878	This domain is found in proteins necessary for strand-specific repair in DNA such as TRCF in Escherichia coli; Region: TRCF; smart00982
31964010879	HMMPfam hit to PF03461, TRCF, score 2.3e-22
31964010880	HMMPfam hit to PF00271, Helicase, C-terminal, score 7.6e-17
31964010881	HMMPfam hit to PF00270, DEAD/DEAH box helicase,N-terminal, score 2.3e-36
31964010882	HMMPfam hit to PF04851, Type III restriction enzyme, res subunit, score 1.2e-05
31964010883	PS00017 ATP/GTP-binding site motif A (P-loop).
31964010884	HMMPfam hit to PF02559, Transcription factor CarD,score 3.8e-44
31964010885	Peptidyl-tRNA hydrolase (PTH) is a monomeric protein that cleaves the ester bond linking the nascent peptide and tRNA when peptidyl-tRNA is released prematurely from the ribosome. This ensures the recycling of peptidyl-tRNAs into tRNAs produced through...; Region: PTH; cd00462
31964010886	putative active site [active]
31964010887	catalytic residue [active]
31964010888	HMMPfam hit to PF01195, Peptidyl-tRNA hydrolase,score 4.2e-72
31964010889	PS01196 Peptidyl-tRNA hydrolase signature 2.
31964010890	PS01195 Peptidyl-tRNA hydrolase signature 1.
31964010891	50S ribosomal protein L25/general stress protein Ctc; Reviewed; Region: PRK05618
31964010892	Ribosomal L25/TL5/CTC N-terminal 5S rRNA binding domain; Region: Ribosomal_L25_TL5_CTC; cd00495
31964010893	5S rRNA interface [nucleotide binding]; other site
31964010894	CTC domain interface [polypeptide binding]; other site
31964010895	L16 interface [polypeptide binding]; other site
31964010896	HMMPfam hit to PF01386, Ribosomal protein L25,score 1.9e-31
31964010897	Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate. The resulting product gluconate-6-phoshate is an important precursor of gluconate metabolism. GntK acts as a dimmer composed of two identical subunits; Region: GntK; cd02021
31964010898	AAA domain; Region: AAA_33; pfam13671
31964010899	ATP-binding site [chemical binding]; other site
31964010900	Gluconate-6-phosphate binding site [chemical binding]; other site
31964010901	Predicted dehydrogenases and related proteins [General function prediction only]; Region: MviM; COG0673
31964010902	Oxidoreductase family, NAD-binding Rossmann fold; Region: GFO_IDH_MocA; pfam01408
31964010903	Oxidoreductase family, C-terminal alpha/beta domain; Region: GFO_IDH_MocA_C; pfam02894
31964010904	HMMPfam hit to PF02894, Oxidoreductase, C-terminal,score 4.4e-10
31964010905	HMMPfam hit to PF01408, Oxidoreductase, N-terminal,score 5.7e-20
31964010906	HMMPfam hit to PF01202, Shikimate kinase, score 2.5e-09
31964010907	PS00017 ATP/GTP-binding site motif A (P-loop).
31964010908	6-phosphogluconate dehydrogenase-like protein; Reviewed; Region: PRK09599
31964010909	6-phosphogluconate dehydrogenase; Validated; Region: PRK09287
31964010910	6-phosphogluconate dehydrogenase, C-terminal domain; Region: 6PGD; pfam00393
31964010911	HMMPfam hit to PF03446, 6-phosphogluconate dehydrogenase, NAD-binding, score 1.8e-86
31964010912	HMMPfam hit to PF00393, 6-phosphogluconate dehydrogenase, C-terminal, score 1e-153
31964010913	PS00461 6-phosphogluconate dehydrogenase signature.
31964010914	1 probable transmembrane helix predicted for CMS2467 by TMHMM2.0 at aa 26-48
31964010915	N-terminal domain of ribose phosphate pyrophosphokinase; Region: Pribosyltran_N; pfam13793
31964010916	ribose-phosphate pyrophosphokinase; Provisional; Region: PRK03092
31964010917	Phosphoribosyl transferase (PRT)-type I domain; Region: PRTases_typeI; cd06223
31964010918	active site
31964010919	HMMPfam hit to PF00156, Phosphoribosyltransferase,score 1.5e-26
31964010920	PS00103 Purine/pyrimidine phosphoribosyl transferases signature.
31964010921	PS00114 Phosphoribosyl pyrophosphate synthetase signature.
31964010922	bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional; Region: glmU; PRK14352
31964010923	N-terminal domain of bacterial GlmU; Region: GT2_GlmU_N_bac; cd02540
31964010924	Substrate binding site; other site
31964010925	Mg++ binding site; other site
31964010926	N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase. It is a bifunctional bacterial enzyme that catalyzes two...; Region: LbH_GlmU_C; cd03353
31964010927	active site
31964010928	substrate binding site [chemical binding]; other site
31964010929	CoA binding site [chemical binding]; other site
31964010930	HMMPfam hit to PF00132, Bacterial transferase hexapeptide repeat, score 9.4
31964010931	HMMPfam hit to PF00132, Bacterial transferase hexapeptide repeat, score 62
31964010932	HMMPfam hit to PF00132, Bacterial transferase hexapeptide repeat, score 68
31964010933	HMMPfam hit to PF00132, Bacterial transferase hexapeptide repeat, score 4.6
31964010934	HMMPfam hit to PF00132, Bacterial transferase hexapeptide repeat, score 19
31964010935	HMMPfam hit to PF00132, Bacterial transferase hexapeptide repeat, score 30
31964010936	HMMPfam hit to PF00132, Bacterial transferase hexapeptide repeat, score 17
31964010937	HMMPfam hit to PF00483, Nucleotidyl transferase,score 6.4e-09
31964010938	submitted with no further information
31964010939	Predicted helix-turn-helix motif with score 1385.000, SD 3.90 at aa 25-46, sequence LTLDEVGLVEGVTREAIRRRLR
31964010940	MarR family; Region: MarR_2; pfam12802
31964010941	HMMPfam hit to PF01047, Bacterial regulatory protein, MarR, score 9.7e-18
31964010942	Prokaryotic dksA/traR C4-type zinc finger; Region: zf-dskA_traR; cl00755
31964010943	luciferase family oxidoreductase, group 1; Region: oxido_grp_1; TIGR03558
31964010944	Flavin-utilizing monoxygenases; Region: Flavin_utilizing_monoxygenases; cl07892
31964010945	HMMPfam hit to PF00296, Bacterial luciferase, score 5.1e-17
31964010946	Lysine efflux permease [General function prediction only]; Region: COG1279
31964010947	7 probable transmembrane helices predicted for CMS2475 by TMHMM2.0 at aa 10-32, 45-67, 72-94, 106-128,148-170, 182-204 and 214-236
31964010948	HMMPfam hit to PF01810, Lysine exporter protein (LYSE/YGGA), score 2.1e-46
31964010949	HMMPfam hit to PF00126, Bacterial regulatory protein, LysR, score 1.2e-11
31964010950	HMMPfam hit to PF03466, LysR, substrate-binding,score 1.4e-07
31964010951	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964010952	dimer interface [polypeptide binding]; other site
31964010953	conserved gate region; other site
31964010954	ABC-ATPase subunit interface; other site
31964010955	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 0.0013
31964010956	6 probable transmembrane helices predicted for CMS2477 by TMHMM2.0 at aa 2-24, 34-56, 63-85, 115-137,144-163 and 168-190
31964010957	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964010958	ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism]; Region: AbcC; COG1135
31964010959	ATP-binding cassette domain of methionine transporter; Region: ABC_MetN_methionine_transporter; cd03258
31964010960	Walker A/P-loop; other site
31964010961	ATP binding site [chemical binding]; other site
31964010962	Q-loop/lid; other site
31964010963	ABC transporter signature motif; other site
31964010964	Walker B; other site
31964010965	D-loop; other site
31964010966	H-loop/switch region; other site
31964010967	This domain is found at the C-terminus of ABC transporter proteins involved in D-methionine transport as well as a number of ferredoxin-like proteins; Region: NIL; smart00930
31964010968	HMMPfam hit to PF00005, ABC transporter, score 4e-74
31964010969	PS00211 ABC transporters family signature.
31964010970	PS00017 ATP/GTP-binding site motif A (P-loop).
31964010971	NLPA lipoprotein; Region: Lipoprotein_9; cl17547
31964010972	HMMPfam hit to PF03180, NLPA lipoprotein, score 6.2e-60
31964010973	1 probable transmembrane helix predicted for CMS2479 by TMHMM2.0 at aa 17-39
31964010974	1 probable transmembrane helix predicted for CMS2481 by TMHMM2.0 at aa 86-108
31964010975	ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only]; Region: Uup; COG0488
31964010976	ATP-binding cassette domain of elongation factor 3, subfamily F; Region: ABCF_EF-3; cd03221
31964010977	ABC transporter; Region: ABC_tran_2; pfam12848
31964010978	ATP-binding cassette domain of elongation factor 3, subfamily F; Region: ABCF_EF-3; cd03221
31964010979	HMMPfam hit to PF00005, ABC transporter, score 1.4e-36
31964010980	PS00211 ABC transporters family signature.
31964010981	PS00017 ATP/GTP-binding site motif A (P-loop).
31964010982	PS00017 ATP/GTP-binding site motif A (P-loop).
31964010983	HMMPfam hit to PF00005, ABC transporter, score 1.7e-36
31964010984	PS00211 ABC transporters family signature.
31964010985	PS00017 ATP/GTP-binding site motif A (P-loop).
31964010986	12 probable transmembrane helices predicted for CMS2483 by TMHMM2.0 at aa 32-54, 64-86, 98-117, 122-144,157-179, 189-208, 237-259, 269-291, 298-320, 325-347,360-382 and 386-408
31964010987	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964010988	PS00216 Sugar transport proteins signature 1.
31964010989	PS00044 Bacterial regulatory proteins, lysR family signature.
31964010990	ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein; Region: ABC_MJ0796_LolCDE_FtsE; cd03255
31964010991	putative bacteriocin export ABC transporter, lactococcin 972 group; Region: L_ocin_972_ABC; TIGR03608
31964010992	Walker A/P-loop; other site
31964010993	ATP binding site [chemical binding]; other site
31964010994	Q-loop/lid; other site
31964010995	ABC transporter signature motif; other site
31964010996	Walker B; other site
31964010997	D-loop; other site
31964010998	H-loop/switch region; other site
31964010999	HMMPfam hit to PF00005, ABC transporter, score 1.1e-49
31964011000	PS00211 ABC transporters family signature.
31964011001	PS00017 ATP/GTP-binding site motif A (P-loop).
31964011002	bacteriocin-associated integral membrane (putative immunity) protein; Region: bact_immun_7tm; TIGR01654
31964011003	8 probable transmembrane helices predicted for CMS2485 by TMHMM2.0 at aa 5-23, 211-233, 254-276, 291-313,333-355, 632-654, 675-697 and 722-744
31964011004	1 probable transmembrane helix predicted for CMS2486 by TMHMM2.0 at aa 7-26
31964011005	MoaE family. Members of this family are involved in biosynthesis of the molybdenum cofactor (Moco), an essential cofactor for a diverse group of redox enzymes. Moco biosynthesis is an evolutionarily conserved pathway present in eubacteria, archaea and...; Region: MoaE; cd00756
31964011006	MoaE homodimer interface [polypeptide binding]; other site
31964011007	MoaD interaction [polypeptide binding]; other site
31964011008	active site residues [active]
31964011009	HMMPfam hit to PF02391, Molybdopterin biosynthesis MoaE, score 5e-36
31964011010	MogA_MoaB family. Members of this family are involved in biosynthesis of the molybdenum cofactor (MoCF) an essential cofactor of a diverse group of redox enzymes. MoCF biosynthesis is an evolutionarily conserved pathway present in eubacteria, archaea; Region: MogA_MoaB; cd00886
31964011011	MPT binding site; other site
31964011012	trimer interface [polypeptide binding]; other site
31964011013	HMMPfam hit to PF00994, Molybdenum cofactor biosynthesis protein, score 8.1e-27
31964011014	PS01078 Molybdenum cofactor biosynthesis proteins signature 1.
31964011015	molybdenum cofactor biosynthesis protein MoaC; Provisional; Region: moaC; PRK09364
31964011016	trimer interface [polypeptide binding]; other site
31964011017	dimer interface [polypeptide binding]; other site
31964011018	putative active site [active]
31964011019	HMMPfam hit to PF01967, Molybdopterin cofactor biosynthesis protein MoaC, score 1.2e-71
31964011020	Molybdopterin biosynthesis enzyme [Coenzyme metabolism]; Region: MoeA; COG0303
31964011021	MoeA family. Members of this family are involved in biosynthesis of the molybdenum cofactor (MoCF), an essential cofactor of a diverse group of redox enzymes. MoCF biosynthesis is an evolutionarily conserved pathway present in eubacteria, archaea and...; Region: MoeA; cd00887
31964011022	dimer interface [polypeptide binding]; other site
31964011023	putative functional site; other site
31964011024	putative MPT binding site; other site
31964011025	HMMPfam hit to PF03454, MoeA, C-terminal, domain IV, score 3e-10
31964011026	HMMPfam hit to PF00994, Molybdenum cofactor biosynthesis protein, score 2.4e-39
31964011027	HMMPfam hit to PF03453, MoeA, N-terminal, domain I and II, score 6.4e-52
31964011028	2 probable transmembrane helices predicted for CMS2491 by TMHMM2.0 at aa 21-43 and 53-75
31964011029	submitted with no further information
31964011030	3 probable transmembrane helices predicted for CMS2492 by TMHMM2.0 at aa 4-21, 166-188 and 198-220
31964011031	Phosphoenolpyruvate phosphomutase; Region: PEP_mutase; pfam13714
31964011032	Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage. Known members are phosphoenolpyruvate mutase (PEPM), phosphonopyruvate hydrolase (PPH), carboxyPEP mutase (CPEP mutase), oxaloacetate hydrolase (OAH), isocitrate...; Region: ICL_PEPM; cd00377
31964011033	tetramer interface [polypeptide binding]; other site
31964011034	active site
31964011035	Mg2+/Mn2+ binding site [ion binding]; other site
31964011036	Sodium Bile acid symporter family; Region: SBF; cl17470
31964011037	10 probable transmembrane helices predicted for CMS2494 by TMHMM2.0 at aa 50-67, 82-99, 111-133, 137-159,171-193, 208-230, 243-265, 271-290, 311-328 and 333-355
31964011038	HMMPfam hit to PF01758, Bile acid:sodium symporter,score 0.00011
31964011039	putative bacillithiol system oxidoreductase, YpdA family; Region: Bthiol_YpdA; TIGR04018
31964011040	Pyridine nucleotide-disulphide oxidoreductase; Region: Pyr_redox_3; pfam13738
31964011041	Phosphorylase superfamily; Region: PNP_UDP_1; cl00303
31964011042	HMMPfam hit to PF00896, Purine phosphorylase,family 2, score 3.1e-74
31964011043	PS01240 Purine and other phosphorylases family 2 signature.
31964011044	Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]; Region: WcaG; COG0451
31964011045	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
31964011046	NAD(P) binding site [chemical binding]; other site
31964011047	active site
31964011048	1 probable transmembrane helix predicted for CMS2497 by TMHMM2.0 at aa 5-24
31964011049	HMMPfam hit to PF01370, NAD-dependent epimerase/dehydratase, score 3e-53
31964011050	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964011051	3-ketoacyl-(acyl-carrier-protein) reductase; Validated; Region: fabG; PRK05653
31964011052	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
31964011053	NAD(P) binding site [chemical binding]; other site
31964011054	active site
31964011055	HMMPfam hit to PF00106, Short-chain dehydrogenase/reductase SDR, score 5.1e-79
31964011056	CAAX protease self-immunity; Region: Abi; pfam02517
31964011057	8 probable transmembrane helices predicted for CMS2500 by TMHMM2.0 at aa 37-59, 74-92, 113-135, 145-162,182-204, 231-248, 255-274 and 294-312
31964011058	HMMPfam hit to PF02517, Abortive infection protein,score 0.0098
31964011059	Stress responsive A/B Barrel Domain; Region: Dabb; smart00886
31964011060	2 probable transmembrane helices predicted for CMS2502 by TMHMM2.0 at aa 34-56 and 69-88
31964011061	1 probable transmembrane helix predicted for CMS2503 by TMHMM2.0 at aa 126-148
31964011062	1 probable transmembrane helix predicted for CMS2504 by TMHMM2.0 at aa 132-154
31964011063	Predicted permease; Region: DUF318; cl17795
31964011064	HMMPfam hit to PF03773, Predicted permease, score 2.2e-49
31964011065	7 probable transmembrane helices predicted for CMS2505 by TMHMM2.0 at aa 96-118, 138-160, 213-235,239-261, 296-318, 328-350, 357-379 and 394-416
31964011066	TIGR03943 family protein; Region: TIGR03943
31964011067	3 probable transmembrane helices predicted for CMS2506 by TMHMM2.0 at aa 2-24, 29-48 and 84-106
31964011068	2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion]; Region: UbiH; COG0654
31964011069	hypothetical protein; Provisional; Region: PRK07236
31964011070	ubiquinone biosynthesis hydroxylase family protein; Provisional; Region: PRK07608; cl17314
31964011071	HMMPfam hit to PF01360, Flavoprotein monooxygenase,score 5.1e-17
31964011072	Cupin domain; Region: Cupin_2; cl17218
31964011073	HMMPfam hit to PF00190, Cupin, score 0.0032
31964011074	1 probable transmembrane helix predicted for CMS2510 by TMHMM2.0 at aa 7-29
31964011075	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964011076	Predicted transcriptional regulators [Transcription]; Region: COG1695
31964011077	Transcriptional regulator PadR-like family; Region: PadR; pfam03551
31964011078	HMMPfam hit to PF03551, Transcriptional regulator PadR-like, score 1.1e-21
31964011079	HMMPfam hit to PF03404, Mo-co oxidoreductase dimerisation domain, score 3.9e-11
31964011080	HMMPfam hit to PF00174, Oxidoreductase,molybdopterin binding, score 1.1e-12
31964011081	Signal transduction histidine kinase [Signal transduction mechanisms]; Region: BaeS; COG0642
31964011082	Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via...; Region: HisKA; cd00082
31964011083	dimer interface [polypeptide binding]; other site
31964011084	phosphorylation site [posttranslational modification]
31964011085	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
31964011086	ATP binding site [chemical binding]; other site
31964011087	Mg2+ binding site [ion binding]; other site
31964011088	G-X-G motif; other site
31964011089	HMMPfam hit to PF02518, ATP-binding region,ATPase-like, score 1.2e-28
31964011090	HMMPfam hit to PF00512, Histidine kinase A,N-terminal, score 3.3e-20
31964011091	HMMPfam hit to PF00672, Histidine kinase, HAMP region, score 0.029
31964011092	3 probable transmembrane helices predicted for CMS2514 by TMHMM2.0 at aa 6-28, 35-57 and 72-94
31964011093	Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription]; Region: OmpR; COG0745
31964011094	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
31964011095	active site
31964011096	phosphorylation site [posttranslational modification]
31964011097	intermolecular recognition site; other site
31964011098	dimerization interface [polypeptide binding]; other site
31964011099	Effector domain of response regulator. Bacteria and certain eukaryotes like protozoa and higher plants use two-component signal transduction systems to detect and respond to changes in the environment. The system consists of a sensor histidine kinase and...; Region: trans_reg_C; cd00383
31964011100	DNA binding site [nucleotide binding]
31964011101	HMMPfam hit to PF00486, Transcriptional regulatory protein, C-terminal, score 4e-23
31964011102	HMMPfam hit to PF00072, Response regulator receiver, score 6.2e-41
31964011103	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily; Region: DPM_DPG-synthase_like; cd04179
31964011104	Ligand binding site; other site
31964011105	Putative Catalytic site; other site
31964011106	DXD motif; other site
31964011107	HMMPfam hit to PF00535, Glycosyl transferase,family 2, score 1.1e-22
31964011108	Uncharacterized protein conserved in bacteria (DUF2064); Region: DUF2064; cl17492
31964011109	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cl17173
31964011110	4 probable transmembrane helices predicted for CMS2519 by TMHMM2.0 at aa 21-43, 58-80, 92-114 and 134-153
31964011111	PS00038 Myc-type, 'helix-loop-helix' dimerization domain signature.
31964011112	Sulfite oxidase and related enzymes [General function prediction only]; Region: COG2041
31964011113	Sulfite oxidase (SO) family, molybdopterin binding domain. This molybdopterin cofactor (Moco) binding domain is found in a variety of oxidoreductases, main members of this family are nitrate reductase (NR) and sulfite oxidase (SO). SO catalyzes the...; Region: SO_family_Moco; cd00321
31964011114	Moco binding site; other site
31964011115	metal coordination site [ion binding]; other site
31964011116	5 probable transmembrane helices predicted for CMS2520 by TMHMM2.0 at aa 21-43, 67-89, 110-132, 142-164 and 222-244
31964011117	Protein of unknown function (DUF2029); Region: DUF2029; pfam09594
31964011118	10 probable transmembrane helices predicted for CMS2521 by TMHMM2.0 at aa 5-27, 40-62, 69-88, 195-217,224-246, 269-291, 298-320, 347-369, 376-398 and 431-453
31964011119	Predicted ATPase involved in cell division [Cell division and chromosome partitioning]; Region: FtsE; COG2884
31964011120	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
31964011121	Walker A/P-loop; other site
31964011122	ATP binding site [chemical binding]; other site
31964011123	Q-loop/lid; other site
31964011124	ABC transporter signature motif; other site
31964011125	Walker B; other site
31964011126	D-loop; other site
31964011127	H-loop/switch region; other site
31964011128	HMMPfam hit to PF00005, ABC transporter, score 1.5e-64
31964011129	PS00211 ABC transporters family signature.
31964011130	PS00017 ATP/GTP-binding site motif A (P-loop).
31964011131	ABC-type sulfate transport system, permease component [Posttranslational modification, protein turnover, chaperones]; Region: CysU; COG0555
31964011132	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964011133	putative PBP binding loops; other site
31964011134	ABC-ATPase subunit interface; other site
31964011135	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 7.8e-19
31964011136	6 probable transmembrane helices predicted for CMS2523 by TMHMM2.0 at aa 5-27, 47-69, 82-104, 124-146,175-197 and 230-249
31964011137	Predicted helix-turn-helix motif with score 1032.000, SD 2.70 at aa 155-176, sequence RRFEDAAATLGASRWTVLRRVT
31964011138	Bacterial extracellular solute-binding protein; Region: SBP_bac_11; pfam13531
31964011139	Bacterial extracellular solute-binding protein; Region: SBP_bac_1; cl17199
31964011140	Helix-Turn-Helix DNA binding domain of truncated MerR-like proteins; Region: HTH_MerR-trunc; cd04762
31964011141	DNA binding residues [nucleotide binding]
31964011142	Molybdopterin-binding protein [Coenzyme metabolism]; Region: MopI; COG3585
31964011143	HMMPfam hit to PF03459, TOBE, score 5.5e-12
31964011144	HMMPfam hit to PF00376, Bacterial regulatory protein, MerR, score 0.00011
31964011145	Predicted helix-turn-helix motif with score 1107.000, SD 2.96 at aa 30-51, sequence YRVSEAAALIGVSDDTLRRWAD
31964011146	molybdenum cofactor biosynthesis protein A; Reviewed; Region: moaA; PRK00164
31964011147	Radical SAM superfamily. Enzymes of this family generate radicals by combining a 4Fe-4S cluster and S-adenosylmethionine (SAM) in close proximity. They are characterized by a conserved CxxxCxxC motif, which coordinates the conserved iron-sulfur cluster; Region: Radical_SAM; cd01335
31964011148	FeS/SAM binding site; other site
31964011149	Molybdenum Cofactor Synthesis C; Region: Mob_synth_C; pfam06463
31964011150	HMMPfam hit to PF04055, Radical SAM, score 1e-41
31964011151	PS01305 moaA / nifB / pqqE family signature.
31964011152	HMMPfam hit to PF06463, Molybdenum cofactor synthesis C, score 2.2e-47
31964011153	Ubiquitin-like proteins; Region: UBQ; cl00155
31964011154	charged pocket; other site
31964011155	hydrophobic patch; other site
31964011156	HMMPfam hit to PF02597, ThiamineS, score 0.00015
31964011157	submitted with no further information
31964011158	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
31964011159	AAA domain; Region: AAA_21; pfam13304
31964011160	Walker A/P-loop; other site
31964011161	ATP binding site [chemical binding]; other site
31964011162	Q-loop/lid; other site
31964011163	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
31964011164	ABC transporter signature motif; other site
31964011165	Walker B; other site
31964011166	D-loop; other site
31964011167	H-loop/switch region; other site
31964011168	PS00017 ATP/GTP-binding site motif A (P-loop).
31964011169	HNH endonuclease; Region: HNH; pfam01844
31964011170	Escherichia coli PhnB and similar proteins; the E. coli phnB gene is found next to an operon involved in the cleavage of carbon-phosphorus bonds in unactivated alkylphosphonates; Region: PhnB_like; cd06588
31964011171	dimer interface [polypeptide binding]; other site
31964011172	HMMPfam hit to PF06983, 3-demethylubiquinone-9 3-methyltransferase, score 6.7e-44
31964011173	Protein of unknown function (DUF1648); Region: DUF1648; pfam07853
31964011174	6 probable transmembrane helices predicted for CMS2531 by TMHMM2.0 at aa 17-39, 59-81, 88-110, 123-145,176-198 and 203-222
31964011175	Predicted transcriptional regulators [Transcription]; Region: COG1725
31964011176	Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators; Region: WHTH_GntR; cd07377
31964011177	DNA-binding site [nucleotide binding]; DNA binding site
31964011178	HMMPfam hit to PF00392, Bacterial regulatory protein, GntR, score 4e-16
31964011179	Transcriptional regulators [Transcription]; Region: PurR; COG1609
31964011180	Helix-turn-helix (HTH) DNA binding domain of the LacI family of transcriptional regulators; Region: HTH_LacI; cd01392
31964011181	DNA binding site [nucleotide binding]
31964011182	domain linker motif; other site
31964011183	Ligand binding domain of the LacI tanscriptional regulator family belonging to the type I periplasmic-binding fold protein superfamily; Region: PBP1_LacI_sugar_binding_like; cd06267
31964011184	ligand binding site [chemical binding]; other site
31964011185	dimerization interface [polypeptide binding]; other site
31964011186	HMMPfam hit to PF00532, Periplasmic binding protein/LacI transcriptional regulator, score 0.00023
31964011187	Predicted dehydrogenases and related proteins [General function prediction only]; Region: MviM; COG0673
31964011188	Oxidoreductase family, NAD-binding Rossmann fold; Region: GFO_IDH_MocA; pfam01408
31964011189	Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols. AKRs are present in all phyla and are of importance to both health and industrial...; Region: Aldo_ket_red; cd06660
31964011190	active site
31964011191	Aldo/keto reductase family; Region: Aldo_ket_red; pfam00248
31964011192	catalytic tetrad [active]
31964011193	HMMPfam hit to PF00248, Aldo/keto reductase, score 5.7e-14
31964011194	HMMPfam hit to PF01408, Oxidoreductase, N-terminal,score 8.5e-21
31964011195	2 probable transmembrane helices predicted for CMS2535 by TMHMM2.0 at aa 273-295 and 300-322
31964011196	hypothetical protein; Validated; Region: PRK07411
31964011197	ThiF_MoeB_HesA. Family of E1-like enzymes involved in molybdopterin and thiamine biosynthesis family. The common reaction mechanism catalyzed by MoeB and ThiF, like other E1 enzymes, begins with a nucleophilic attack of the C-terminal carboxylate of MoaD...; Region: ThiF_MoeB_HesA_family; cd00757
31964011198	ATP binding site [chemical binding]; other site
31964011199	substrate interface [chemical binding]; other site
31964011200	Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein. The cysteine containing enzymatically active version of the domain is also found in the Cdc25 class of protein phosphatases and a variety of proteins...; Region: RHOD; cd00158
31964011201	active site residue [active]
31964011202	HMMPfam hit to PF00581, Rhodanese-like, score 0.00012
31964011203	HMMPfam hit to PF05237, MoeZ/MoeB, score 3.6e-26
31964011204	HMMPfam hit to PF00899, UBA/THIF-type NAD/FAD binding fold, score 1.4e-53
31964011205	Dolichyl-phosphate-mannose-protein mannosyltransferase; Region: PMT_2; cl17364
31964011206	9 probable transmembrane helices predicted for CMS2539 by TMHMM2.0 at aa 46-68, 132-154, 167-189,209-231, 244-266, 301-318, 358-380, 385-404 and 409-426
31964011207	Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only]; Region: MhpC; COG0596
31964011208	Putative lysophospholipase; Region: Hydrolase_4; pfam12146
31964011209	HMMPfam hit to PF00561, Alpha/beta hydrolase fold,score 4.4e-28
31964011210	CGNR zinc finger; Region: zf-CGNR; pfam11706
31964011211	HMMPfam hit to PF07336, Protein of unknown function DUF1470, score 6.5e-22
31964011212	Homeodomain-like domain; Region: HTH_23; cl17451
31964011213	Winged helix-turn helix; Region: HTH_29; pfam13551
31964011214	Integrase core domain; Region: rve; pfam00665
31964011215	Integrase core domain; Region: rve_3; pfam13683
31964011216	Predicted helix-turn-helix motif with score 1316.000, SD 3.67 at aa 25-46, sequence WPVRRAAERFQCSPATASRWAR
31964011217	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.9e-42
31964011218	Transcriptional regulators [Transcription]; Region: MarR; COG1846
31964011219	Winged helix DNA-binding domain; Region: HTH_27; pfam13463
31964011220	MarR family; Region: MarR_2; cl17246
31964011221	HMMPfam hit to PF01047, Bacterial regulatory protein, MarR, score 1.2e-17
31964011222	Predicted helix-turn-helix motif with score 1261.000, SD 3.48 at aa 61-82, sequence LRLRDLNQHVLLTQPSVSRLID
31964011223	Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription]; Region: OmpR; COG0745
31964011224	Effector domain of response regulator. Bacteria and certain eukaryotes like protozoa and higher plants use two-component signal transduction systems to detect and respond to changes in the environment. The system consists of a sensor histidine kinase and...; Region: trans_reg_C; cd00383
31964011225	DNA binding site [nucleotide binding]
31964011226	HMMPfam hit to PF00486, Transcriptional regulatory protein, C-terminal, score 3.8e-19
31964011227	Phosphoribosyl transferase (PRT)-type I domain; Region: PRTases_typeI; cd06223
31964011228	active site
31964011229	HMMPfam hit to PF00156, Phosphoribosyltransferase,score 8.7e-12
31964011230	Nucleoside deaminases include adenosine, guanine and cytosine deaminases. These enzymes are Zn dependent and catalyze the deamination of nucleosides. The zinc ion in the active site plays a central role in the proposed catalytic mechanism, activating a...; Region: nucleoside_deaminase; cd01285
31964011231	nucleoside/Zn binding site; other site
31964011232	dimer interface [polypeptide binding]; other site
31964011233	catalytic motif [active]
31964011234	HMMPfam hit to PF00383, Cytidine/deoxycytidylate deaminase, zinc-binding region, score 4.6e-32
31964011235	PS00903 Cytidine and deoxycytidylate deaminases zinc-binding region signature.
31964011236	Predicted Co/Zn/Cd cation transporters [Inorganic ion transport and metabolism]; Region: MMT1; COG0053
31964011237	Cation efflux family; Region: Cation_efflux; pfam01545
31964011238	HMMPfam hit to PF01545, Cation efflux protein,score 1.6e-63
31964011239	5 probable transmembrane helices predicted for CMS2549 by TMHMM2.0 at aa 35-57, 103-125, 138-160, 191-210 and 217-236
31964011240	HMMPfam hit to PF01089, Delta 1-pyrroline-5-carboxylate reductase, score 6.8e-70
31964011241	Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism]; Region: ProC; COG0345
31964011242	NADP oxidoreductase coenzyme F420-dependent; Region: F420_oxidored; cl17232
31964011243	K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism]; Region: TrkA; COG0569
31964011244	TrkA-N domain; Region: TrkA_N; pfam02254
31964011245	TrkA-C domain; Region: TrkA_C; pfam02080
31964011246	HMMPfam hit to PF02254, TrkA-N, score 2.9e-30
31964011247	Cation transport protein; Region: TrkH; cl17365
31964011248	potassium uptake protein, TrkH family; Region: 2a38; TIGR00933
31964011249	Trk-type K+ transport systems, membrane components [Inorganic ion transport and metabolism]; Region: TrkG; COG0168
31964011250	HMMPfam hit to PF02386, Cation transporter, score 2.4e-42
31964011251	9 probable transmembrane helices predicted for CMS2552 by TMHMM2.0 at aa 28-50, 57-79, 94-116, 152-174,220-242, 254-276, 336-358, 378-400 and 435-457
31964011252	Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to...; Region: HTH_ARSR; cd00090
31964011253	putative DNA binding site [nucleotide binding]; other site
31964011254	putative Zn2+ binding site [ion binding]; other site
31964011255	HMMPfam hit to PF01022, Bacterial regulatory protein, ArsR, score 2.6e-20
31964011256	Predicted helix-turn-helix motif with score 1858.000, SD 5.52 at aa 61-82, sequence ISVSELVQTLGISQPTVSKHLR
31964011257	DNA binding domain, excisionase family; Region: excise; TIGR01764
31964011258	Predicted helix-turn-helix motif with score 1732.000, SD 5.09 at aa 11-32, sequence LTVAEVAEMMRVSKMTVYRLVH
31964011259	Phosphoserine phosphatase [Amino acid transport and metabolism]; Region: SerB; COG0560
31964011260	haloacid dehalogenase-like hydrolase; Region: HAD; cl17202
31964011261	HMMPfam hit to PF00702, Haloacid dehalogenase-like hydrolase, score 0.00021
31964011262	Glutaredoxin-like domain (DUF836); Region: DUF836; pfam05768
31964011263	Stress responsive A/B Barrel Domain; Region: Dabb; smart00886
31964011264	cell division ATP-binding protein FtsE; Region: FtsE; TIGR02673
31964011265	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
31964011266	Walker A/P-loop; other site
31964011267	ATP binding site [chemical binding]; other site
31964011268	Q-loop/lid; other site
31964011269	ABC transporter signature motif; other site
31964011270	Walker B; other site
31964011271	D-loop; other site
31964011272	H-loop/switch region; other site
31964011273	HMMPfam hit to PF00005, ABC transporter, score 1.9e-31
31964011274	PS00017 ATP/GTP-binding site motif A (P-loop).
31964011275	PS00211 ABC transporters family signature.
31964011276	12 probable transmembrane helices predicted for CMS2560 by TMHMM2.0 at aa 27-49, 83-105, 118-140, 145-167,180-202, 222-244, 308-330, 334-356, 379-401, 406-428,435-457 and 472-494
31964011277	AAA domain; Region: AAA_18; pfam13238
31964011278	PS00017 ATP/GTP-binding site motif A (P-loop).
31964011279	Cell envelope-related transcriptional attenuator domain; Region: LytR_cpsA_psr; cl00581
31964011280	HMMPfam hit to PF03816, Cell envelope-related transcriptional attenuator, score 6.1e-47
31964011281	1 probable transmembrane helix predicted for CMS2563 by TMHMM2.0 at aa 5-27
31964011282	aspartyl-tRNA synthetase; Provisional; Region: aspC; PRK05159
31964011283	Asp_Lys_Asn_RS_N: N-terminal, anticodon recognition domain of class 2b aminoacyl-tRNA synthetases (aaRSs). This domain is a beta-barrel domain (OB fold) involved in binding the tRNA anticodon stem-loop.  Class 2b aaRSs include the homodimeric aspartyl-; Region: Asp_Lys_Asn_RS_N; cd04100
31964011284	Dimer interface [polypeptide binding]; other site
31964011285	anticodon binding site; other site
31964011286	Class II tRNA amino-acyl synthetase-like catalytic core domain. Class II amino acyl-tRNA synthetases (aaRS) share a common fold and generally attach an amino acid to the 3' OH of ribose of the appropriate tRNA.   PheRS is an exception in that it...; Region: class_II_aaRS-like_core; cl00268
31964011287	motif 1; other site
31964011288	dimer interface [polypeptide binding]; other site
31964011289	active site
31964011290	motif 2; other site
31964011291	motif 3; other site
31964011292	HMMPfam hit to PF00152, tRNA synthetase, class II (D, K and N), score 8.3e-65
31964011293	PS00179 Aminoacyl-transfer RNA synthetases class-II signature 1.
31964011294	HMMPfam hit to PF01336, OB-fold nucleic acid binding, score 7.7e-13
31964011295	LamB/YcsF family of  lactam utilization protein; Region: LamB_YcsF_like; cd10787
31964011296	putative active site [active]
31964011297	HMMPfam hit to PF03746, LamB/YcsF, score 1.3e-131
31964011298	Allophanate hydrolase subunit 1; Region: AHS1; pfam02682
31964011299	Allophanate hydrolase subunit 1 [Amino acid transport and metabolism]; Region: DUR1; cl00896
31964011300	HMMPfam hit to PF02682, Protein of unknown function DUF213, score 3.7e-51
31964011301	Allophanate hydrolase subunit 2; Region: AHS2; pfam02626
31964011302	HMMPfam hit to PF02626, Urea amidolyase-related,score 2.6e-57
31964011303	Protein of unknown function (DUF2510); Region: DUF2510; pfam10708
31964011304	4 probable transmembrane helices predicted for CMS2568 by TMHMM2.0 at aa 125-144, 164-186, 201-223 and 235-257
31964011305	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
31964011306	Walker A/P-loop; other site
31964011307	ATP binding site [chemical binding]; other site
31964011308	Excinuclease ATPase subunit [DNA replication, recombination, and repair]; Region: UvrA; COG0178
31964011309	Q-loop/lid; other site
31964011310	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
31964011311	ABC transporter signature motif; other site
31964011312	Walker B; other site
31964011313	D-loop; other site
31964011314	H-loop/switch region; other site
31964011315	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
31964011316	Walker A/P-loop; other site
31964011317	ATP binding site [chemical binding]; other site
31964011318	Q-loop/lid; other site
31964011319	ABC transporter signature motif; other site
31964011320	Walker B; other site
31964011321	D-loop; other site
31964011322	H-loop/switch region; other site
31964011323	HMMPfam hit to PF00005, ABC transporter, score 5.5e-29
31964011324	PS00211 ABC transporters family signature.
31964011325	PS00017 ATP/GTP-binding site motif A (P-loop).
31964011326	HMMPfam hit to PF00005, ABC transporter, score 1.7e-09
31964011327	PS00211 ABC transporters family signature.
31964011328	PS00017 ATP/GTP-binding site motif A (P-loop).
31964011329	Beta-galactosidase [Carbohydrate transport and metabolism]; Region: LacA; COG1874
31964011330	Beta-galactosidase; Region: Glyco_hydro_42; pfam02449
31964011331	A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain; Region: A4_beta-galactosidase_middle_domain; cd03143
31964011332	Beta-galactosidase C-terminal domain; Region: Glyco_hydro_42C; pfam08533
31964011333	HMMPfam hit to PF02449, Glycoside hydrolase, family 42, score 1e-127
31964011334	HMMPfam hit to PF01547, Bacterial extracellular solute-binding protein, family 1, score 1.2e-05
31964011335	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964011336	dimer interface [polypeptide binding]; other site
31964011337	conserved gate region; other site
31964011338	putative PBP binding loops; other site
31964011339	ABC-ATPase subunit interface; other site
31964011340	7 probable transmembrane helices predicted for CMS2574 by TMHMM2.0 at aa 6-28, 35-57, 72-94, 107-129,149-171, 206-228 and 261-283
31964011341	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 0.0007
31964011342	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964011343	ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism]; Region: UgpE; COG0395
31964011344	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964011345	dimer interface [polypeptide binding]; other site
31964011346	conserved gate region; other site
31964011347	putative PBP binding loops; other site
31964011348	ABC-ATPase subunit interface; other site
31964011349	6 probable transmembrane helices predicted for CMS2575 by TMHMM2.0 at aa 32-54, 96-118, 129-151, 161-183,204-226 and 264-286
31964011350	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 2.5e-18
31964011351	Transcriptional regulators [Transcription]; Region: PurR; COG1609
31964011352	Helix-turn-helix (HTH) DNA binding domain of the LacI family of transcriptional regulators; Region: HTH_LacI; cd01392
31964011353	DNA binding site [nucleotide binding]
31964011354	domain linker motif; other site
31964011355	Ligand binding domain of a transcription regulator of cellulose genes, CelR, which is highly homologous to the LacI-GalR family of bacterial transcription regulators; Region: PBP1_CelR; cd06295
31964011356	putative dimerization interface [polypeptide binding]; other site
31964011357	putative ligand binding site [chemical binding]; other site
31964011358	HMMPfam hit to PF00356, Bacterial regulatory protein, LacI, score 8.7e-08
31964011359	Predicted helix-turn-helix motif with score 2159.000, SD 6.54 at aa 10-31, sequence PTIEDVAAEAGVSRGTVSRVLN
31964011360	PS00356 Bacterial regulatory proteins, lacI family signature.
31964011361	HMMPfam hit to PF00532, Periplasmic binding protein/LacI transcriptional regulator, score 3.4e-09
31964011362	RNA polymerase sigma factor SigB; Reviewed; Region: PRK07921
31964011363	Sigma-70 factor, region 1.2; Region: Sigma70_r1_2; pfam00140
31964011364	Sigma-70 region 2; Region: Sigma70_r2; pfam04542
31964011365	Sigma-70 region 3; Region: Sigma70_r3; pfam04539
31964011366	Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs). A SF is a dissociable subunit of RNA polymerase, it directs bacterial or...; Region: Sigma70_r4; cd06171
31964011367	DNA binding residues [nucleotide binding]
31964011368	HMMPfam hit to PF04545, Sigma-70 region 4, score 1.3e-17
31964011369	Predicted helix-turn-helix motif with score 1854.000, SD 5.50 at aa 282-303, sequence RSLAFVSQQLGVTRERVRQIEK
31964011370	HMMPfam hit to PF04539, Sigma-70 region 3, score 3.3e-16
31964011371	HMMPfam hit to PF04542, Sigma-70 region 2, score 2e-25
31964011372	PS00715 Sigma-70 factors family signature 1.
31964011373	HMMPfam hit to PF00140, Sigma-70 region 1.2, score 1.4e-11
31964011374	Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction; Region: HP_PGM_like; cd07067
31964011375	catalytic core [active]
31964011376	HMMPfam hit to PF00300,Phosphoglycerate/bisphosphoglycerate mutase, score 0.00013
31964011377	TlpA-like family; composed of  TlpA, ResA, DsbE and similar proteins. TlpA, ResA and DsbE are bacterial protein disulfide reductases with important roles in cytochrome maturation. They are membrane-anchored proteins with a soluble TRX domain containing a...; Region: TlpA_like_family; cd02966
31964011378	Thioredoxin-like; Region: Thioredoxin_8; pfam13905
31964011379	catalytic residues [active]
31964011380	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964011381	Cytochrome c biogenesis protein [Posttranslational modification, protein turnover, chaperones]; Region: CcdA; COG0785
31964011382	Cytochrome C biogenesis protein transmembrane region; Region: DsbD; cl15788
31964011383	6 probable transmembrane helices predicted for CMS2580 by TMHMM2.0 at aa 15-37, 58-80, 95-117, 137-159,169-191 and 210-232
31964011384	HMMPfam hit to PF02683, Cytochrome c biogenesis protein, transmembrane region, score 7.2e-46
31964011385	ResB-like family; Region: ResB; pfam05140
31964011386	ResB protein required for cytochrome c biosynthesis [Posttranslational modification, protein turnover, chaperones]; Region: ResB; cl09125
31964011387	HMMPfam hit to PF05140, ResB-like, score 1.1e-57
31964011388	4 probable transmembrane helices predicted for CMS2581 by TMHMM2.0 at aa 45-62, 95-117, 198-220 and 469-488
31964011389	cytochrome c-type biogenesis protein CcsB; Region: cytochr_II_ccsB; TIGR03144
31964011390	8 probable transmembrane helices predicted for CMS2582 by TMHMM2.0 at aa 10-32, 92-114, 124-146, 153-175,190-212, 250-269, 284-301 and 310-332
31964011391	HMMPfam hit to PF01578, Cytochrome c assembly protein, score 5.9e-43
31964011392	o-Succinylbenzoate synthase (OSBS) catalyzes the conversion of 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate (SHCHC) to 4-(2'-carboxyphenyl)-4-oxobutyrate (o-succinylbenzoate or OSB), a reaction in the menaquinone biosynthetic pathway; Region: OSBS; cd03320
31964011393	O-succinylbenzoate synthase; Provisional; Region: PRK05105
31964011394	active site
31964011395	HMMPfam hit to PF01188, Mandelate racemase/muconate lactonizing enzyme, score 4.9e-08
31964011396	Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily. This superfamily contains a diverse set of enzymes including enoyl-CoA hydratase, napthoate synthase, methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA dehydratase, and dienoyl-CoA isomerase; Region: crotonase-like; cd06558
31964011397	Enoyl-CoA hydratase/isomerase family; Region: ECH; pfam00378
31964011398	substrate binding site [chemical binding]; other site
31964011399	oxyanion hole (OAH) forming residues; other site
31964011400	trimer interface [polypeptide binding]; other site
31964011401	HMMPfam hit to PF00378, Enoyl-CoA hydratase/isomerase, score 4.6e-39
31964011402	PS00017 ATP/GTP-binding site motif A (P-loop).
31964011403	Adenylate forming domain, Class I; Region: AFD_class_I; cl17068
31964011404	AMP binding site [chemical binding]; other site
31964011405	active site
31964011406	acyl-activating enzyme (AAE) consensus motif; other site
31964011407	CoA binding site [chemical binding]; other site
31964011408	HMMPfam hit to PF00501, AMP-dependent synthetase and ligase, score 2e-07
31964011409	PS00455  AMP-binding domain signature.
31964011410	CsbD-like; Region: CsbD; pfam05532
31964011411	HMMPfam hit to PF05532, CsbD-like, score 3.7e-12
31964011412	2 probable transmembrane helices predicted for CMS2587 by TMHMM2.0 at aa 13-35 and 45-64
31964011413	Homeodomain-like domain; Region: HTH_23; cl17451
31964011414	Winged helix-turn helix; Region: HTH_29; pfam13551
31964011415	Integrase core domain; Region: rve; pfam00665
31964011416	Integrase core domain; Region: rve_3; pfam13683
31964011417	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964011418	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964011419	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964011420	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.6e-38
31964011421	ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]; Region: MdlB; COG1132
31964011422	ABC transporter transmembrane region; Region: ABC_membrane; pfam00664
31964011423	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
31964011424	Walker A/P-loop; other site
31964011425	ATP binding site [chemical binding]; other site
31964011426	Q-loop/lid; other site
31964011427	ABC transporter signature motif; other site
31964011428	Walker B; other site
31964011429	D-loop; other site
31964011430	H-loop/switch region; other site
31964011431	HMMPfam hit to PF00005, ABC transporter, score 6.3e-62
31964011432	PS00211 ABC transporters family signature.
31964011433	PS00017 ATP/GTP-binding site motif A (P-loop).
31964011434	HMMPfam hit to PF00664, ABC transporter,transmembrane region, score 5.3e-42
31964011435	6 probable transmembrane helices predicted for CMS2589 by TMHMM2.0 at aa 42-64, 79-101, 156-178, 183-205,265-287 and 297-314
31964011436	ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]; Region: MdlB; COG1132
31964011437	ABC transporter transmembrane region; Region: ABC_membrane; pfam00664
31964011438	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
31964011439	Walker A/P-loop; other site
31964011440	ATP binding site [chemical binding]; other site
31964011441	Q-loop/lid; other site
31964011442	ABC transporter signature motif; other site
31964011443	Walker B; other site
31964011444	D-loop; other site
31964011445	H-loop/switch region; other site
31964011446	HMMPfam hit to PF00005, ABC transporter, score 3.3e-50
31964011447	PS00211 ABC transporters family signature.
31964011448	PS00017 ATP/GTP-binding site motif A (P-loop).
31964011449	6 probable transmembrane helices predicted for CMS2590 by TMHMM2.0 at aa 13-36, 51-73, 130-152, 156-174,241-263 and 273-295
31964011450	HMMPfam hit to PF00664, ABC transporter,transmembrane region, score 4e-41
31964011451	N-Dimethylarginine dimethylaminohydrolase [Amino acid transport and metabolism]; Region: COG1834
31964011452	Amidinotransferase; Region: Amidinotransf; cl12043
31964011453	HMMPfam hit to PF02274, Amidinotransferase, score 5.6e-40
31964011454	4 probable transmembrane helices predicted for CMS2591 by TMHMM2.0 at aa 3-25, 40-59, 66-88 and 103-125
31964011455	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase; Provisional; Region: purH; PRK00881
31964011456	Inosine monophosphate cyclohydrolase domain. This is the N-terminal domain in the purine biosynthesis pathway protein ATIC (purH). The bifunctional ATIC protein contains a C-terminal  ATIC formylase domain that formylates...; Region: IMPCH; cd01421
31964011457	purine monophosphate binding site [chemical binding]; other site
31964011458	dimer interface [polypeptide binding]; other site
31964011459	putative catalytic residues [active]
31964011460	AICARFT/IMPCHase bienzyme; Region: AICARFT_IMPCHas; smart00798
31964011461	AICARFT/IMPCHase bienzyme; Region: AICARFT_IMPCHas; cl03362
31964011462	HMMPfam hit to PF01808, AICARFT/IMPCHase bienzyme,score 6.3e-134
31964011463	HMMPfam hit to PF02142, Methylglyoxal synthase-like, score 1.7e-47
31964011464	phosphoribosylglycinamide formyltransferase; Reviewed; Region: purN; PRK05647
31964011465	Phosphoribosylglycinamide formyltransferase (GAR transformylase, GART); Region: FMT_core_GART; cd08645
31964011466	active site
31964011467	substrate binding site [chemical binding]; other site
31964011468	cosubstrate binding site; other site
31964011469	catalytic site [active]
31964011470	HMMPfam hit to PF00551, Formyl transferase,N-terminal, score 2.5e-44
31964011471	10 probable transmembrane helices predicted for CMS2594 by TMHMM2.0 at aa 7-29, 79-101, 114-133, 143-165,218-240, 250-272, 279-301, 316-338, 351-373 and 388-410
31964011472	succinyl-CoA synthetase subunit alpha; Validated; Region: PRK05678
31964011473	CoA binding domain; Region: CoA_binding; smart00881
31964011474	CoA-ligase; Region: Ligase_CoA; pfam00549
31964011475	HMMPfam hit to PF00549, ATP-citrate lyase/succinyl-CoA ligase, score 3.5e-37
31964011476	PS00399 ATP-citrate lyase / succinyl-CoA ligases family active site.
31964011477	PS01216 ATP-citrate lyase / succinyl-CoA ligases family signature 1.
31964011478	PS00017 ATP/GTP-binding site motif A (P-loop).
31964011479	PS00017 ATP/GTP-binding site motif A (P-loop).
31964011480	HMMPfam hit to PF02629, CoA-binding, score 1.5e-49
31964011481	succinyl-CoA synthetase subunit beta; Provisional; Region: sucC; PRK00696
31964011482	ATP-grasp domain; Region: ATP-grasp_2; pfam08442
31964011483	CoA-ligase; Region: Ligase_CoA; pfam00549
31964011484	HMMPfam hit to PF00549, ATP-citrate lyase/succinyl-CoA ligase, score 1.6e-30
31964011485	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964011486	PS01217 ATP-citrate lyase / succinyl-CoA ligases family signature 3.
31964011487	HMMPfam hit to PF02222, ATP-dependent carboxylate-amine ligase-like, ATP-grasp, score 3.2e-18
31964011488	Uncharacterized protein conserved in bacteria (DUF2236); Region: DUF2236; pfam09995
31964011489	1 probable transmembrane helix predicted for CMS2599 by TMHMM2.0 at aa 97-119
31964011490	ATP-dependent DNA helicase PcrA; Region: pcrA; TIGR01073
31964011491	Part of AAA domain; Region: AAA_19; pfam13245
31964011492	Family description; Region: UvrD_C_2; pfam13538
31964011493	HMMPfam hit to PF00580, UvrD/REP helicase, score 3.8e-189
31964011494	PS00017 ATP/GTP-binding site motif A (P-loop).
31964011495	Homeodomain-like domain; Region: HTH_23; cl17451
31964011496	Winged helix-turn helix; Region: HTH_29; pfam13551
31964011497	Integrase core domain; Region: rve; pfam00665
31964011498	Integrase core domain; Region: rve_3; pfam13683
31964011499	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964011500	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964011501	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964011502	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.6e-38
31964011503	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely...; Region: SGNH_hydrolase; cl01053
31964011504	active site
31964011505	oxyanion hole [active]
31964011506	catalytic triad [active]
31964011507	prenyltransferase; Reviewed; Region: ubiA; PRK13105
31964011508	UbiA prenyltransferase family; Region: UbiA; pfam01040
31964011509	5 probable transmembrane helices predicted for CMS2604 by TMHMM2.0 at aa 98-132, 163-185, 206-228,232-254 and 275-297
31964011510	HMMPfam hit to PF01040, UbiA prenyltransferase,score 6.2e-12
31964011511	lycopene cyclase domain; Region: CarR_dom_SF; TIGR03462
31964011512	3 probable transmembrane helices predicted for CMS2605 by TMHMM2.0 at aa 4-26, 45-67 and 87-109
31964011513	lycopene cyclase domain; Region: CarR_dom_SF; TIGR03462
31964011514	3 probable transmembrane helices predicted for CMS2606 by TMHMM2.0 at aa 4-26, 38-60 and 75-97
31964011515	Trans-Isoprenyl Diphosphate Synthases, head-to-head; Region: Trans_IPPS_HH; cd00683
31964011516	active site lid residues [active]
31964011517	substrate binding pocket [chemical binding]; other site
31964011518	catalytic residues [active]
31964011519	substrate-Mg2+ binding site; other site
31964011520	aspartate-rich region 1; other site
31964011521	aspartate-rich region 2; other site
31964011522	phytoene desaturase; Region: crtI_fam; TIGR02734
31964011523	NAD(P)-binding Rossmann-like domain; Region: NAD_binding_8; pfam13450
31964011524	HMMPfam hit to PF01593, Amine oxidase, score 1.2e-21
31964011525	HMMPfam hit to PF00494, Squalene/phytoene synthase,score 2.4e-10
31964011526	PS01045 Squalene and phytoene synthases signature 2.
31964011527	Geranylgeranyl pyrophosphate synthase [Coenzyme metabolism]; Region: IspA; COG0142
31964011528	Trans-Isoprenyl Diphosphate Synthases, head-to-tail; Region: Trans_IPPS_HT; cd00685
31964011529	substrate binding pocket [chemical binding]; other site
31964011530	chain length determination region; other site
31964011531	substrate-Mg2+ binding site; other site
31964011532	catalytic residues [active]
31964011533	aspartate-rich region 1; other site
31964011534	active site lid residues [active]
31964011535	aspartate-rich region 2; other site
31964011536	HMMPfam hit to PF00348, Polyprenyl synthetase,score 2.3e-30
31964011537	PS00444 Polyprenyl synthetases signature 2.
31964011538	PS00723 Polyprenyl synthetases signature 1.
31964011539	Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway. Isoprenoids comprise a large family of natural products including sterols, carotenoids, dolichols and prenylated...; Region: IPP_Isomerase; cd02885
31964011540	isopentenyl-diphosphate delta-isomerase, type 1; Region: IPP_isom_1; TIGR02150
31964011541	active site
31964011542	metal binding site [ion binding]; metal-binding site
31964011543	nudix motif; other site
31964011544	HMMPfam hit to PF00293, NUDIX hydrolase, score 7.2e-17
31964011545	Helix-turn-helix domain; Region: HTH_38; pfam13936
31964011546	Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair]; Region: Tra8; COG2826
31964011547	Integrase core domain; Region: rve; pfam00665
31964011548	PS00017 ATP/GTP-binding site motif A (P-loop).
31964011549	Predicted helix-turn-helix motif with score 1119.000, SD 3.00 at aa 43-64, sequence MSRRVAASRVGVHERTAQDWDR
31964011550	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.8e-28
31964011551	PS01043 Transposases, IS30 family, signature.
31964011552	Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase), trehalose synthase (also called maltose alpha-D-glucosyltransferase), and related proteins; Region: AmyAc_OligoGlu_TS; cd11332
31964011553	alpha,alpha-phosphotrehalase; Region: trehalose_treC; TIGR02403
31964011554	active site
31964011555	catalytic site [active]
31964011556	Domain of unknown function (DUF3459); Region: DUF3459; pfam11941
31964011557	HMMPfam hit to PF00128, Alpha amylase, catalytic region, score 1.7e-85
31964011558	Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols. AKRs are present in all phyla and are of importance to both health and industrial...; Region: Aldo_ket_red; cd06660
31964011559	Aldo/keto reductase family; Region: Aldo_ket_red; pfam00248
31964011560	active site
31964011561	catalytic tetrad [active]
31964011562	HMMPfam hit to PF00248, Aldo/keto reductase, score 1.2e-58
31964011563	similar to hypothetical protein
31964011564	(R)-hydratase [(R)-specific enoyl-CoA hydratase]. Catalyzes the hydration of trans-2-enoyl CoA to (R)-3-hydroxyacyl-CoA as part of the PHA (polyhydroxyalkanoate) biosynthetic pathway.  The structure of the monomer includes a five-strand antiparallel...; Region: R_hydratase_like; cd03441
31964011565	active site
31964011566	catalytic site [active]
31964011567	HMMPfam hit to PF05921, Actinomycete protein of unknown function DUF875, score 1.5e-37
31964011568	SAV4209_like.  Similar in sequence to the Streptomyces avermitilis SAV4209 protein, with a hot dog fold that is similar to those of (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid...; Region: SAV4209_like; cd03453
31964011569	active site
31964011570	catalytic site [active]
31964011571	HMMPfam hit to PF01575, MaoC-like dehydratase,score 1.9e-14
31964011572	PS00639 Eukaryotic thiol (cysteine) proteases histidine active site.
31964011573	PS00017 ATP/GTP-binding site motif A (P-loop).
31964011574	UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional; Region: murB; PRK13903
31964011575	FAD binding domain; Region: FAD_binding_4; pfam01565
31964011576	UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain; Region: MurB_C; pfam02873
31964011577	HMMPfam hit to PF01565, FAD linked oxidase,N-terminal, score 0.00015
31964011578	HMMPfam hit to PF02873,UDP-N-acetylenolpyruvoylglucosamine reductase, score 8.4e-23
31964011579	submitted with no further information
31964011580	aspartate aminotransferase; Provisional; Region: PRK05764
31964011581	Aspartate aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). Pyridoxal phosphate combines with an alpha-amino acid to form a compound called a Schiff base or aldimine...; Region: AAT_like; cd00609
31964011582	pyridoxal 5'-phosphate binding site [chemical binding]; other site
31964011583	homodimer interface [polypeptide binding]; other site
31964011584	catalytic residue [active]
31964011585	HMMPfam hit to PF00155, Aminotransferase, class I and II, score 3.7e-62
31964011586	PS00105 Aminotransferases class-I pyridoxal-phosphate attachment site.
31964011587	preprotein translocase subunit SecE; Reviewed; Region: secE; PRK07597
31964011588	HMMPfam hit to PF00584, Protein secE/sec61-gamma protein, score 1.8e-17
31964011589	1 probable transmembrane helix predicted for CMS2622 by TMHMM2.0 at aa 52-74
31964011590	transcription antitermination protein NusG; Validated; Region: nusG; PRK05609
31964011591	Bacterial N-Utilization Substance G (NusG) N-terminal (NGN) domain, subgroup 1; Region: NGN_Bact_1; cd09891
31964011592	putative homodimer interface [polypeptide binding]; other site
31964011593	NusG contains an NGN domain at its N-terminus and KOW motif at its C-terminus; Region: KOW_NusG; cd06091
31964011594	heterodimer interface [polypeptide binding]; other site
31964011595	homodimer interface [polypeptide binding]; other site
31964011596	HMMPfam hit to PF02357, Bacterial transcription antitermination protein NusG, score 1e-18
31964011597	HMMPfam hit to PF00467, KOW, score 3.3e-06
31964011598	50S ribosomal protein L11; Validated; Region: rplK; PRK00140
31964011599	Ribosomal protein L11. Ribosomal protein L11, together with proteins L10 and L7/L12, and 23S rRNA, form the L7/L12 stalk on the surface of the large subunit of the ribosome. The homologous eukaryotic cytoplasmic protein is also called 60S ribosomal...; Region: Ribosomal_L11; cd00349
31964011600	23S rRNA interface [nucleotide binding]; other site
31964011601	L7/L12 interface [polypeptide binding]; other site
31964011602	putative thiostrepton binding site; other site
31964011603	L25 interface [polypeptide binding]; other site
31964011604	HMMPfam hit to PF03946, Ribosomal protein L11,score 2.5e-36
31964011605	HMMPfam hit to PF00298, Ribosomal protein L11,score 2.3e-36
31964011606	PS00359 Ribosomal protein L11 signature.
31964011607	Ribosomal protein L1.  The L1 protein, located near the E-site of the ribosome, forms part of the L1 stalk along with 23S rRNA.  In bacteria and archaea, L1 functions both as a ribosomal protein that binds rRNA, and as a translation repressor that binds...; Region: Ribosomal_L1; cd00403
31964011608	mRNA/rRNA interface [nucleotide binding]; other site
31964011609	HMMPfam hit to PF00687, Ribosomal protein L1, score 4.5e-108
31964011610	PS01199 Ribosomal protein L1 signature.
31964011611	Acetyltransferase (GNAT) family; Region: Acetyltransf_1; pfam00583
31964011612	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 4.4e-10
31964011613	NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only]; Region: Qor; COG0604
31964011614	alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases; Region: MDR_like_2; cd05289
31964011615	putative NAD(P) binding site [chemical binding]; other site
31964011616	HMMPfam hit to PF00107, Zinc-containing alcohol dehydrogenase superfamily, score 5.2e-59
31964011617	leucine-zipper of insertion element IS481; Region: LZ_Tnp_IS481; pfam13011
31964011618	Winged helix-turn helix; Region: HTH_29; pfam13551
31964011619	Integrase core domain; Region: rve; pfam00665
31964011620	Integrase core domain; Region: rve_3; pfam13683
31964011621	HMMPfam hit to PF00665, Integrase, catalytic region, score 2.5e-37
31964011622	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964011623	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964011624	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964011625	HMMPfam hit to PF02894, Oxidoreductase, C-terminal,score 2e-05
31964011626	HMMPfam hit to PF01408, Oxidoreductase, N-terminal,score 2.1e-21
31964011627	Type 1 glutamine amidotransferase (GATase1)-like domain; Region: GAT_1; cl00020
31964011628	conserved cys residue [active]
31964011629	HMMPfam hit to PF06283, Protein of unknown function DUF1037, score 6.3e-123
31964011630	HMMPfam hit to PF00005, ABC transporter, score 3.3e-58
31964011631	PS00211 ABC transporters family signature.
31964011632	PS00017 ATP/GTP-binding site motif A (P-loop).
31964011633	2 probable transmembrane helices predicted for CMS2633 by TMHMM2.0 at aa 10-32 and 97-119
31964011634	2 probable transmembrane helices predicted for CMS2634 by TMHMM2.0 at aa 50-72 and 85-107
31964011635	Ferritin-like superfamily of diiron-containing four-helix-bundle proteins; Region: Ferritin_like; cd00657
31964011636	dinuclear metal binding motif [ion binding]; other site
31964011637	1 probable transmembrane helix predicted for CMS2637 by TMHMM2.0 at aa 76-98
31964011638	Predicted membrane protein [Function unknown]; Region: COG2261
31964011639	HMMPfam hit to PF04226, Transglycosylase-associated protein, score 4.4e-05
31964011640	3 probable transmembrane helices predicted for CMS2638 by TMHMM2.0 at aa 22-44, 49-71 and 81-103
31964011641	Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription]; Region: CitB; COG2197
31964011642	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
31964011643	active site
31964011644	phosphorylation site [posttranslational modification]
31964011645	intermolecular recognition site; other site
31964011646	dimerization interface [polypeptide binding]; other site
31964011647	C-terminal DNA-binding domain of LuxR-like proteins. This domain contains a helix-turn-helix motif and binds DNA. Proteins belonging to this group are response regulators; some act as transcriptional activators, others as transcriptional repressors. Many...; Region: LuxR_C_like; cd06170
31964011648	DNA binding residues [nucleotide binding]
31964011649	dimerization interface [polypeptide binding]; other site
31964011650	HMMPfam hit to PF00072, Response regulator receiver, score 4.7e-05
31964011651	HMMPfam hit to PF00196, Bacterial regulatory protein, LuxR, score 5.4e-17
31964011652	PS00017 ATP/GTP-binding site motif A (P-loop).
31964011653	PS00622 Bacterial regulatory proteins, luxR family signature.
31964011654	Predicted helix-turn-helix motif with score 1468.000, SD 4.19 at aa 176-197, sequence KSNQEVAALTYLSPNTVKSYIR
31964011655	Uncharacterized protein family (UPF0156); Region: RHH_2; cl17383
31964011656	HMMPfam hit to PF03693, Protein of unknown function UPF0156, bacterial, score 1.1e-08
31964011657	Fic/DOC family; Region: Fic; cl00960
31964011658	HMMPfam hit to PF02661, Filamentation induced by cAMP protein Fic, score 7.8e-08
31964011659	Microcin C7 self-immunity protein determines resistance to exogenous microcin C7; Region: Peptidase_S66_mccF_like; cd07062
31964011660	putative dimer interface [polypeptide binding]; other site
31964011661	catalytic triad [active]
31964011662	HMMPfam hit to PF02016, Peptidase U61,LD-carboxypeptidase A, score 2.1e-06
31964011663	submitted with no further information
31964011664	cellulose synthase subunit BcsC; Provisional; Region: PRK11447
31964011665	Domain of unknown function (DUF4365); Region: DUF4365; pfam14280
31964011666	ADP-heptose:LPS heptosyltransferase [Cell envelope biogenesis, outer membrane]; Region: RfaF; COG0859
31964011667	Lipopolysaccharide heptosyltransferase is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from...; Region: GT1_LPS_heptosyltransferase; cd03789
31964011668	putative active site [active]
31964011669	HMMPfam hit to PF01075, Glycosyl transferase,family 9, score 1.6e-08
31964011670	Uncharacterized membrane-associated protein [Function unknown]; Region: DedA; COG0586
31964011671	SNARE associated Golgi protein; Region: SNARE_assoc; cl00429
31964011672	4 probable transmembrane helices predicted for CMS2647 by TMHMM2.0 at aa 21-43, 70-92, 157-179 and 189-211
31964011673	HMMPfam hit to PF00597, DedA, score 5.4e-16
31964011674	2 probable transmembrane helices predicted for CMS2649 by TMHMM2.0 at aa 91-110 and 250-272
31964011675	helix_turn_helix multiple antibiotic resistance protein; Region: HTH_MARR; smart00347
31964011676	MarR family; Region: MarR; pfam01047
31964011677	HMMPfam hit to PF01047, Bacterial regulatory protein, MarR, score 1.1e-20
31964011678	Fic/DOC family; Region: Fic; cl00960
31964011679	HMMPfam hit to PF05012, Death-on-curing protein,score 1.1e-11
31964011680	Exonuclease-Endonuclease-Phosphatase domain; uncharacterized family 1; Region: EEP-1; cd09083
31964011681	putative catalytic site [active]
31964011682	putative metal binding site [ion binding]; other site
31964011683	putative phosphate binding site [ion binding]; other site
31964011684	HMMPfam hit to PF03372,Endonuclease/exonuclease/phosphatase, score 3.3e-09
31964011685	5 probable transmembrane helices predicted for CMS2655 by TMHMM2.0 at aa 20-42, 49-71, 111-133, 146-165 and 185-207
31964011686	RloB-like protein; Region: RloB; pfam13707
31964011687	submitted with no further information
31964011688	Predicted ATPases [General function prediction only]; Region: COG1106
31964011689	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
31964011690	Walker A/P-loop; other site
31964011691	ATP binding site [chemical binding]; other site
31964011692	PS00017 ATP/GTP-binding site motif A (P-loop).
31964011693	Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism]; Region: HisB; COG0241
31964011694	Haloacid dehalogenase-like hydrolases. The haloacid dehalogenase-like (HAD) superfamily includes L-2-haloacid dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, and many others; Region: HAD_like; cd01427
31964011695	active site
31964011696	motif I; other site
31964011697	motif II; other site
31964011698	ADP-heptose:LPS heptosyltransferase [Cell envelope biogenesis, outer membrane]; Region: RfaF; COG0859
31964011699	Lipopolysaccharide heptosyltransferase is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from...; Region: GT1_LPS_heptosyltransferase; cd03789
31964011700	putative active site [active]
31964011701	HMMPfam hit to PF00702, Haloacid dehalogenase-like hydrolase, score 0.0029
31964011702	HMMPfam hit to PF01075, Glycosyl transferase,family 9, score 2.3e-07
31964011703	Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate...; Region: Glycosyltransferase_GTB_type; cl10013
31964011704	This family is most closely related to the GT1 family of glycosyltransferases. The sucrose-phosphate synthases in this family may be unique to plants and photosynthetic bacteria. This enzyme catalyzes the synthesis of sucrose 6-phosphate from fructose...; Region: GT1_Sucrose_synthase; cd03800
31964011705	Glycosyltransferase Family 4; Region: Glyco_transf_4; pfam13439
31964011706	putative ADP-binding pocket [chemical binding]; other site
31964011707	Phosphoheptose isomerase is a member of the SIS (Sugar ISomerase) superfamily. Phosphoheptose isomerase catalyzes the isomerization of sedoheptulose 7-phosphate into D-glycero-D-mannoheptose 7-phosphate. This is the first step of the biosynthesis of...; Region: SIS_GmhA; cd05006
31964011708	dimer interface [polypeptide binding]; other site
31964011709	active site
31964011710	HMMPfam hit to PF00534, Glycosyl transferase, group 1, score 7.4e-48
31964011711	HMMPfam hit to PF01380, Sugar isomerase (SIS),score 8.3e-09
31964011712	ribokinase/pfkB superfamily: Kinases that accept a wide variety of substrates, including carbohydrates and aromatic small molecules, all are phosphorylated at a hydroxyl group. The superfamily includes ribokinase, fructokinase, ketohexokinase; Region: ribokinase_pfkB_like; cl00192
31964011713	nucleotidyl transferase superfamily; Region: nt_trans; cl00015
31964011714	active site
31964011715	HIGH motif; other site
31964011716	nucleotide binding site [chemical binding]; other site
31964011717	HMMPfam hit to PF00294, Carbohydrate kinase, PfkB,score 6.4e-15
31964011718	HMMPfam hit to PF01467, Cytidylyltransferase, score 4.1e-17
31964011719	classical (c) SDRs; Region: SDR_c; cd05233
31964011720	NAD(P) binding site [chemical binding]; other site
31964011721	active site
31964011722	HMMPfam hit to PF00106, Short-chain dehydrogenase/reductase SDR, score 3.8e-12
31964011723	PS00061 Short-chain dehydrogenases/reductases family signature.
31964011724	submitted with no further information
31964011725	Peptidase family C39 mostly contains bacteriocin-processing endopeptidases from bacteria. The cysteine peptidases in family C39 cleave the "double-glycine" leader peptides from the precursors of various bacteriocins (mostly non-lantibiotic); Region: Peptidase_C39_like; cl00296
31964011726	putative active site [active]
31964011727	1 probable transmembrane helix predicted for CMS2666 by TMHMM2.0 at aa 13-35
31964011728	Alpha/beta hydrolase; Region: Abhydrolase_8; pfam06259
31964011729	Alpha/beta hydrolase family; Region: Abhydrolase_6; pfam12697
31964011730	1 probable transmembrane helix predicted for CMS2669 by TMHMM2.0 at aa 12-29
31964011731	HMMPfam hit to PF06259, Protein of unknown function DUF1023, score 9.8e-13
31964011732	Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate...; Region: Glycosyltransferase_GTB_type; cl10013
31964011733	HMMPfam hit to PF01075, Glycosyl transferase,family 9, score 3.1e-12
31964011734	Transcriptional regulators [Transcription]; Region: PurR; COG1609
31964011735	Helix-turn-helix (HTH) DNA binding domain of the LacI family of transcriptional regulators; Region: HTH_LacI; cd01392
31964011736	DNA binding site [nucleotide binding]
31964011737	domain linker motif; other site
31964011738	Ligand-binding domain of DNA transcription repressor LacI specific for lactose, a member of the LacI-GalR family of bacterial transcription regulators; Region: PBP1_LacI; cd01574
31964011739	ligand binding site [chemical binding]; other site
31964011740	dimerization interface (open form) [polypeptide binding]; other site
31964011741	dimerization interface (closed form) [polypeptide binding]; other site
31964011742	HMMPfam hit to PF00532, Periplasmic binding protein/LacI transcriptional regulator, score 1.1e-05
31964011743	Predicted helix-turn-helix motif with score 1475.000, SD 4.21 at aa 32-53, sequence VSMADVAAHADVSAQTVSRVSN
31964011744	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cl00427
31964011745	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964011746	dimer interface [polypeptide binding]; other site
31964011747	ABC-ATPase subunit interface; other site
31964011748	putative PBP binding loops; other site
31964011749	6 probable transmembrane helices predicted for CMS2672 by TMHMM2.0 at aa 34-56, 93-115, 128-150, 175-197,227-249 and 285-307
31964011750	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 6.4e-09
31964011751	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964011752	ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism]; Region: UgpE; COG0395
31964011753	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964011754	dimer interface [polypeptide binding]; other site
31964011755	conserved gate region; other site
31964011756	putative PBP binding loops; other site
31964011757	ABC-ATPase subunit interface; other site
31964011758	6 probable transmembrane helices predicted for CMS2673 by TMHMM2.0 at aa 42-64, 111-130, 142-164,174-196, 225-247 and 279-301
31964011759	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 7.8e-11
31964011760	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964011761	ABC-type sugar transport system, periplasmic component [Carbohydrate transport and metabolism]; Region: UgpB; COG1653
31964011762	Bacterial extracellular solute-binding protein; Region: SBP_bac_1; pfam01547
31964011763	HMMPfam hit to PF01547, Bacterial extracellular solute-binding protein, family 1, score 2.9e-27
31964011764	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964011765	Glycosyl hydrolases family 35; Region: Glyco_hydro_35; pfam01301
31964011766	HMMPfam hit to PF01301, Glycoside hydrolase, family 35, score 8.7e-171
31964011767	PS01182 Glycosyl hydrolases family 35  active site.
31964011768	Predicted nuclease of restriction endonuclease-like fold [General    function prediction only]; Region: COG4804
31964011769	Protein of unknown function (DUF1016); Region: DUF1016; pfam06250
31964011770	Predicted nuclease of restriction endonuclease-like fold [General    function prediction only]; Region: COG4804
31964011771	HMMPfam hit to PF06250, Protein of unknown function DUF1016, score 2.1e-93
31964011772	Aldehyde dehydrogenase family; Region: Aldedh; pfam00171
31964011773	NAD(P)+ dependent aldehyde dehydrogenase family; Region: ALDH; cd07078
31964011774	NAD(P) binding site [chemical binding]; other site
31964011775	catalytic residues [active]
31964011776	HMMPfam hit to PF00171, Aldehyde dehydrogenase,score 2.2e-87
31964011777	HMMPfam hit to PF00294, Carbohydrate kinase, PfkB,score 5.2e-21
31964011778	Protein of unknown function (DUF2795); Region: DUF2795; pfam11387
31964011779	Uncharacterized protein conserved in bacteria (DUF2087); Region: DUF2087; pfam09860
31964011780	Zeta toxin; Region: Zeta_toxin; pfam06414
31964011781	Zeta toxin; Region: Zeta_toxin; pfam06414
31964011782	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG4185
31964011783	HMMPfam hit to PF06414, Zeta toxin, score 1.7e-06
31964011784	PS00017 ATP/GTP-binding site motif A (P-loop).
31964011785	Helix-turn-helix domain; Region: HTH_17; pfam12728
31964011786	Predicted helix-turn-helix motif with score 1175.000, SD 3.19 at aa 104-125, sequence LTYRDLMELFQKSRPAILGWLR
31964011787	Predicted helix-turn-helix motif with score 1288.000, SD 3.57 at aa 104-55, sequence AKGTIPGYRISHSWIAFRSEVREWLESTSTVPVPPHEPYPHPLDAYPDHL
31964011788	Predicted helix-turn-helix motif with score 1288.000, SD 3.57 at aa 34-55, sequence LRSADLQRILQIGQTTVSLWFA
31964011789	Membrane proteins related to metalloendopeptidases [Cell envelope biogenesis, outer membrane]; Region: NlpD; COG0739
31964011790	Peptidase family M23; Region: Peptidase_M23; pfam01551
31964011791	HMMPfam hit to PF01551, Peptidase M23B, score 8.6e-13
31964011792	1 probable transmembrane helix predicted for CMS2690 by TMHMM2.0 at aa 20-42
31964011793	1 probable transmembrane helix predicted for CMS2691 by TMHMM2.0 at aa 20-42
31964011794	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964011795	PS00017 ATP/GTP-binding site motif A (P-loop).
31964011796	2 probable transmembrane helices predicted for CMS2694 by TMHMM2.0 at aa 49-71 and 84-106
31964011797	1 probable transmembrane helix predicted for CMS2695 by TMHMM2.0 at aa 13-35
31964011798	8 probable transmembrane helices predicted for CMS2696 by TMHMM2.0 at aa 64-86, 99-121, 141-163, 176-198,237-259, 266-285, 295-317 and 330-352
31964011799	1 probable transmembrane helix predicted for CMS2697 by TMHMM2.0 at aa 20-42
31964011800	AAA-like domain; Region: AAA_10; pfam12846
31964011801	PS00017 ATP/GTP-binding site motif A (P-loop).
31964011802	Type IV secretory pathway, VirD4 components [Intracellular trafficking and secretion]; Region: VirD4; COG3505
31964011803	RecA-like NTPases. This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and...; Region: RecA-like_NTPases; cl17233
31964011804	Walker A motif; other site
31964011805	ATP binding site [chemical binding]; other site
31964011806	TraM recognition site of TraD and TraG; Region: TraG-D_C; pfam12696
31964011807	2 probable transmembrane helices predicted for CMS2699 by TMHMM2.0 at aa 20-42 and 75-97
31964011808	HMMPfam hit to PF02534, TRAG protein, score 1.3e-06
31964011809	PS00017 ATP/GTP-binding site motif A (P-loop).
31964011810	3 probable transmembrane helices predicted for CMS2701 by TMHMM2.0 at aa 11-33, 43-62 and 154-176
31964011811	FOG: GAF domain [Signal transduction mechanisms]; Region: FhlA; COG2203
31964011812	GAF domain; Region: GAF; pfam01590
31964011813	Stage II sporulation protein E (SpoIIE); Region: SpoIIE; pfam07228
31964011814	HMMPfam hit to PF07228, Stage II sporulation E,score 1.2e-29
31964011815	HMMPfam hit to PF01590, GAF, score 2.5e-18
31964011816	Stage II sporulation protein E (SpoIIE); Region: SpoIIE; pfam07228
31964011817	HMMPfam hit to PF07228, Stage II sporulation E,score 2.1e-32
31964011818	5 probable transmembrane helices predicted for CMS2703 by TMHMM2.0 at aa 47-69, 73-93, 100-119, 144-166 and 173-190
31964011819	Histidine kinase-like ATPase domain; Region: HATPase_c_2; pfam13581
31964011820	Sulphate Transporter and Anti-Sigma factor antagonist) domain of anti-anti-sigma factors, key regulators of anti-sigma factors by phosphorylation; Region: STAS_anti-anti-sigma_factors; cd07043
31964011821	anti sigma factor interaction site; other site
31964011822	regulatory phosphorylation site [posttranslational modification]; other site
31964011823	HMMPfam hit to PF01740, Sulfate transporter/antisigma-factor antagonist STAS, score 4.8e-12
31964011824	Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction; Region: HP_PGM_like; cd07067
31964011825	catalytic core [active]
31964011826	HMMPfam hit to PF00300,Phosphoglycerate/bisphosphoglycerate mutase, score 2.3e-12
31964011827	3 probable transmembrane helices predicted for CMS2708 by TMHMM2.0 at aa 13-35, 50-72 and 106-123
31964011828	Proteins of this family catalyze the reduction of flavin or nitrocompounds using NAD(P)H as electron donor in a obligatory two-electron transfer,  utilizing FMN or FAD as cofactor. They are often found to be homodimers. Enzymes of this family are...; Region: Nitro_FMN_reductase; cd02062
31964011829	FMN binding site [chemical binding]; other site
31964011830	Proteins of this family catalyze the reduction of flavin or nitrocompounds using NAD(P)H as electron donor in a obligatory two-electron transfer,  utilizing FMN or FAD as cofactor. They are often found to be homodimers. Enzymes of this family are...; Region: Nitro_FMN_reductase; cl00514
31964011831	dimer interface [polypeptide binding]; other site
31964011832	HMMPfam hit to PF00881, Nitroreductase, score 0.00036
31964011833	4 probable transmembrane helices predicted for CMS2710 by TMHMM2.0 at aa 20-42, 52-74, 230-248 and 258-280
31964011834	2 probable transmembrane helices predicted for CMS2711 by Phobius
31964011835	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cd04301
31964011836	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cl17182
31964011837	Coenzyme A binding pocket [chemical binding]; other site
31964011838	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 3.6e-06
31964011839	Protein of unknown function (DUF3494); Region: DUF3494; pfam11999
31964011840	2 probable transmembrane helices predicted for tmhmm2embl_unknown_000008_2857770_2858894 by TMHMM2.0 at aa 20-42 and 347-369
31964011841	PS00343 Gram-positive cocci surface proteins 'anchoring' hexapeptide.
31964011842	submitted with no further information
31964011843	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964011844	dimer interface [polypeptide binding]; other site
31964011845	conserved gate region; other site
31964011846	putative PBP binding loops; other site
31964011847	ABC-ATPase subunit interface; other site
31964011848	6 probable transmembrane helices predicted for CMS2715 by TMHMM2.0 at aa 30-52, 93-115, 128-150, 180-199,226-248 and 284-306
31964011849	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 5.9e-13
31964011850	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964011851	ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism]; Region: UgpE; COG0395
31964011852	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964011853	dimer interface [polypeptide binding]; other site
31964011854	conserved gate region; other site
31964011855	putative PBP binding loops; other site
31964011856	ABC-ATPase subunit interface; other site
31964011857	6 probable transmembrane helices predicted for CMS2716 by TMHMM2.0 at aa 60-82, 124-146, 153-175,181-203, 261-283 and 298-320
31964011858	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 4.2e-13
31964011859	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964011860	HipA N-terminal domain; Region: Couple_hipA; cl11853
31964011861	HipA-like N-terminal domain; Region: HipA_N; pfam07805
31964011862	HipA-like C-terminal domain; Region: HipA_C; pfam07804
31964011863	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
31964011864	non-specific DNA binding site [nucleotide binding]; other site
31964011865	salt bridge; other site
31964011866	sequence-specific DNA binding site [nucleotide binding]; other site
31964011867	HMMPfam hit to PF01381, Helix-turn-helix motif,score 5.7e-05
31964011868	Predicted helix-turn-helix motif with score 1371.000, SD 3.86 at aa 36-57, sequence MTQSDLAEKLGFERFYVRELET
31964011869	Small Multidrug Resistance protein; Region: Multi_Drug_Res; cl00910
31964011870	4 probable transmembrane helices predicted for CMS2719 by TMHMM2.0 at aa 34-53, 63-82, 89-111 and 115-137
31964011871	HMMPfam hit to PF00893, Small multidrug resistance protein, score 1.4e-14
31964011872	ABC-type sugar transport system, periplasmic component [Carbohydrate transport and metabolism]; Region: UgpB; COG1653
31964011873	Bacterial extracellular solute-binding protein; Region: SBP_bac_1; cl17199
31964011874	HMMPfam hit to PF01547, Bacterial extracellular solute-binding protein, family 1, score 1.3e-10
31964011875	PS00017 ATP/GTP-binding site motif A (P-loop).
31964011876	1 probable transmembrane helix predicted for CMS2720 by TMHMM2.0 at aa 7-29
31964011877	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964011878	alpha/beta hydrolase fold; Region: Abhydrolase_3; pfam07859
31964011879	Protein of unknown function (DUF2424); Region: DUF2424; pfam10340
31964011880	Bacterial fructose-1,6-bisphosphatase, glpX-encoded. A dimeric enzyme dependent on Mg(2+). glpX-encoded FPBase (FBPase class II) differs from other members of the inositol-phosphatase superfamily by permutation of secondary structure elements. The core...; Region: FBPase_glpX; cd01516
31964011881	Bacterial fructose-1,6-bisphosphatase, glpX-encoded; Region: FBPase_glpX; pfam03320
31964011882	putative active site [active]
31964011883	HMMPfam hit to PF03320, GlpX, score 2.8e-162
31964011884	Predicted permease, member of the PurR regulon [General function prediction only]; Region: yhhT; COG0628
31964011885	Domain of unknown function DUF20; Region: UPF0118; pfam01594
31964011886	HMMPfam hit to PF01594, Protein of unknown function UPF0118, score 1.7e-45
31964011887	8 probable transmembrane helices predicted for CMS2723 by TMHMM2.0 at aa 79-98, 103-125, 132-154,217-239, 274-296, 300-322, 329-351 and 371-393
31964011888	PS00136 Serine proteases, subtilase family,aspartic acid active site.
31964011889	leucine-zipper of insertion element IS481; Region: LZ_Tnp_IS481; pfam13011
31964011890	Winged helix-turn helix; Region: HTH_29; pfam13551
31964011891	Integrase core domain; Region: rve; pfam00665
31964011892	Integrase core domain; Region: rve_3; pfam13683
31964011893	HMMPfam hit to PF00665, Integrase, catalytic region, score 3.5E-36
31964011894	Predicted helix-turn-helix motif with score 991.000, SD 2.56 at aa 87-108, sequence AGPARLAPVTGVPSRTISRILR
31964011895	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 87-46, sequence NRFRAEGLRGLTDRSSRPRSVPRRTSPERERAVLEARAQLRA
31964011896	Predicted helix-turn-helix motif with score 1740.000, SD 5.11 at aa 25-46, sequence RPVAHVARELGVSRQCAHRWVN
31964011897	phosphate ABC transporter, permease protein PstA; Region: 3a0107s02c; TIGR00974
31964011898	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964011899	dimer interface [polypeptide binding]; other site
31964011900	conserved gate region; other site
31964011901	putative PBP binding loops; other site
31964011902	ABC-ATPase subunit interface; other site
31964011903	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 8.1e-27
31964011904	7 probable transmembrane helices predicted for CMS2725 by TMHMM2.0 at aa 24-46, 59-81, 114-136, 149-171,175-197, 229-251 and 300-322
31964011905	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964011906	PS00038 Myc-type, 'helix-loop-helix' dimerization domain signature.
31964011907	phosphate transporter permease subunit PstC; Provisional; Region: pstC; PRK11275
31964011908	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964011909	dimer interface [polypeptide binding]; other site
31964011910	conserved gate region; other site
31964011911	putative PBP binding loops; other site
31964011912	ABC-ATPase subunit interface; other site
31964011913	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 4.7e-13
31964011914	6 probable transmembrane helices predicted for CMS2726 by TMHMM2.0 at aa 46-68, 98-120, 132-154, 183-205,255-277 and 304-326
31964011915	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964011916	PBP superfamily domain; Region: PBP_like_2; cl17296
31964011917	HMMPfam hit to PF01547, Bacterial extracellular solute-binding protein, family 1, score 4.5e-09
31964011918	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964011919	Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily. Ap6A hydrolase specifically hydrolyzes diadenosine polyphosphates, but not ATP or diadenosine triphosphate, and it generates ATP as the product. Ap6A, the most...; Region: Ap6A_hydrolase; cd03673
31964011920	active site
31964011921	Ap6A binding site [chemical binding]; other site
31964011922	nudix motif; other site
31964011923	metal binding site [ion binding]; metal-binding site
31964011924	Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction; Region: HP_PGM_like; cd07067
31964011925	catalytic core [active]
31964011926	PS00216 Sugar transport proteins signature 1.
31964011927	HMMPfam hit to PF00293, NUDIX hydrolase, score 5e-22
31964011928	PS00893 mutT domain signature.
31964011929	polyphosphate kinase; Provisional; Region: PRK05443
31964011930	Polyphosphate kinase N-terminal domain; Region: PP_kinase_N; pfam13089
31964011931	Polyphosphate kinase middle domain; Region: PP_kinase; pfam02503
31964011932	Catalytic C-terminal domain, first repeat, of Pseudomonas aeruginosa polyphosphate kinase 1 and similar proteins; Region: PLDc_PaPPK1_C1_like; cd09165
31964011933	putative domain interface [polypeptide binding]; other site
31964011934	putative active site [active]
31964011935	catalytic site [active]
31964011936	Catalytic C-terminal domain, second repeat, of Pseudomonas aeruginosa polyphosphate kinase 1 and similar proteins; Region: PLDc_PaPPK1_C2_like; cd09168
31964011937	putative domain interface [polypeptide binding]; other site
31964011938	putative active site [active]
31964011939	catalytic site [active]
31964011940	HMMPfam hit to PF02503, Polyphosphate kinase, score 0
31964011941	mycothiol synthase; Region: mycothiol_MshD; TIGR03448
31964011942	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cd04301
31964011943	Coenzyme A binding pocket [chemical binding]; other site
31964011944	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 1.2e-15
31964011945	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 4.8e-07
31964011946	DNA-binding response regulator CreB; Provisional; Region: PRK11083
31964011947	Effector domain of response regulator. Bacteria and certain eukaryotes like protozoa and higher plants use two-component signal transduction systems to detect and respond to changes in the environment. The system consists of a sensor histidine kinase and...; Region: trans_reg_C; cd00383
31964011948	DNA binding site [nucleotide binding]
31964011949	HMMPfam hit to PF00486, Transcriptional regulatory protein, C-terminal, score 5.9e-24
31964011950	3 probable transmembrane helices predicted for CMS2732 by TMHMM2.0 at aa 7-26, 31-53 and 65-87
31964011951	1 probable transmembrane helix predicted for CMS2733 by TMHMM2.0 at aa 10-32
31964011952	nitrobindin heme-binding domain; Region: nitrobindin; cd07828
31964011953	heme-binding site [chemical binding]; other site
31964011954	Predicted aminomethyltransferase related to GcvT [General function prediction only]; Region: COG0354
31964011955	folate-binding protein YgfZ; Region: ygfZ_signature; TIGR03317
31964011956	Glycine cleavage T-protein C-terminal barrel domain; Region: GCV_T_C; pfam08669
31964011957	HMMPfam hit to PF01571, Glycine cleavage T protein (aminomethyl transferase), score 7.6e-08
31964011958	Predicted membrane protein [Function unknown]; Region: COG4129
31964011959	4 probable transmembrane helices predicted for CMS2736 by TMHMM2.0 at aa 29-51, 100-122, 129-148 and 152-174
31964011960	1 probable transmembrane helix predicted for CMS2737 by TMHMM2.0 at aa 27-49
31964011961	PS00142 Neutral zinc metallopeptidases,zinc-binding region signature.
31964011962	PS00339 Aminoacyl-transfer RNA synthetases class-II signature 2.
31964011963	Methyltransferase domain; Region: Methyltransf_18; pfam12847
31964011964	Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction; Region: HP_PGM_like; cd07067
31964011965	catalytic core [active]
31964011966	HMMPfam hit to PF00300,Phosphoglycerate/bisphosphoglycerate mutase, score 1.8e-121
31964011967	phosphate transport system regulatory protein PhoU; Region: phoU_full; TIGR02135
31964011968	PhoU domain; Region: PhoU; pfam01895
31964011969	PhoU domain; Region: PhoU; pfam01895
31964011970	HMMPfam hit to PF01895, PhoU, score 3.3e-13
31964011971	HMMPfam hit to PF01895, PhoU, score 7.5e-23
31964011972	phosphate regulon sensor kinase PhoR; Region: phoR_proteo; TIGR02966
31964011973	Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via...; Region: HisKA; cd00082
31964011974	dimer interface [polypeptide binding]; other site
31964011975	phosphorylation site [posttranslational modification]
31964011976	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
31964011977	ATP binding site [chemical binding]; other site
31964011978	G-X-G motif; other site
31964011979	1 probable transmembrane helix predicted for CMS2741 by TMHMM2.0 at aa 2-24
31964011980	HMMPfam hit to PF00512, Histidine kinase A,N-terminal, score 5.6e-15
31964011981	HMMPfam hit to PF02518, ATP-binding region,ATPase-like, score 6.1e-45
31964011982	Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription]; Region: OmpR; COG0745
31964011983	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
31964011984	active site
31964011985	phosphorylation site [posttranslational modification]
31964011986	intermolecular recognition site; other site
31964011987	dimerization interface [polypeptide binding]; other site
31964011988	Effector domain of response regulator. Bacteria and certain eukaryotes like protozoa and higher plants use two-component signal transduction systems to detect and respond to changes in the environment. The system consists of a sensor histidine kinase and...; Region: trans_reg_C; cd00383
31964011989	DNA binding site [nucleotide binding]
31964011990	HMMPfam hit to PF00072, Response regulator receiver, score 6.3e-40
31964011991	HMMPfam hit to PF00486, Transcriptional regulatory protein, C-terminal, score 1.3e-26
31964011992	PS00777 Glycosyl hydrolases family 11 active site signature 2.
31964011993	1 probable transmembrane helix predicted for CMS2743 by TMHMM2.0 at aa 7-29
31964011994	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964011995	Transcriptional regulators, similar to M. xanthus CarD [Transcription]; Region: COG1329
31964011996	HMMPfam hit to PF02559, Transcription factor CarD,score 4.8e-28
31964011997	bifunctional 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase/2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase protein; Provisional; Region: ispDF; PRK09382
31964011998	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold; Region: Glyco_tranf_GTA_type; cl11394
31964011999	active site
31964012000	MECDP_synthase (2-C-methyl-D-erythritol-2,4-cyclodiphosphate synthase), encoded by the ispF gene, catalyzes the formation of 2-C-methyl-D-erythritol 2,4-cyclodiphosphate (MEC) in the non-mevalonate deoxyxylulose (DOXP) pathway for isoprenoid biosynthesis; Region: MECDP_synthase; cd00554
31964012001	homotrimer interaction site [polypeptide binding]; other site
31964012002	zinc binding site [ion binding]; other site
31964012003	CDP-binding sites; other site
31964012004	HMMPfam hit to PF01128,4-diphosphocytidyl-2C-methyl-D-erythritol synthase, score 3.4e-54
31964012005	PS01295 Uncharacterized protein family UPF0007 signature.
31964012006	HMMPfam hit to PF02542, MECDP-synthase, score 2.4e-59
31964012007	cysteinyl-tRNA synthetase; Validated; Region: cysS; PRK00260
31964012008	nucleotidyl transferase superfamily; Region: nt_trans; cl00015
31964012009	active site
31964012010	HIGH motif; other site
31964012011	nucleotide binding site [chemical binding]; other site
31964012012	catalytic core domain of cysteinyl tRNA synthetase; Region: CysRS_core; cd00672
31964012013	KMSKS motif; other site
31964012014	Anticodon-binding domain of class Ia aminoacyl tRNA synthetases and similar domains; Region: Anticodon_Ia_like; cl12020
31964012015	HMMPfam hit to PF01406, Cysteinyl-tRNA synthetase,class Ia, score 9.2e-157
31964012016	rRNA methylases [Translation, ribosomal structure and biogenesis]; Region: SpoU; COG0566
31964012017	RNA 2'-O ribose methyltransferase substrate binding; Region: SpoU_sub_bind; pfam08032
31964012018	SpoU rRNA Methylase family; Region: SpoU_methylase; pfam00588
31964012019	HMMPfam hit to PF00588, tRNA/rRNA methyltransferase (SpoU), score 1.9e-40
31964012020	Domain of unknown function (DUF4032); Region: DUF4032; pfam13224
31964012021	glycerol-3-phosphate transporter ATP-binding subunit; Provisional; Region: ugpC; PRK11650
31964012022	The N-terminal ATPase domain of the maltose transporter, MalK; Region: ABC_MalK_N; cd03301
31964012023	Walker A/P-loop; other site
31964012024	ATP binding site [chemical binding]; other site
31964012025	Q-loop/lid; other site
31964012026	ABC transporter signature motif; other site
31964012027	Walker B; other site
31964012028	D-loop; other site
31964012029	H-loop/switch region; other site
31964012030	TOBE domain; Region: TOBE_2; pfam08402
31964012031	HMMPfam hit to PF03459, TOBE, score 2.3e-07
31964012032	HMMPfam hit to PF00005, ABC transporter, score 4.6e-59
31964012033	PS00211 ABC transporters family signature.
31964012034	PS00017 ATP/GTP-binding site motif A (P-loop).
31964012035	Thioredoxin; Region: Thioredoxin_4; cl17273
31964012036	1 probable transmembrane helix predicted for CMS2750 by TMHMM2.0 at aa 41-63
31964012037	Nitroreductase-like family which includes NADH oxidase and arsenite oxidiase. NADH oxidase catalyses the oxidation of NAD(P)H and accepts a wide broad range of compounds as electron acceptors, such as nitrocompound. Arsenite oxidase in a...; Region: Arsenite_oxidase; cd02135
31964012038	putative FMN binding site [chemical binding]; other site
31964012039	HMMPfam hit to PF00881, Nitroreductase, score 5.1e-06
31964012040	PS00626 Regulator of chromosome condensation (RCC1) signature 2.
31964012041	methionine sulfoxide reductase B; Provisional; Region: PRK00222
31964012042	SelR domain; Region: SelR; pfam01641
31964012043	HMMPfam hit to PF01641, Protein of unknown function DUF25, score 4.6e-76
31964012044	Protein of unknown function (DUF3263); Region: DUF3263; pfam11662
31964012045	LytR cell envelope-related transcriptional attenuator; Region: LytR_C; pfam13399
31964012046	Cold-Shock Protein (CSP) contains an S1-like cold-shock domain (CSD) that is found in eukaryotes, prokaryotes, and archaea.  CSP's include the major cold-shock proteins CspA and CspB in bacteria and the eukaryotic gene regulatory factor Y-box...; Region: CSP_CDS; cd04458
31964012047	DNA-binding site [nucleotide binding]; DNA binding site
31964012048	RNA-binding motif; other site
31964012049	HMMPfam hit to PF00313, Cold-shock protein,DNA-binding, score 1.3e-33
31964012050	chaperonin GroEL; Reviewed; Region: groEL; PRK12849
31964012051	GroEL_like type I chaperonin. Chaperonins are involved in productive folding of proteins. They share a common general morphology, a double toroid of 2 stacked rings, each composed of 7-9 subunits. The symmetry of type I is seven-fold and they are found...; Region: GroEL; cd03344
31964012052	ring oligomerisation interface [polypeptide binding]; other site
31964012053	ATP/Mg binding site [chemical binding]; other site
31964012054	stacking interactions; other site
31964012055	hinge regions; other site
31964012056	HMMPfam hit to PF00118, Chaperonin Cpn60/TCP-1,score 1.8e-193
31964012057	PS00296 Chaperonins cpn60 signature.
31964012058	WXG100 family type VII secretion target; Region: WXG100_ESAT6; TIGR03930
31964012059	HMMPfam hit to PF06013, Bacterial protein of unknown function DUF909, score 8e-14
31964012060	Histidine kinase, Adenylyl cyclase, Methyl-accepting protein, and Phosphatase (HAMP) domain. HAMP is a signaling domain which occurs in a wide variety of signaling proteins, many of which are bacterial. The HAMP domain consists of two alpha helices...; Region: HAMP; cd06225
31964012061	dimerization interface [polypeptide binding]; other site
31964012062	Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via...; Region: HisKA; cd00082
31964012063	dimer interface [polypeptide binding]; other site
31964012064	phosphorylation site [posttranslational modification]
31964012065	Signal transduction histidine kinase [Signal transduction mechanisms]; Region: BaeS; COG0642
31964012066	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
31964012067	ATP binding site [chemical binding]; other site
31964012068	Mg2+ binding site [ion binding]; other site
31964012069	G-X-G motif; other site
31964012070	HMMPfam hit to PF02518, ATP-binding region,ATPase-like, score 9.2e-39
31964012071	HMMPfam hit to PF00512, Histidine kinase A,N-terminal, score 1.6e-19
31964012072	HMMPfam hit to PF00672, Histidine kinase, HAMP region, score 3e-11
31964012073	2 probable transmembrane helices predicted for CMS2758 by TMHMM2.0 at aa 22-44 and 174-196
31964012074	Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription]; Region: OmpR; COG0745
31964012075	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
31964012076	active site
31964012077	phosphorylation site [posttranslational modification]
31964012078	intermolecular recognition site; other site
31964012079	dimerization interface [polypeptide binding]; other site
31964012080	Effector domain of response regulator. Bacteria and certain eukaryotes like protozoa and higher plants use two-component signal transduction systems to detect and respond to changes in the environment. The system consists of a sensor histidine kinase and...; Region: trans_reg_C; cd00383
31964012081	DNA binding site [nucleotide binding]
31964012082	HMMPfam hit to PF00486, Transcriptional regulatory protein, C-terminal, score 6.3e-27
31964012083	HMMPfam hit to PF00072, Response regulator receiver, score 5.8e-43
31964012084	Helicase conserved C-terminal domain; Region: Helicase_C_3; pfam13625
31964012085	DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair]; Region: SSL2; COG1061
31964012086	DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region; Region: DEXDc; cd00046
31964012087	ATP binding site [chemical binding]; other site
31964012088	putative Mg++ binding site [ion binding]; other site
31964012089	Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may...; Region: HELICc; cd00079
31964012090	nucleotide binding region [chemical binding]; other site
31964012091	ATP-binding site [chemical binding]; other site
31964012092	HMMPfam hit to PF00271, Helicase, C-terminal, score 1.6e-11
31964012093	HMMPfam hit to PF00270, DEAD/DEAH box helicase,N-terminal, score 5.5e-10
31964012094	HMMPfam hit to PF04851, Type III restriction enzyme, res subunit, score 4.2e-12
31964012095	Helicase conserved C-terminal domain; Region: Helicase_C_3; pfam13625
31964012096	2 probable transmembrane helices predicted for CMS2762 by TMHMM2.0 at aa 20-42 and 52-74
31964012097	Cold-Shock Protein (CSP) contains an S1-like cold-shock domain (CSD) that is found in eukaryotes, prokaryotes, and archaea.  CSP's include the major cold-shock proteins CspA and CspB in bacteria and the eukaryotic gene regulatory factor Y-box...; Region: CSP_CDS; cd04458
31964012098	DNA-binding site [nucleotide binding]; DNA binding site
31964012099	RNA-binding motif; other site
31964012100	HMMPfam hit to PF00313, Cold-shock protein,DNA-binding, score 2.8e-08
31964012101	PS00352 'Cold-shock' DNA-binding domain signature.
31964012102	Protein of unknown function (DUF3027); Region: DUF3027; pfam11228
31964012103	phosphoserine aminotransferase; Provisional; Region: PRK03080
31964012104	pyridoxal 5'-phosphate binding pocket [chemical binding]; other site
31964012105	catalytic residue [active]
31964012106	Iron dependent repressor, N-terminal DNA binding domain; Region: Fe_dep_repress; pfam01325
31964012107	Helix-turn-helix diphteria tox regulatory element; Region: HTH_DTXR; smart00529
31964012108	Iron dependent repressor, metal binding and dimerisation domain; Region: Fe_dep_repr_C; pfam02742
31964012109	This entry represents the core domain of the ferrous iron (Fe2+) transport protein FeoA found in bacteria; Region: FeoA; smart00899
31964012110	HMMPfam hit to PF01325, Iron dependent repressor,score 4.4e-26
31964012111	HMMPfam hit to PF02742, Iron dependent repressor,score 2.6e-32
31964012112	HMMPfam hit to PF04023, FeoA, score 0.0018
31964012113	Cell wall-associated hydrolases (invasion-associated proteins) [Cell envelope biogenesis, outer membrane]; Region: Spr; COG0791
31964012114	NlpC/P60 family; Region: NLPC_P60; pfam00877
31964012115	1 probable transmembrane helix predicted for CMS2767 by TMHMM2.0 at aa 94-116
31964012116	HMMPfam hit to PF00877, NLP/P60, score 3.4e-27
31964012117	Restriction endonuclease [Defense mechanisms]; Region: McrA; COG1403
31964012118	HNH nucleases; HNH endonuclease signature which is found in viral, prokaryotic, and eukaryotic proteins. The alignment includes members of the large group of homing endonucleases, yeast intron 1 protein, MutS, as well as bacterial colicins, pyocins, and...; Region: HNHc; cd00085
31964012119	active site
31964012120	HMMPfam hit to PF01844, HNH endonuclease, score 2e-13
31964012121	Serine proteases of the peptidase family S9A [Amino acid transport and metabolism]; Region: COG1505
31964012122	Prolyl oligopeptidase family; Region: Peptidase_S9; pfam00326
31964012123	HMMPfam hit to PF02897, Peptidase S9A, prolyl oligopeptidase, N-terminal beta-propeller, score 2.7e-24
31964012124	HMMPfam hit to PF00326, Peptidase S9, prolyl oligopeptidase active site region, score 3.8e-51
31964012125	Bacterial transcriptional activator domain; Region: BTAD; smart01043
31964012126	HMMPfam hit to PF03704, Bacterial transcriptional activator domain, score 9.7e-12
31964012127	1 probable transmembrane helix predicted for CMS2771 by TMHMM2.0 at aa 279-298
31964012128	PS00178 Aminoacyl-transfer RNA synthetases class-I signature.
31964012129	Lsr2; Region: Lsr2; pfam11774
31964012130	Telomere recombination; Region: Sua5_yciO_yrdC; cl00305
31964012131	Protein of unknown function (DUF2510); Region: DUF2510; pfam10708
31964012132	Domain of unknown function (DUF4041); Region: DUF4041; pfam13250
31964012133	This entry represents the putative helicase A859L; Region: T5orf172; smart00974
31964012134	N-methylhydantoinase A/acetone carboxylase, beta subunit [Amino acid transport and metabolism / Secondary metabolites biosynthesis, transport, and catabolism]; Region: HyuA; COG0145
31964012135	Hydantoinase/oxoprolinase N-terminal region; Region: Hydant_A_N; pfam05378
31964012136	Hydantoinase/oxoprolinase; Region: Hydantoinase_A; pfam01968
31964012137	HMMPfam hit to PF01968, Hydantoinase/oxoprolinase,score 3.6e-34
31964012138	HMMPfam hit to PF05378, Hydantoinaseoxoprolinase,N-terminal, score 1.1e-51
31964012139	Solute carrier families 5 and 6-like; solute binding domain; Region: SLC5-6-like_sbd; cl00456
31964012140	Permease for cytosine/purines, uracil, thiamine, allantoin; Region: Transp_cyt_pur; pfam02133
31964012141	Na binding site [ion binding]; other site
31964012142	HMMPfam hit to PF02133, Permease for cytosine/purines, uracil, thiamine, allantoin, score 1.1e-07
31964012143	11 probable transmembrane helices predicted for CMS2776 by TMHMM2.0 at aa 54-76, 92-114, 129-151, 156-175,190-212, 232-254, 259-278, 306-325, 330-352, 365-387 and 391-413
31964012144	submitted with no further information
31964012145	4 probable transmembrane helices predicted for CMS2778 by TMHMM2.0 at aa 35-57, 62-84, 97-119 and 124-146
31964012146	GIY-YIG domain of uncharacterized bacterial protein structurally related to COG3410; Region: GIY-YIG_COG3410; cd10439
31964012147	GIY-YIG motif/motif A; other site
31964012148	putative active site [active]
31964012149	putative metal binding site [ion binding]; other site
31964012150	Uncharacterized conserved protein (DUF2075); Region: DUF2075; pfam09848
31964012151	Uncharacterized conserved protein [Function unknown]; Region: COG3410
31964012152	PS00017 ATP/GTP-binding site motif A (P-loop).
31964012153	Nucleoside Triphosphate Pyrophosphohydrolase (EC 3.6.1.8) MazG-like domain found in mouse RS21-C6 protein and its homologs; Region: NTP-PPase_RS21-C6_like; cd11537
31964012154	homodimer interface [polypeptide binding]; other site
31964012155	chemical substrate binding site [chemical binding]; other site
31964012156	oligomer interface [polypeptide binding]; other site
31964012157	metal binding site [ion binding]; metal-binding site
31964012158	Uncharacterized conserved protein [Function unknown]; Region: COG4748
31964012159	Type I restriction enzyme R protein N terminus (HSDR_N); Region: HSDR_N; cl14958
31964012160	HMMPfam hit to PF04313, Protein of unknown function DUF450, score 2.8e-24
31964012161	RecA-like NTPases. This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and...; Region: RecA-like_NTPases; cl17233
31964012162	AAA-like domain; Region: AAA_10; pfam12846
31964012163	Walker A motif; other site
31964012164	ATP binding site [chemical binding]; other site
31964012165	Walker B motif; other site
31964012166	HMMPfam hit to PF02534, TRAG protein, score 0.00064
31964012167	PS00017 ATP/GTP-binding site motif A (P-loop).
31964012168	3 probable transmembrane helices predicted for CMS2790 by TMHMM2.0 at aa 107-129, 139-161 and 188-210
31964012169	2 probable transmembrane helices predicted for CMS2791 by TMHMM2.0 at aa 49-71 and 552-574
31964012170	PS00136 Serine proteases, subtilase family,aspartic acid active site.
31964012171	Protein of unknown function DUF86; Region: DUF86; cl01031
31964012172	HMMPfam hit to PF01934, Protein of unknown function DUF86, score 7.3e-06
31964012173	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
31964012174	sequence-specific DNA binding site [nucleotide binding]; other site
31964012175	salt bridge; other site
31964012176	Nucleotidyltransferase (NT) domain of Staphylococcus aureus kanamycin nucleotidyltransferase, and similar proteins; Region: NT_KNTase_like; cd05403
31964012177	active site
31964012178	NTP binding site [chemical binding]; other site
31964012179	metal binding triad [ion binding]; metal-binding site
31964012180	antibiotic binding site [chemical binding]; other site
31964012181	HMMPfam hit to PF01381, Helix-turn-helix motif,score 2.3e-13
31964012182	Protein of unknown function (DUF4011); Region: DUF4011; pfam13195
31964012183	Part of AAA domain; Region: AAA_19; pfam13245
31964012184	Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair]; Region: COG1112
31964012185	PS00017 ATP/GTP-binding site motif A (P-loop).
31964012186	Homeodomain-like domain; Region: HTH_23; cl17451
31964012187	Winged helix-turn helix; Region: HTH_29; pfam13551
31964012188	Integrase core domain; Region: rve; pfam00665
31964012189	Integrase core domain; Region: rve_3; pfam13683
31964012190	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.6e-38
31964012191	The S26 Type I signal peptidase (SPase; LepB; leader peptidase B; leader peptidase I; EC 3.4.21.89) family members are essential membrane-bound serine proteases that function to cleave the amino-terminal signal peptide extension from proteins that are...; Region: S26_SPase_I; cd06530
31964012192	Catalytic site [active]
31964012193	4 probable transmembrane helices predicted for CMS2797 by TMHMM2.0 at aa 90-112, 212-229, 241-263 and 325-347
31964012194	HMMPfam hit to PF00717, Peptidase S24, S26A and S26B, score 0.022
31964012195	Concanavalin A-like lectin/glucanases superfamily; Region: Laminin_G_3; pfam13385
31964012196	SnoaL-like domain; Region: SnoaL_2; pfam12680
31964012197	Nuclear transport factor 2 (NTF2-like) superfamily. This family includes members of the NTF2 family, Delta-5-3-ketosteroid isomerases, Scytalone Dehydratases, and the beta subunit of Ring hydroxylating dioxygenases. This family is a classic example of...; Region: NTF2_like; cl09109
31964012198	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964012199	1 probable transmembrane helix predicted for CMS2800 by TMHMM2.0 at aa 7-29
31964012200	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964012201	1 probable transmembrane helix predicted for CMS2801 by TMHMM2.0 at aa 32-54
31964012202	The S26 Type I signal peptidase (SPase; LepB; leader peptidase B; leader peptidase I; EC 3.4.21.89) family members are essential membrane-bound serine proteases that function to cleave the amino-terminal signal peptide extension from proteins that are...; Region: S26_SPase_I; cd06530
31964012203	Catalytic site [active]
31964012204	2 probable transmembrane helices predicted for CMS2802 by TMHMM2.0 at aa 36-58 and 181-203
31964012205	1 probable transmembrane helix predicted for CMS2803 by TMHMM2.0 at aa 240-262
31964012206	1 probable transmembrane helix predicted for CMS2804 by TMHMM2.0 at aa 16-38
31964012207	legume lectins; Region: lectin_L-type; cl14058
31964012208	carbohydrate binding site [chemical binding]; other site
31964012209	metal binding site [ion binding]; metal-binding site
31964012210	Domain of unknown function DUF11; Region: DUF11; cl17728
31964012211	HMMPfam hit to PF01345, Protein of unknown function DUF11, score 4.3e-07
31964012212	1 probable transmembrane helix predicted for CMS2805 by TMHMM2.0 at aa 24-46
31964012213	molecular chaperone DnaK; Provisional; Region: dnaK; PRK00290
31964012214	Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily; Region: NBD_sugar-kinase_HSP70_actin; cl17037
31964012215	nucleotide binding site [chemical binding]; other site
31964012216	HMMPfam hit to PF00012, Heat shock protein Hsp70,score 0
31964012217	PS00297 Heat shock hsp70 proteins family signature 1.
31964012218	PS00329 Heat shock hsp70 proteins family signature 2.
31964012219	PS01036 Heat shock hsp70 proteins family signature 3.
31964012220	GrpE; Region: GrpE; pfam01025
31964012221	GrpE is the adenine nucleotide exchange factor of DnaK (Hsp70)-type ATPases. The GrpE dimer binds to the ATPase domain of Hsp70 catalyzing the dissociation of ADP, which enables rebinding of ATP, one step in the Hsp70 reaction cycle in protein folding; Region: GrpE; cd00446
31964012222	dimer interface [polypeptide binding]; other site
31964012223	hsp70 (ATPase domain) interactions [polypeptide binding]; other site
31964012224	HMMPfam hit to PF01025, GrpE protein, score 3e-33
31964012225	PS01071 grpE protein signature.
31964012226	curved DNA-binding protein CbpA; Provisional; Region: PRK10266
31964012227	DnaJ domain or J-domain.  DnaJ/Hsp40 (heat shock protein 40) proteins are highly conserved and play crucial roles in protein translation, folding, unfolding, translocation, and degradation. They act primarily by stimulating the ATPase activity of Hsp70s; Region: DnaJ; cd06257
31964012228	HSP70 interaction site [polypeptide binding]; other site
31964012229	C-terminal substrate binding domain of DnaJ and HSP40; Region: DnaJ_C; cd10747
31964012230	dimer interface [polypeptide binding]; other site
31964012231	HMMPfam hit to PF00226, Heat shock protein DnaJ,N-terminal, score 1.6e-33
31964012232	PS00636 Nt-dnaJ domain signature.
31964012233	HMMPfam hit to PF01556, Chaperone DnaJ, C-terminal,score 1.6e-47
31964012234	Helix-Turn-Helix DNA binding domain of the HspR transcription regulator; Region: HTH_HspR; cd04766
31964012235	DNA binding residues [nucleotide binding]
31964012236	MerR HTH family regulatory protein; Region: MerR_1; pfam13411
31964012237	putative dimer interface [polypeptide binding]; other site
31964012238	HMMPfam hit to PF00376, Bacterial regulatory protein, MerR, score 6e-09
31964012239	16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis]; Region: RsmC; COG2813
31964012240	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
31964012241	S-adenosylmethionine binding site [chemical binding]; other site
31964012242	PS00092 N-6 Adenine-specific DNA methylases signature.
31964012243	HMMPfam hit to PF05175, Methyltransferase small,score 1.5e-05
31964012244	Homeodomain-like domain; Region: HTH_23; cl17451
31964012245	Winged helix-turn helix; Region: HTH_29; pfam13551
31964012246	Integrase core domain; Region: rve; pfam00665
31964012247	Integrase core domain; Region: rve_3; pfam13683
31964012248	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.6e-38
31964012249	HMMPfam hit to PF00132, Bacterial transferase hexapeptide repeat, score 31
31964012250	HMMPfam hit to PF00132, Bacterial transferase hexapeptide repeat, score 5.2
31964012251	4 probable transmembrane helices predicted for CMS2812 by TMHMM2.0 at aa 105-127, 142-164, 344-366 and 376-398
31964012252	HMMPfam hit to PF00132, Bacterial transferase hexapeptide repeat, score 61
31964012253	HMMPfam hit to PF00132, Bacterial transferase hexapeptide repeat, score 0.61
31964012254	Peptidase M1 family Aminopeptidase N; Region: M1_APN_4; cd09603
31964012255	Peptidase family M1; Region: Peptidase_M1; pfam01433
31964012256	Zn binding site [ion binding]; other site
31964012257	HMMPfam hit to PF01433, Peptidase M1, membrane alanine aminopeptidase, score 7.7e-16
31964012258	PS00142 Neutral zinc metallopeptidases,zinc-binding region signature.
31964012259	AAA ATPase domain; Region: AAA_16; pfam13191
31964012260	PS00017 ATP/GTP-binding site motif A (P-loop).
31964012261	Tetratricopeptide repeat; Region: TPR_16; pfam13432
31964012262	3 probable transmembrane helices predicted for CMS2816 by TMHMM2.0 at aa 153-175, 179-201 and 208-230
31964012263	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cd04301
31964012264	Coenzyme A binding pocket [chemical binding]; other site
31964012265	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 5.4e-19
31964012266	Proline dehydrogenase; Region: Pro_dh; cl03282
31964012267	Delta(1)-pyrroline-5-carboxylate dehydrogenase, PutA; Region: ALDH_PutA-P5CDH; cd07125
31964012268	Aldehyde dehydrogenase family; Region: Aldedh; pfam00171
31964012269	Glutamate binding site [chemical binding]; other site
31964012270	NAD binding site [chemical binding]; other site
31964012271	catalytic residues [active]
31964012272	HMMPfam hit to PF00171, Aldehyde dehydrogenase,score 1.9e-46
31964012273	PS00070 Aldehyde dehydrogenases cysteine active site.
31964012274	PS00687 Aldehyde dehydrogenases glutamic acid active site.
31964012275	HMMPfam hit to PF01619, Proline dehydrogenase,score 3.4e-35
31964012276	Transcriptional regulator [Transcription]; Region: LysR; COG0583
31964012277	Bacterial regulatory helix-turn-helix protein, lysR family; Region: HTH_1; pfam00126
31964012278	The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold; Region: PBP2_LTTR_like_6; cd08423
31964012279	putative dimerization interface [polypeptide binding]; other site
31964012280	HMMPfam hit to PF00126, Bacterial regulatory protein, LysR, score 8.6e-14
31964012281	HMMPfam hit to PF03466, LysR, substrate-binding,score 5.2e-25
31964012282	CopC domain; Region: CopC; pfam04234
31964012283	2 probable transmembrane helices predicted for CMS2820 by TMHMM2.0 at aa 19-41 and 232-254
31964012284	HMMPfam hit to PF04234, Copper resistance protein CopC, score 5.4e-07
31964012285	Reeler-like domain of YcnI and similar proteins; Region: YcnI_like; cd08545
31964012286	2 probable transmembrane helices predicted for CMS2821 by TMHMM2.0 at aa 13-35 and 221-243
31964012287	3 probable transmembrane helices predicted for CMS2822 by TMHMM2.0 at aa 25-47, 52-74 and 110-132
31964012288	Glycosyl hydrolase family 68, includes levansucrase, beta-fructofuranosidase and inulosucrase; Region: GH68; cd08997
31964012289	active site
31964012290	HMMPfam hit to PF02435, Glycoside hydrolase, family 68, score 1.2e-154
31964012291	Beta-fructosidases (levanase/invertase) [Carbohydrate transport and metabolism]; Region: SacC; COG1621
31964012292	Glycosyl hydrolase family 32, beta-fructosidases; Region: GH32_B_Fructosidase; cd08996
31964012293	substrate binding [chemical binding]; other site
31964012294	active site
31964012295	1 probable transmembrane helix predicted for CMS2824 by TMHMM2.0 at aa 54-76
31964012296	HMMPfam hit to PF00251, Glycoside hydrolase, family 32, score 2.4e-21
31964012297	helix_turn_helix multiple antibiotic resistance protein; Region: HTH_MARR; smart00347
31964012298	MarR family; Region: MarR; pfam01047
31964012299	HMMPfam hit to PF01047, Bacterial regulatory protein, MarR, score 1.6e-22
31964012300	This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins; Region: Glo_EDI_BRP_like; cl14632
31964012301	Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily; Region: Glyoxalase; pfam00903
31964012302	active site
31964012303	Aldose 1-epimerase, similar to Escherichia coli YihR; Region: Aldose_epim_Ec_YihR; cd09022
31964012304	active site
31964012305	catalytic residues [active]
31964012306	HMMPfam hit to PF01263, Aldose 1-epimerase, score 1.3e-37
31964012307	Thioredoxin; Region: Thioredoxin_4; pfam13462
31964012308	DSBA-like thioredoxin domain; Region: DSBA; pfam01323
31964012309	1 probable transmembrane helix predicted for CMS2828 by TMHMM2.0 at aa 52-74
31964012310	HMMPfam hit to PF01323, DSBA oxidoreductase, score 3.5e-06
31964012311	3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase [DNA replication, recombination, and repair]; Region: AlkA; COG0122
31964012312	endonuclease III; includes endonuclease III (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA glycosidases (Alka-family) and other DNA glycosidases; Region: ENDO3c; cd00056
31964012313	minor groove reading motif; other site
31964012314	helix-hairpin-helix signature motif; other site
31964012315	active site
31964012316	AAA ATPase domain; Region: AAA_16; pfam13191
31964012317	AAA domain; Region: AAA_22; pfam13401
31964012318	PS00017 ATP/GTP-binding site motif A (P-loop).
31964012319	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cl17189
31964012320	Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates...; Region: NK; cl17190
31964012321	active site
31964012322	Walker A motif; other site
31964012323	ATP binding site [chemical binding]; other site
31964012324	PS00017 ATP/GTP-binding site motif A (P-loop).
31964012325	6-phosphofructokinase; Region: PFKA_ATP; TIGR02482
31964012326	phosphofructokinase; Region: PFK_mixed; TIGR02483
31964012327	active site
31964012328	ADP/pyrophosphate binding site [chemical binding]; other site
31964012329	dimerization interface [polypeptide binding]; other site
31964012330	allosteric effector site; other site
31964012331	fructose-1,6-bisphosphate binding site; other site
31964012332	HMMPfam hit to PF00365, Phosphofructokinase, score 2.9e-84
31964012333	PS00433 Phosphofructokinase signature.
31964012334	Yhdh putative quinone oxidoreductases; Region: MDR_yhdh; cd08288
31964012335	putative quinone oxidoreductase, YhdH/YhfP family; Region: oxido_YhdH; TIGR02823
31964012336	NADP binding site [chemical binding]; other site
31964012337	dimer interface [polypeptide binding]; other site
31964012338	HMMPfam hit to PF00107, Zinc-containing alcohol dehydrogenase superfamily, score 4.3e-33
31964012339	Protein of unknown function (DUF1304); Region: DUF1304; pfam06993
31964012340	4 probable transmembrane helices predicted for CMS2834 by TMHMM2.0 at aa 10-29, 59-76, 80-102 and 109-128
31964012341	Heme oxygenase catalyzes the rate limiting step in the degradation of heme to bilirubin, it is essential for recycling of iron from heme. Heme is used as a substrate and cofactor for its own degradation to biliverdin, iron, and carbon monoxide. This...; Region: HemeO; cd00232
31964012342	heme binding pocket [chemical binding]; other site
31964012343	HMMPfam hit to PF01126, Heme oxygenase, score 6.7e-42
31964012344	DNA/RNA non-specific endonuclease; prokaryotic and eukaryotic double- and single-stranded DNA and RNA endonucleases also present in phosphodiesterases.  They exists as monomers and homodimers; Region: NUC; cd00091
31964012345	DNA/RNA non-specific endonuclease; Region: Endonuclease_NS; smart00892
31964012346	active site
31964012347	substrate binding site [chemical binding]; other site
31964012348	Mg2+ binding site [ion binding]; other site
31964012349	HMMPfam hit to PF01223, DNA/RNA non-specific endonuclease, score 2e-53
31964012350	glutamate-1-semialdehyde aminotransferase; Provisional; Region: PRK00062
31964012351	Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes. PLP combines with an alpha-amino acid to form a compound called a Schiff base or aldimine intermediate, which depending on the reaction, is the...; Region: AAT_I; cl00321
31964012352	pyridoxal 5'-phosphate binding pocket [chemical binding]; other site
31964012353	catalytic residue [active]
31964012354	HMMPfam hit to PF00202, Aminotransferase class-III,score 2.7e-74
31964012355	Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the...; Region: ALAD_PBGS; cd00384
31964012356	dimer interface [polypeptide binding]; other site
31964012357	active site
31964012358	Schiff base residues; other site
31964012359	HMMPfam hit to PF00490, Delta-aminolevulinic acid dehydratase, score 2.6e-187
31964012360	PS00169 Delta-aminolevulinic acid dehydratase active site.
31964012361	Uroporphyrinogen-III synthase [Coenzyme metabolism]; Region: HemD; COG1587
31964012362	Uroporphyrinogen-III synthase (HemD) catalyzes the asymmetrical cyclization of tetrapyrrole (linear) to uroporphyrinogen-III, the fourth step in the biosynthesis of heme. This ubiquitous enzyme is present in eukaryotes, bacteria and archaea. Mutations in...; Region: HemD; cd06578
31964012363	active site
31964012364	HMMPfam hit to PF02602, Uroporphyrinogen III synthase HEM4, score 5.7e-27
31964012365	porphobilinogen deaminase; Reviewed; Region: hemC; PRK00072
31964012366	Hydroxymethylbilane synthase (HMBS), also known as porphobilinogen deaminase (PBGD), is an intermediate enzyme in the biosynthetic pathway of tetrapyrrolic ring systems, such as heme, chlorophylls, and vitamin B12. HMBS catalyzes the conversion of...; Region: HMBS; cl17708
31964012367	domain interfaces; other site
31964012368	active site
31964012369	HMMPfam hit to PF03900, Porphobilinogen deaminase,score 7.7e-06
31964012370	PS00639 Eukaryotic thiol (cysteine) proteases histidine active site.
31964012371	HMMPfam hit to PF01379, Porphobilinogen deaminase,score 7.9e-76
31964012372	ferrochelatase; Reviewed; Region: hemH; PRK00035
31964012373	Ferrochelatase, N-terminal domain: Ferrochelatase (protoheme ferrolyase or HemH) is the terminal enzyme of the heme biosynthetic pathway. It catalyzes the insertion of ferrous iron into the protoporphyrin IX ring yielding protoheme. This enzyme is...; Region: Ferrochelatase_N; cd03411
31964012374	C-terminal domain interface [polypeptide binding]; other site
31964012375	active site
31964012376	Ferrochelatase, C-terminal domain: Ferrochelatase (protoheme ferrolyase or HemH) is the terminal enzyme of the heme biosynthetic pathway. It catalyzes the insertion of ferrous iron into the protoporphyrin IX ring yielding protoheme. This enzyme is...; Region: Ferrochelatase_C; cd00419
31964012377	active site
31964012378	N-terminal domain interface [polypeptide binding]; other site
31964012379	HMMPfam hit to PF00762, Ferrochelatase, score 3.1e-97
31964012380	Chlorite dismutase; Region: Chlor_dismutase; pfam06778
31964012381	HMMPfam hit to PF06778, Chlorite dismutase, score 4.5e-67
31964012382	carotene biosynthesis associated membrane protein; Region: crt_membr; TIGR03459
31964012383	12 probable transmembrane helices predicted for CMS2844 by TMHMM2.0 at aa 20-42, 73-95, 108-125, 196-218,230-252, 272-294, 333-355, 370-392, 405-424, 439-461,468-490 and 500-522
31964012384	PS00211 ABC transporters family signature.
31964012385	Protein of unknown function (DUF3618); Region: DUF3618; pfam12277
31964012386	1 probable transmembrane helix predicted for CMS2845 by TMHMM2.0 at aa 64-86
31964012387	Protein of unknown function (DUF1469); Region: DUF1469; pfam07332
31964012388	HMMPfam hit to PF07332, Protein of unknown function DUF1469, score 1.1e-13
31964012389	2 probable transmembrane helices predicted for CMS2846 by TMHMM2.0 at aa 51-73 and 83-105
31964012390	1 probable transmembrane helix predicted for CMS2847 by TMHMM2.0 at aa 5-22
31964012391	protoporphyrinogen oxidase; Reviewed; Region: PRK11883
31964012392	NAD(P)-binding Rossmann-like domain; Region: NAD_binding_8; pfam13450
31964012393	HMMPfam hit to PF01593, Amine oxidase, score 1.6e-08
31964012394	Uroporphyrinogen decarboxylase (URO-D) is a dimeric cytosolic enzyme that decarboxylates the four acetate side chains of uroporphyrinogen III (uro-III) to create coproporphyrinogen III, without requiring any prosthetic groups or cofactors. This reaction...; Region: URO-D; cd00717
31964012395	substrate binding site [chemical binding]; other site
31964012396	active site
31964012397	HMMPfam hit to PF01208, Uroporphyrinogen decarboxylase (URO-D), score 2.6e-131
31964012398	PS00907 Uroporphyrinogen decarboxylase signature 2.
31964012399	PS00906 Uroporphyrinogen decarboxylase signature 1.
31964012400	glutamyl-tRNA reductase; Reviewed; Region: hemA; PRK00045
31964012401	NAD(P) binding domain of amino acid dehydrogenase-like proteins; Region: NAD_bind_amino_acid_DH; cl17226
31964012402	NAD(P) binding pocket [chemical binding]; other site
31964012403	Glutamyl-tRNAGlu reductase, dimerisation domain; Region: GlutR_dimer; pfam00745
31964012404	HMMPfam hit to PF05201, Glutamyl-tRNA reductase,score 5e-19
31964012405	HMMPfam hit to PF05200, Glutamyl-tRNA reductase,score 1.2e-11
31964012406	HMMPfam hit to PF00745, Glutamyl-tRNA reductase,score 4e-07
31964012407	Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis]; Region: RimL; COG1670
31964012408	Acetyltransferase (GNAT) family; Region: Acetyltransf_1; pfam00583
31964012409	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 6e-06
31964012410	Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis]; Region: RimL; COG1670
31964012411	Acetyltransferase (GNAT) family; Region: Acetyltransf_1; pfam00583
31964012412	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 1.6e-07
31964012413	Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly...; Region: Nudix_Hydrolase_31; cd04690
31964012414	nudix motif; other site
31964012415	HMMPfam hit to PF00293, NUDIX hydrolase, score 9.1e-20
31964012416	leucine-zipper of insertion element IS481; Region: LZ_Tnp_IS481; pfam13011
31964012417	Winged helix-turn helix; Region: HTH_29; pfam13551
31964012418	Integrase core domain; Region: rve; pfam00665
31964012419	Integrase core domain; Region: rve_3; pfam13683
31964012420	HMMPfam hit to PF00665, Integrase, catalytic region, score 3.5E-36
31964012421	adenosine deaminase; Provisional; Region: PRK09358
31964012422	Adenosine deaminase [Nucleotide transport and metabolism]; Region: Add; COG1816
31964012423	active site
31964012424	HMMPfam hit to PF00962, Adenosine/AMP deaminase,score 5.4e-64
31964012425	nuc_hydro_IU_UC_XIUA: inosine-uridine preferring, xanthosine-inosine-uridine-adenosine-preferring and, uridine-cytidine preferring nucleoside hydrolases. Nucleoside hydrolases cleave the N-glycosidic bond in nucleosides generating ribose and the...; Region: nuc_hydro_IU_UC_XIUA; cd02651
31964012426	active site
31964012427	tetramer interface [polypeptide binding]; other site
31964012428	HMMPfam hit to PF01156, Inosine/uridine-preferring nucleoside hydrolase, score 6.1e-147
31964012429	thymidine phosphorylase; Reviewed; Region: deoA; PRK05820
31964012430	Glycosyl transferase family, helical bundle domain; Region: Glycos_trans_3N; pfam02885
31964012431	Glycosyl transferase family, a/b domain; Region: Glycos_transf_3; pfam00591
31964012432	Pyrimidine nucleoside phosphorylase C-terminal domain; Region: PYNP_C; smart00941
31964012433	HMMPfam hit to PF00591, Glycosyl transferase,family 3, score 1.1e-35
31964012434	PS00647 Thymidine and pyrimidine-nucleoside phosphorylases signature.
31964012435	HMMPfam hit to PF02885, Glycosyl transferase,family 3, score 1e-11
31964012436	Cytidine deaminase zinc-binding domain. These enzymes are Zn dependent. The zinc ion in the active site plays a central role in the proposed catalytic mechanism, activating a water molecule to form a hydroxide ion that performs a nucleophilic attack on...; Region: cytidine_deaminase; cd01283
31964012437	active site
31964012438	catalytic motif [active]
31964012439	Zn binding site [ion binding]; other site
31964012440	HMMPfam hit to PF00383, Cytidine/deoxycytidylate deaminase, zinc-binding region, score 1.4e-16
31964012441	PS00903 Cytidine and deoxycytidylate deaminases zinc-binding region signature.
31964012442	Branched-chain amino acid transport system / permease component; Region: BPD_transp_2; pfam02653
31964012443	Transmembrane subunit (TM) of Treponema pallidum (Tp) RbsC-1, RbsC-2 and related proteins. This is a functionally uncharacterized subgroup of TMs which belong to a larger group of TMs of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette; Region: TM_PBP1_transp_TpRbsC_like; cd06580
31964012444	TM-ABC transporter signature motif; other site
31964012445	12 probable transmembrane helices predicted for CMS2859 by TMHMM2.0 at aa 33-55, 75-97, 104-126, 131-153,160-182, 187-209, 216-238, 269-291, 324-346, 350-367,374-396 and 400-422
31964012446	HMMPfam hit to PF02653, Bacterial inner-membrane translocator, score 8.8e-40
31964012447	Branched-chain amino acid transport system / permease component; Region: BPD_transp_2; pfam02653
31964012448	Transmembrane subunit (TM) of Treponema pallidum (Tp) RbsC-1, RbsC-2 and related proteins. This is a functionally uncharacterized subgroup of TMs which belong to a larger group of TMs of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette; Region: TM_PBP1_transp_TpRbsC_like; cd06580
31964012449	TM-ABC transporter signature motif; other site
31964012450	10 probable transmembrane helices predicted for CMS2860 by TMHMM2.0 at aa 67-89, 109-131, 147-169,196-218, 225-247, 279-301, 328-350, 354-376, 381-400 and 410-432
31964012451	HMMPfam hit to PF02653, Bacterial inner-membrane translocator, score 4.1e-61
31964012452	ABC-type uncharacterized transport systems, ATPase components [General function prediction only]; Region: COG3845
31964012453	First domain of the ATP-binding cassette component of monosaccharide transport system; Region: ABC_Carb_Monos_I; cd03216
31964012454	Walker A/P-loop; other site
31964012455	ATP binding site [chemical binding]; other site
31964012456	Q-loop/lid; other site
31964012457	ABC transporter signature motif; other site
31964012458	Walker B; other site
31964012459	D-loop; other site
31964012460	H-loop/switch region; other site
31964012461	Second domain of the ATP-binding cassette component of monosaccharide transport system; Region: ABC_Carb_Monos_II; cd03215
31964012462	HMMPfam hit to PF00005, ABC transporter, score 6.9e-17
31964012463	PS00211 ABC transporters family signature.
31964012464	HMMPfam hit to PF00005, ABC transporter, score 3.9e-47
31964012465	PS00017 ATP/GTP-binding site motif A (P-loop).
31964012466	Uncharacterized ABC-type transport system, periplasmic component/surface lipoprotein [General function prediction only]; Region: Med; COG1744
31964012467	Periplasmic binding domain of basic membrane lipoprotein, PnrA, in Treponema pallidum and its homologs from other bacteria and Archaea; Region: PBP1_BmpA_PnrA_like; cd06354
31964012468	ligand binding site [chemical binding]; other site
31964012469	HMMPfam hit to PF02608, Basic membrane lipoprotein,score 4.9e-45
31964012470	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964012471	Uncharacterized ABC-type transport system, periplasmic component/surface lipoprotein [General function prediction only]; Region: Med; COG1744
31964012472	Periplasmic binding domain of basic membrane lipoprotein, PnrA, in Treponema pallidum and its homologs from other bacteria and Archaea; Region: PBP1_BmpA_PnrA_like; cd06354
31964012473	ligand binding site [chemical binding]; other site
31964012474	HMMPfam hit to PF02608, Basic membrane lipoprotein,score 4.8e-24
31964012475	Mannose-1-phosphate guanylyltransferase [Cell envelope biogenesis, outer membrane]; Region: {ManC}; COG0836
31964012476	GDP-M1P_Guanylyltransferase catalyzes the formation of GDP-Mannose; Region: GDP-M1P_Guanylyltransferase; cd02509
31964012477	Substrate binding site; other site
31964012478	Cupin domain; Region: Cupin_2; cl17218
31964012479	HMMPfam hit to PF00483, Nucleotidyl transferase,score 1.1e-43
31964012480	Glycosyltransferase [Cell envelope biogenesis, outer membrane]; Region: RfaG; COG0438
31964012481	This family is most closely related to the GT1 family of glycosyltransferases. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can...; Region: GT1_like_2; cd03814
31964012482	HMMPfam hit to PF00534, Glycosyl transferase, group 1, score 3.7e-22
31964012483	Succinate:quinone oxidoreductase (SQR) Type A subfamily, Succinate dehydrogenase C (SdhC)-like subunit; SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol. Members of this subfamily reduce low potential...; Region: SQR_TypeA_SdhC_like; cd03501
31964012484	putative Iron-sulfur protein interface [polypeptide binding]; other site
31964012485	putative proximal heme binding site [chemical binding]; other site
31964012486	putative SdhD-like interface [polypeptide binding]; other site
31964012487	putative distal heme binding site [chemical binding]; other site
31964012488	HMMPfam hit to PF01127, Succinate dehydrogenase,cytochrome b subunit, score 2.2e-05
31964012489	3 probable transmembrane helices predicted for CMS2866 by TMHMM2.0 at aa 9-28, 48-70 and 83-105
31964012490	Succinate:quinone oxidoreductase (SQR) Type A subfamily, Succinate dehydrogenase D (SdhD)-like subunit; SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol. Members of this subfamily reduce low potential...; Region: SQR_TypeA_SdhD_like; cd03500
31964012491	putative Iron-sulfur protein interface [polypeptide binding]; other site
31964012492	putative proximal heme binding site [chemical binding]; other site
31964012493	putative SdhC-like subunit interface [polypeptide binding]; other site
31964012494	putative distal heme binding site [chemical binding]; other site
31964012495	HMMPfam hit to PF01127, Succinate dehydrogenase,cytochrome b subunit, score 3.1e-05
31964012496	3 probable transmembrane helices predicted for CMS2867 by TMHMM2.0 at aa 34-56, 83-105 and 117-139
31964012497	succinate dehydrogenase flavoprotein subunit; Reviewed; Region: sdhA; PRK08205
31964012498	L-aspartate oxidase; Provisional; Region: PRK06175
31964012499	Fumarate reductase flavoprotein C-term; Region: Succ_DH_flav_C; pfam02910
31964012500	PS00504 Fumarate reductase / succinate dehydrogenase FAD-binding site.
31964012501	HMMPfam hit to PF00890, Fumarate reductase/succinate dehydrogenase flavoprotein,N-terminal, score 2e-182
31964012502	HMMPfam hit to PF02910, Fumarate reductase/succinate dehydrogenase flavoprotein,C-terminal, score 2.5e-58
31964012503	succinate dehydrogenase iron-sulfur subunit; Reviewed; Region: sdhB; PRK05950
31964012504	2Fe-2S iron-sulfur cluster binding domain. Iron-sulfur proteins play an important role in electron transfer processes and in various enzymatic reactions. The family includes plant and algal ferredoxins, which act as electron carriers in photosynthesis...; Region: fer2; cd00207
31964012505	catalytic loop [active]
31964012506	iron binding site [ion binding]; other site
31964012507	HMMPfam hit to PF00111, Ferredoxin, score 0.042
31964012508	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
31964012509	PEP-utilising enzyme, N-terminal; Region: PEP-utilisers_N; pfam05524
31964012510	Phosphoenolpyruvate-protein kinase (PTS system EI component in bacteria) [Carbohydrate transport and metabolism]; Region: PtsA; COG1080
31964012511	PEP-utilising enzyme, mobile domain; Region: PEP-utilizers; pfam00391
31964012512	PEP-utilising enzyme, TIM barrel domain; Region: PEP-utilizers_C; pfam02896
31964012513	HMMPfam hit to PF02896, PEP-utilizing enzyme, score 4.6e-80
31964012514	PS00742 PEP-utilizing enzymes signature 2.
31964012515	HMMPfam hit to PF00391, PEP-utilising enzyme,mobile region, score 3.6e-18
31964012516	PS00370 PEP-utilizing enzymes phosphorylation site signature.
31964012517	HMMPfam hit to PF05524, PEP-utilising enzyme,N-terminal, score 2.7e-18
31964012518	Virulence factor BrkB; Region: Virul_fac_BrkB; cl07918
31964012519	Virulence factor BrkB; Region: Virul_fac_BrkB; cl07918
31964012520	6 probable transmembrane helices predicted for CMS2871 by TMHMM2.0 at aa 48-70, 126-148, 179-201,216-238, 251-273 and 288-310
31964012521	HMMPfam hit to PF03631, Ribonuclease BN, score 8.5e-17
31964012522	Neisseria meningitides Nape-like subfamily of the ExoIII family purinic/apyrimidinic (AP) endonucleases; Region: Nape_like_AP-endo; cd10281
31964012523	putative active site [active]
31964012524	putative catalytic site [active]
31964012525	putative DNA binding site [nucleotide binding]; other site
31964012526	putative phosphate binding site [ion binding]; other site
31964012527	metal binding site A [ion binding]; metal-binding site
31964012528	putative AP binding site [nucleotide binding]; other site
31964012529	putative metal binding site B [ion binding]; other site
31964012530	HMMPfam hit to PF03372,Endonuclease/exonuclease/phosphatase, score 5.4e-39
31964012531	tryptophanyl-tRNA synthetase II; Reviewed; Region: PRK12282
31964012532	catalytic core domain of tryptophanyl-tRNA synthetase; Region: TrpRS_core; cd00806
31964012533	active site
31964012534	HIGH motif; other site
31964012535	dimer interface [polypeptide binding]; other site
31964012536	KMSKS motif; other site
31964012537	HMMPfam hit to PF00579, Aminoacyl-tRNA synthetase,class Ib, score 8.9e-101
31964012538	Predicted hydrolase (HAD superfamily) [General function prediction only]; Region: COG1011
31964012539	Haloacid dehalogenase-like hydrolases. The haloacid dehalogenase-like (HAD) superfamily includes L-2-haloacid dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, and many others; Region: HAD_like; cd01427
31964012540	motif II; other site
31964012541	HMMPfam hit to PF00702, Haloacid dehalogenase-like hydrolase, score 1.6e-29
31964012542	PS00134 Serine proteases, trypsin family, histidine active site.
31964012543	1 probable transmembrane helix predicted for CMS2875 by TMHMM2.0 at aa 75-97
31964012544	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964012545	riboflavin biosynthesis protein RibD; Region: eubact_ribD; TIGR00326
31964012546	Riboflavin-specific deaminase. Riboflavin biosynthesis protein RibD (Diaminohydroxyphosphoribosylaminopyrimidine deaminase) catalyzes the deamination of 2,5-diamino-6-ribosylamino-4(3H)-pyrimidinone 5'-phosphate, which is an intermediate step in the...; Region: Riboflavin_deaminase-reductase; cd01284
31964012547	catalytic motif [active]
31964012548	Zn binding site [ion binding]; other site
31964012549	RibD C-terminal domain; Region: RibD_C; cl17279
31964012550	HMMPfam hit to PF00383, Cytidine/deoxycytidylate deaminase, zinc-binding region, score 4.2e-28
31964012551	PS00903 Cytidine and deoxycytidylate deaminases zinc-binding region signature.
31964012552	HMMPfam hit to PF01872, Bacterial bifunctional deaminase-reductase, C-terminal, score 3.9e-63
31964012553	riboflavin synthase subunit alpha; Provisional; Region: PRK09289
31964012554	Lumazine binding domain; Region: Lum_binding; pfam00677
31964012555	Lumazine binding domain; Region: Lum_binding; pfam00677
31964012556	HMMPfam hit to PF00677, Lumazine-binding protein,score 2.8e-23
31964012557	PS00693 Riboflavin synthase alpha chain family signature.
31964012558	HMMPfam hit to PF00677, Lumazine-binding protein,score 9e-21
31964012559	PS00693 Riboflavin synthase alpha chain family signature.
31964012560	bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II protein; Provisional; Region: PRK09311
31964012561	3,4-dihydroxy-2-butanone 4-phosphate synthase; Region: DHBP_synthase; pfam00926
31964012562	GTP cyclohydrolase II (RibA).  GTP cyclohydrolase II catalyzes the conversion of GTP to 2,5-diamino-6-ribosylamino-4(3H)-pyrimidinone 5' phosphate, formate, pyrophosphate (APy), and GMP in the biosynthetic pathway of riboflavin. Riboflavin is the...; Region: GTP_cyclohydro2; cd00641
31964012563	dimerization interface [polypeptide binding]; other site
31964012564	active site
31964012565	HMMPfam hit to PF00926, 3,4-Dihydroxy-2-butanone 4-phosphate synthase, score 9.5e-87
31964012566	HMMPfam hit to PF00925, GTP cyclohydrolase II,score 4.6e-91
31964012567	lumazine synthase (6,7-dimethyl-8-ribityllumazine synthase, LS), catalyzes the penultimate step in the biosynthesis of riboflavin (vitamin B2); type-I; Region: Lumazine_synthase-I; cd09209
31964012568	homopentamer interface [polypeptide binding]; other site
31964012569	active site
31964012570	HMMPfam hit to PF00885,6,7-dimethyl-8-ribityllumazine synthase, score 1.1e-53
31964012571	ATP-binding cassette domain of nickel/oligopeptides specific transporters; Region: ABC_NikE_OppD_transporters; cd03257
31964012572	nickel import ATP-binding protein NikD; Region: nickel_nikD; TIGR02770
31964012573	Walker A/P-loop; other site
31964012574	ATP binding site [chemical binding]; other site
31964012575	Q-loop/lid; other site
31964012576	ABC transporter signature motif; other site
31964012577	Walker B; other site
31964012578	D-loop; other site
31964012579	H-loop/switch region; other site
31964012580	HMMPfam hit to PF00005, ABC transporter, score 1.6e-40
31964012581	PS00017 ATP/GTP-binding site motif A (P-loop).
31964012582	PS00211 ABC transporters family signature.
31964012583	ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]; Region: DppF; COG1124
31964012584	ATP-binding cassette domain of nickel/oligopeptides specific transporters; Region: ABC_NikE_OppD_transporters; cd03257
31964012585	Walker A/P-loop; other site
31964012586	ATP binding site [chemical binding]; other site
31964012587	Q-loop/lid; other site
31964012588	ABC transporter signature motif; other site
31964012589	Walker B; other site
31964012590	D-loop; other site
31964012591	H-loop/switch region; other site
31964012592	Oligopeptide/dipeptide transporter, C-terminal region; Region: oligo_HPY; cl07097
31964012593	HMMPfam hit to PF00005, ABC transporter, score 7.2e-59
31964012594	PS00017 ATP/GTP-binding site motif A (P-loop).
31964012595	PS00211 ABC transporters family signature.
31964012596	multidrug resistance protein MdtH; Provisional; Region: PRK11646
31964012597	11 probable transmembrane helices predicted for CMS2882 by TMHMM2.0 at aa 48-70, 75-97, 133-155, 176-198,203-225, 257-276, 291-313, 322-344, 354-376, 389-411 and 415-437
31964012598	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964012599	PS00850 Glycine radical signature.
31964012600	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964012601	The substrate-binding domain of an ABC-type nickel/oligopeptide-like import system contains the type 2 periplasmic binding fold; Region: PBP2_NikA_DppA_OppA_like; cl01709
31964012602	Bacterial extracellular solute-binding proteins, family 5 Middle; Region: SBP_bac_5; pfam00496
31964012603	1 probable transmembrane helix predicted for CMS2883 by TMHMM2.0 at aa 20-42
31964012604	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964012605	HMMPfam hit to PF00496, Bacterial extracellular solute-binding protein, family 5, score 2e-51
31964012606	ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism]; Region: DppB; COG0601
31964012607	ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism]; Region: DppC; COG1173
31964012608	12 probable transmembrane helices predicted for CMS2884 by TMHMM2.0 at aa 7-29, 102-124, 145-167, 182-201,234-256, 280-302, 330-349, 385-407, 414-436, 441-463,505-527 and 547-569
31964012609	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 1.4e-09
31964012610	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 3.4e-16
31964012611	Winged helix-turn helix; Region: HTH_29; pfam13551
31964012612	leucine-zipper of insertion element IS481; Region: LZ_Tnp_IS481; pfam13011
31964012613	Integrase core domain; Region: rve; pfam00665
31964012614	Integrase core domain; Region: rve_3; pfam13683
31964012615	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.6e-38
31964012616	Predicted permeases [General function prediction only]; Region: COG0679
31964012617	10 probable transmembrane helices predicted for CMS2886 by TMHMM2.0 at aa 5-27, 34-51, 61-83, 96-118,123-145, 165-182, 192-211, 224-246, 251-273 and 286-308
31964012618	HMMPfam hit to PF03547, Auxin Efflux Carrier, score 6.1e-18
31964012619	PS00445 FGGY family of carbohydrate kinases signature 2.
31964012620	Histidine phosphatase domain found in a functionally diverse set of proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction; Region: HP; cl11399
31964012621	2 probable transmembrane helices predicted for CMS2887 by TMHMM2.0 at aa 13-35 and 526-548
31964012622	HMMPfam hit to PF00328, Histidine acid phosphatase,score 0.0093
31964012623	leucine-zipper of insertion element IS481; Region: LZ_Tnp_IS481; pfam13011
31964012624	Winged helix-turn helix; Region: HTH_29; pfam13551
31964012625	Integrase core domain; Region: rve; pfam00665
31964012626	Integrase core domain; Region: rve_3; pfam13683
31964012627	HMMPfam hit to PF00665, Integrase, catalytic region, score 3.5E-36
31964012628	HipA N-terminal domain; Region: Couple_hipA; pfam13657
31964012629	Toxin module HipA, protein kinase of phosphatidylinositol 3/4-kinase superfamily [General function prediction only]; Region: HipA; COG3550
31964012630	HipA-like N-terminal domain; Region: HipA_N; pfam07805
31964012631	HipA-like C-terminal domain; Region: HipA_C; pfam07804
31964012632	Putative hydrophobic ligand-binding SRPBCC domain of Micromonospora echinospora CalC, human Aha1, and related proteins; Region: SRPBCC_CalC_Aha1-like; cd07814
31964012633	putative hydrophobic ligand binding site [chemical binding]; other site
31964012634	drug resistance transporter, EmrB/QacA subfamily; Region: efflux_EmrB; TIGR00711
31964012635	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
31964012636	putative substrate translocation pore; other site
31964012637	13 probable transmembrane helices predicted for CMS2892 by TMHMM2.0 at aa 28-50, 57-79, 83-105, 117-139,144-166, 179-198, 203-225, 246-268, 283-305, 312-334,339-361, 381-403 and 450-472
31964012638	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964012639	Bacterial regulatory proteins, tetR family; Region: TetR_N; pfam00440
31964012640	mycofactocin system transcriptional regulator; Region: mycofact_TetR; TIGR03968
31964012641	HMMPfam hit to PF00440, Bacterial regulatory protein, TetR, score 3.8e-10
31964012642	Protein of unknown function (DUF3349); Region: DUF3349; pfam11829
31964012643	Protein of unknown function (DUF3349); Region: DUF3349; pfam11829
31964012644	2 probable transmembrane helices predicted for CMS2895 by TMHMM2.0 at aa 5-27 and 61-83
31964012645	Phosphate/sulphate permeases [Inorganic ion transport and metabolism]; Region: PitA; COG0306
31964012646	7 probable transmembrane helices predicted for CMS2896 by TMHMM2.0 at aa 4-23, 43-65, 91-113, 120-142,157-179, 328-347 and 352-374
31964012647	HMMPfam hit to PF01384, Phosphate transporter,score 1.2e-76
31964012648	Acetyltransferase (GNAT) domain; Region: Acetyltransf_3; pfam13302
31964012649	Acetyltransferase (GNAT) family; Region: Acetyltransf_1; pfam00583
31964012650	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 2.1e-05
31964012651	Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only]; Region: FabG; COG1028
31964012652	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
31964012653	active site
31964012654	HMMPfam hit to PF00106, Short-chain dehydrogenase/reductase SDR, score 5.7e-06
31964012655	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
31964012656	Walker A motif; other site
31964012657	ATP binding site [chemical binding]; other site
31964012658	PS00017 ATP/GTP-binding site motif A (P-loop).
31964012659	Domain of unknown function (DUF1905); Region: DUF1905; pfam08922
31964012660	This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins; Region: Glo_EDI_BRP_like; cd06587
31964012661	Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily; Region: Glyoxalase; pfam00903
31964012662	active site
31964012663	HMMPfam hit to PF00903, Glyoxalase/bleomycin resistance protein/dioxygenase, score 7.3e-12
31964012664	Winged helix-turn helix; Region: HTH_29; pfam13551
31964012665	leucine-zipper of insertion element IS481; Region: LZ_Tnp_IS481; pfam13011
31964012666	Integrase core domain; Region: rve; pfam00665
31964012667	Integrase core domain; Region: rve_3; pfam13683
31964012668	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.6e-38
31964012669	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
31964012670	drug resistance transporter, EmrB/QacA subfamily; Region: efflux_EmrB; TIGR00711
31964012671	putative substrate translocation pore; other site
31964012672	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
31964012673	14 probable transmembrane helices predicted for CMS2905 by TMHMM2.0 at aa 13-35, 45-67, 74-93, 98-120,133-155, 159-181, 193-215, 225-244, 264-286, 301-323,330-347, 357-379, 398-420 and 468-490
31964012674	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964012675	Transcriptional regulators [Transcription]; Region: MarR; COG1846
31964012676	Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to...; Region: HTH_ARSR; cd00090
31964012677	dimerization interface [polypeptide binding]; other site
31964012678	putative DNA binding site [nucleotide binding]; other site
31964012679	putative Zn2+ binding site [ion binding]; other site
31964012680	HMMPfam hit to PF01047, Bacterial regulatory protein, MarR, score 8.6e-11
31964012681	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
31964012682	S-adenosylmethionine binding site [chemical binding]; other site
31964012683	submitted with no further information
31964012684	1 probable transmembrane helix predicted for CMS2909 by TMHMM2.0 at aa 39-61
31964012685	PS00135 Serine proteases, trypsin family, serine active site.
31964012686	Domain of unknown function (DUF303); Region: DUF303; pfam03629
31964012687	Carboxypeptidase regulatory-like domain; Region: CarboxypepD_reg; pfam13620
31964012688	Carboxypeptidase regulatory-like domain; Region: CarboxypepD_reg; pfam13620
31964012689	1 probable transmembrane helix predicted for CMS2911 by TMHMM2.0 at aa 9-31
31964012690	Peptidase associated domain: C-terminal domain of M14 N/E carboxypeptidase; putative folding, regulation, or interaction domain; Region: Peptidase_M14NE-CP-C_like; cl17499
31964012691	Carboxypeptidase regulatory-like domain; Region: CarboxypepD_reg; pfam13620
31964012692	putative phosphoketolase; Provisional; Region: PRK05261
31964012693	Thiamine pyrophosphate (TPP) family, Phosphoketolase (PK) subfamily, TPP-binding module; PK catalyzes the conversion of D-xylulose 5-phosphate and phosphate to acetyl phosphate, D-glyceraldehyde-3-phosphate and H2O. This enzyme requires divalent...; Region: TPP_PK; cd02011
31964012694	TPP-binding site; other site
31964012695	XFP C-terminal domain; Region: XFP_C; pfam09363
31964012696	HMMPfam hit to PF03894, D-xylulose 5-phosphate/D-fructose 6-phosphate phosphoketolase, score 0
31964012697	submitted with no further information
31964012698	Helix-turn-helix domain; Region: HTH_38; pfam13936
31964012699	Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair]; Region: Tra8; COG2826
31964012700	Integrase core domain; Region: rve; pfam00665
31964012701	PS00017 ATP/GTP-binding site motif A (P-loop).
31964012702	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.8e-28
31964012703	PS01043 Transposases, IS30 family, signature.
31964012704	Predicted esterase of the alpha-beta hydrolase superfamily [General function prediction only]; Region: RssA; COG1752
31964012705	Patatins and Phospholipases; Region: Patatin_and_cPLA2; cl11396
31964012706	HMMPfam hit to PF01734, Patatin, score 1e-21
31964012707	MarR family; Region: MarR_2; cl17246
31964012708	HMMPfam hit to PF01047, Bacterial regulatory protein, MarR, score 1.7e-09
31964012709	Transport protein; Region: actII; TIGR00833
31964012710	Transport protein; Region: actII; TIGR00833
31964012711	10 probable transmembrane helices predicted for CMS2921 by TMHMM2.0 at aa 13-32, 167-189, 196-218,228-250, 271-293, 308-330, 366-388, 514-531, 538-560 and 570-592
31964012712	HMMPfam hit to PF03176, MMPL, score 3e-18
31964012713	HMMPfam hit to PF03176, MMPL, score 2.4e-13
31964012714	Cysteine hydrolases; This family contains amidohydrolases, like CSHase (N-carbamoylsarcosine amidohydrolase), involved in creatine metabolism and nicotinamidase, converting nicotinamide to nicotinic acid and ammonia in the pyridine nucleotide cycle. It...; Region: cysteine_hydrolases; cl00220
31964012715	catalytic triad [active]
31964012716	conserved cis-peptide bond; other site
31964012717	HMMPfam hit to PF00857, Isochorismatase hydrolase,score 0.00013
31964012718	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964012719	3 probable transmembrane helices predicted for CMS2924 by TMHMM2.0 at aa 20-42, 46-64 and 71-93
31964012720	Alanine dehydrogenase [Amino acid transport and metabolism]; Region: Ald; COG0686
31964012721	Alanine dehydrogenase NAD-binding and catalytic domains; Region: L-AlaDH; cd05305
31964012722	hexamer interface [polypeptide binding]; other site
31964012723	ligand binding site [chemical binding]; other site
31964012724	putative active site [active]
31964012725	NAD(P) binding site [chemical binding]; other site
31964012726	HMMPfam hit to PF01262, Alanine dehydrogenase/PNT,C-terminal, score 1.1e-93
31964012727	PS00837 Alanine dehydrogenase & pyridine nucleotide transhydrogenase signature 2.
31964012728	HMMPfam hit to PF05222, Alanine dehydrogenase/PNT,N-terminal, score 3.9e-81
31964012729	PS00836 Alanine dehydrogenase & pyridine nucleotide transhydrogenase signature 1.
31964012730	Transcriptional regulators [Transcription]; Region: Lrp; COG1522
31964012731	Winged helix-turn-helix DNA-binding; Region: HTH_24; pfam13412
31964012732	AsnC family; Region: AsnC_trans_reg; pfam01037
31964012733	HMMPfam hit to PF01037, Bacterial regulatory proteins, AsnC/Lrp, score 3.3e-21
31964012734	Homeodomain-like domain; Region: HTH_23; cl17451
31964012735	Winged helix-turn helix; Region: HTH_29; pfam13551
31964012736	Integrase core domain; Region: rve; pfam00665
31964012737	Integrase core domain; Region: rve_3; pfam13683
31964012738	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.6e-41
31964012739	Acetyltransferase (GNAT) domain; Region: Acetyltransf_3; pfam13302
31964012740	HMMPfam hit to PF00583, GCN5-related N-acetyltransferase, score 5.9e-09
31964012741	4 probable transmembrane helices predicted for CMS2929 by TMHMM2.0 at aa 53-75, 96-118, 128-147 and 152-174
31964012742	Cupin; Region: Cupin_6; pfam12852
31964012743	helix_turn_helix, arabinose operon control protein; Region: HTH_ARAC; smart00342
31964012744	Bacterial regulatory helix-turn-helix proteins, AraC family; Region: HTH_AraC; pfam00165
31964012745	HMMPfam hit to PF00165, Helix-turn-helix, AraC type, score 9.7e-10
31964012746	PS00041 Bacterial regulatory proteins, araC family signature.
31964012747	HMMPfam hit to PF00165, Helix-turn-helix, AraC type, score 4.6e-06
31964012748	PS00041 Bacterial regulatory proteins, araC family signature.
31964012749	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
31964012750	short chain dehydrogenase; Provisional; Region: PRK12828
31964012751	NAD(P) binding site [chemical binding]; other site
31964012752	active site
31964012753	HMMPfam hit to PF00106, Short-chain dehydrogenase/reductase SDR, score 3.2e-33
31964012754	2 probable transmembrane helices predicted for CMS2932 by TMHMM2.0 at aa 5-27 and 31-53
31964012755	ASC-1 homology domain, subfamily similar to Enterococcus faecalis Ef3133. The ASCH domain, a small beta-barrel domain found in all three kingdoms of life, resembles the RNA-binding PUA domain and may also interact with RNA. ASCH has been proposed to...; Region: ASCH_Ef3133_like; cd06553
31964012756	HMMPfam hit to PF06171, Protein of unknown function DUF984, score 4.1e-23
31964012757	Putative protein-S-isoprenylcysteine methyltransferase [Posttranslational modification, protein turnover, chaperones]; Region: STE14; COG2020
31964012758	7 probable transmembrane helices predicted for CMS2934 by TMHMM2.0 at aa 12-34, 44-66, 68-90, 95-117,145-167, 182-204 and 240-262
31964012759	Aldo/keto reductase family; Region: Aldo_ket_red; pfam00248
31964012760	Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols. AKRs are present in all phyla and are of importance to both health and industrial...; Region: Aldo_ket_red; cd06660
31964012761	active site
31964012762	catalytic tetrad [active]
31964012763	HMMPfam hit to PF00248, Aldo/keto reductase, score 5.4e-55
31964012764	Na+-driven multidrug efflux pump [Defense mechanisms]; Region: NorM; COG0534
31964012765	DinF and similar proteins, a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins; Region: MATE_DinF_like; cd13136
31964012766	11 probable transmembrane helices predicted for CMS2936 by TMHMM2.0 at aa 29-51, 72-94, 127-149, 156-178,182-204, 242-264, 269-291, 304-326, 341-360, 373-395 and 405-427
31964012767	HMMPfam hit to PF01554, Multi antimicrobial extrusion protein MatE, score 1.2e-29
31964012768	Antiactivator of flagellar biosynthesis FleN, an ATPase [Cell motility]; Region: flhG; COG0455
31964012769	1 probable transmembrane helix predicted for CMS2938 by TMHMM2.0 at aa 16-38
31964012770	The S26 Type I signal peptidase (SPase; LepB; leader peptidase B; leader peptidase I; EC 3.4.21.89) family members are essential membrane-bound serine proteases that function to cleave the amino-terminal signal peptide extension from proteins that are...; Region: S26_SPase_I; cd06530
31964012771	Catalytic site [active]
31964012772	2 probable transmembrane helices predicted for CMS2939 by TMHMM2.0 at aa 41-63 and 180-202
31964012773	2 probable transmembrane helices predicted for CMS2940 by TMHMM2.0 at aa 19-41 and 216-238
31964012774	PS00343 Gram-positive cocci surface proteins 'anchoring' hexapeptide.
31964012775	1 probable transmembrane helix predicted for CMS2941 by TMHMM2.0 at aa 32-54
31964012776	helix_turn_helix multiple antibiotic resistance protein; Region: HTH_MARR; smart00347
31964012777	Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to...; Region: HTH_ARSR; cd00090
31964012778	putative DNA binding site [nucleotide binding]; other site
31964012779	putative Zn2+ binding site [ion binding]; other site
31964012780	HMMPfam hit to PF01047, Bacterial regulatory protein, MarR, score 7.7e-16
31964012781	Predicted divalent heavy-metal cations transporter [Inorganic ion transport and metabolism]; Region: COG0428; cl00437
31964012782	8 probable transmembrane helices predicted for CMS2943 by TMHMM2.0 at aa 15-37, 46-64, 74-93, 106-126,136-158, 178-200, 210-232 and 237-254
31964012783	2 probable transmembrane helices predicted for CMS2944 by TMHMM2.0 at aa 20-39 and 105-127
31964012784	Bacterial protein of unknown function (DUF839); Region: DUF839; pfam05787
31964012785	HMMPfam hit to PF05787, Bacterial protein of unknown function DUF839, score 9.8e-221
31964012786	PS00017 ATP/GTP-binding site motif A (P-loop).
31964012787	short chain dehydrogenase; Provisional; Region: PRK06172
31964012788	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
31964012789	NAD(P) binding site [chemical binding]; other site
31964012790	active site
31964012791	HMMPfam hit to PF00106, Short-chain dehydrogenase/reductase SDR, score 3e-68
31964012792	PS00061 Short-chain dehydrogenases/reductases family signature.
31964012793	Uncharacterized conserved protein [Function unknown]; Region: COG1359
31964012794	HMMPfam hit to PF03992, Antibiotic biosynthesis monooxygenase, score 1.2e-14
31964012795	ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]; Region: LivG; COG0411
31964012796	First domain of the ATP-binding cassette component of monosaccharide transport system; Region: ABC_Carb_Monos_I; cd03216
31964012797	Walker A/P-loop; other site
31964012798	ATP binding site [chemical binding]; other site
31964012799	Q-loop/lid; other site
31964012800	ABC transporter signature motif; other site
31964012801	Walker B; other site
31964012802	D-loop; other site
31964012803	H-loop/switch region; other site
31964012804	HMMPfam hit to PF00005, ABC transporter, score 1.9e-47
31964012805	PS00211 ABC transporters family signature.
31964012806	PS00017 ATP/GTP-binding site motif A (P-loop).
31964012807	Branched-chain amino acid transport system / permease component; Region: BPD_transp_2; pfam02653
31964012808	Transmembrane subunit (TM) of Escherichia coli AraH and related proteins. E. coli AraH is the TM of a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of the monosaccharide arabinose. This group...; Region: TM_PBP1_transp_AraH_like; cd06579
31964012809	TM-ABC transporter signature motif; other site
31964012810	8 probable transmembrane helices predicted for CMS2950 by TMHMM2.0 at aa 40-62, 93-115, 122-144, 154-176,197-219, 248-270, 291-313 and 323-345
31964012811	HMMPfam hit to PF02653, Bacterial inner-membrane translocator, score 3.9e-58
31964012812	Periplasmic sugar-binding domain of active transport systems that are members of the type I periplasmic binding protein (PBP1) superfamily; Region: PBP1_ABC_sugar_binding_like; cd01536
31964012813	Periplasmic binding protein domain; Region: Peripla_BP_4; pfam13407
31964012814	ligand binding site [chemical binding]; other site
31964012815	HMMPfam hit to PF00532, Periplasmic binding protein/LacI transcriptional regulator, score 1.3e-05
31964012816	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964012817	Transcriptional regulators [Transcription]; Region: PurR; COG1609
31964012818	Helix-turn-helix (HTH) DNA binding domain of the LacI family of transcriptional regulators; Region: HTH_LacI; cd01392
31964012819	DNA binding site [nucleotide binding]
31964012820	domain linker motif; other site
31964012821	Ligand binding domain of the LacI tanscriptional regulator family belonging to the type I periplasmic-binding fold protein superfamily; Region: PBP1_LacI_sugar_binding_like; cd06267
31964012822	dimerization interface [polypeptide binding]; other site
31964012823	ligand binding site [chemical binding]; other site
31964012824	HMMPfam hit to PF00356, Bacterial regulatory protein, LacI, score 1.5e-08
31964012825	HMMPfam hit to PF00532, Periplasmic binding protein/LacI transcriptional regulator, score 6.2e-19
31964012826	Sugar kinases, ribokinase family [Carbohydrate transport and metabolism]; Region: RbsK; COG0524
31964012827	ribokinase/pfkB superfamily: Kinases that accept a wide variety of substrates, including carbohydrates and aromatic small molecules, all are phosphorylated at a hydroxyl group. The superfamily includes ribokinase, fructokinase, ketohexokinase; Region: ribokinase_pfkB_like; cl00192
31964012828	substrate binding site [chemical binding]; other site
31964012829	ATP binding site [chemical binding]; other site
31964012830	HMMPfam hit to PF00294, Carbohydrate kinase, PfkB,score 1.9e-27
31964012831	PS00583 pfkB family of carbohydrate kinases signature 1.
31964012832	PS00584 pfkB family of carbohydrate kinases signature 2.
31964012833	submitted with no further information
31964012834	Predicted transcriptional regulators [Transcription]; Region: HipB; COG1396
31964012835	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
31964012836	non-specific DNA binding site [nucleotide binding]; other site
31964012837	salt bridge; other site
31964012838	sequence-specific DNA binding site [nucleotide binding]; other site
31964012839	HMMPfam hit to PF01381, Helix-turn-helix motif,score 3.2e-13
31964012840	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
31964012841	Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]; Region: COG0702
31964012842	NAD(P) binding site [chemical binding]; other site
31964012843	active site
31964012844	Domain of unknown function (DUF202); Region: DUF202; cl09954
31964012845	4 probable transmembrane helices predicted for CMS2958 by TMHMM2.0 at aa 32-51, 61-83, 167-189 and 216-238
31964012846	HMMPfam hit to PF02656, Protein of unknown function DUF202, score 8.6e-14
31964012847	EamA-like transporter family; Region: EamA; pfam00892
31964012848	HMMPfam hit to PF00892, Protein of unknown function DUF6, score 3.1e-14
31964012849	9 probable transmembrane helices predicted for CMS2959 by TMHMM2.0 at aa 32-51, 56-78, 91-113, 118-140,147-164, 174-196, 203-222, 237-259 and 280-302
31964012850	HMMPfam hit to PF00892, Protein of unknown function DUF6, score 2.3e-08
31964012851	The substrate binding domain of LysR-type transcriptional regulators (LTTRs), a member of the type 2 periplasmic binding fold protein superfamily; Region: PBP2_LTTR_substrate; cd05466
31964012852	Transcriptional regulator [Transcription]; Region: LysR; COG0583
31964012853	HMMPfam hit to PF00126, Bacterial regulatory protein, LysR, score 1.1e-08
31964012854	HMMPfam hit to PF03466, LysR, substrate-binding,score 4.3e-20
31964012855	6 probable transmembrane helices predicted for CMS2961 by TMHMM2.0 at aa 12-31, 54-76, 83-105, 120-142,147-169 and 174-196
31964012856	HMMPfam hit to PF02517, Abortive infection protein,score 1.8e-13
31964012857	Methyltransferase domain; Region: Methyltransf_18; pfam12847
31964012858	HMMPfam hit to PF02517, Abortive infection protein,score 0.031
31964012859	2 probable transmembrane helices predicted for CMS2963 by TMHMM2.0 at aa 153-175 and 185-207
31964012860	This family is the oxydase domain of NRPS (non-ribosomal peptide synthetase) and other proteins that modify polypeptides by cyclizing a thioester to form a ring. These include epoB, part of the epothilone biosynthesis pathway; tubD, part of the tubulysin...; Region: mcbC-like_oxidoreductase; cd02142
31964012861	putative FMN binding site [chemical binding]; other site
31964012862	NADPH bind site [chemical binding]; other site
31964012863	thiazole/oxazole-forming peptide maturase, SagD family component; Region: TOMM_cyclo_SagD; TIGR03604
31964012864	YcaO-like family; Region: YcaO; pfam02624
31964012865	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
31964012866	6 probable transmembrane helices predicted for CMS2968 by TMHMM2.0 at aa 21-43, 56-78, 103-125, 140-162,169-191 and 222-244
31964012867	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
31964012868	ABC-type multidrug transport system, ATPase component [Defense mechanisms]; Region: CcmA; COG1131
31964012869	Walker A/P-loop; other site
31964012870	ATP binding site [chemical binding]; other site
31964012871	Q-loop/lid; other site
31964012872	ABC transporter signature motif; other site
31964012873	Walker B; other site
31964012874	D-loop; other site
31964012875	H-loop/switch region; other site
31964012876	HMMPfam hit to PF00005, ABC transporter, score 2.2e-39
31964012877	PS00211 ABC transporters family signature.
31964012878	PS00017 ATP/GTP-binding site motif A (P-loop).
31964012879	submitted with no further information
31964012880	Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols. AKRs are present in all phyla and are of importance to both health and industrial...; Region: Aldo_ket_red; cd06660
31964012881	Aldo/keto reductase family; Region: Aldo_ket_red; pfam00248
31964012882	active site
31964012883	catalytic tetrad [active]
31964012884	HMMPfam hit to PF00248, Aldo/keto reductase, score 3.6e-35
31964012885	11 probable transmembrane helices predicted for CMS2971 by TMHMM2.0 at aa 21-43, 58-80, 89-111, 149-168,175-197, 230-252, 259-281, 304-323, 325-347, 362-384 and 391-413
31964012886	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964012887	Predicted transcriptional regulators [Transcription]; Region: COG1733
31964012888	HxlR-like helix-turn-helix; Region: HxlR; pfam01638
31964012889	HMMPfam hit to PF01638, Protein of unknown function DUF24, score 6.8e-27
31964012890	Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]; Region: COG0702
31964012891	triphenylmethane reductase (TMR)-like proteins, NMRa-like, atypical (a) SDRs; Region: TMR_SDR_a; cd05269
31964012892	NADP binding site [chemical binding]; other site
31964012893	Homocysteine S-methyltransferase; Region: S-methyl_trans; pfam02574
31964012894	homocysteine methyltransferase; Provisional; Region: mmuM; PRK09485
31964012895	HMMPfam hit to PF02574, Homocysteine S-methyltransferase, score 2.9e-88
31964012896	helix_turn_helix multiple antibiotic resistance protein; Region: HTH_MARR; smart00347
31964012897	MarR family; Region: MarR_2; cl17246
31964012898	HMMPfam hit to PF01047, Bacterial regulatory protein, MarR, score 7.2e-13
31964012899	Predicted phosphatases [General function prediction only]; Region: Gph; COG0546
31964012900	Haloacid dehalogenase-like hydrolases. The haloacid dehalogenase-like (HAD) superfamily includes L-2-haloacid dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, and many others; Region: HAD_like; cd01427
31964012901	motif II; other site
31964012902	HMMPfam hit to PF00702, Haloacid dehalogenase-like hydrolase, score 2.4e-17
31964012903	1 probable transmembrane helix predicted for CMS2978 by TMHMM2.0 at aa 47-69
31964012904	submitted with no further information
31964012905	submitted with no further information
31964012906	1 probable transmembrane helix predicted for CMS2980 by TMHMM2.0 at aa 29-51
31964012907	Lsr2; Region: Lsr2; pfam11774
31964012908	Helix-turn-helix domain; Region: HTH_17; pfam12728
31964012909	Domain of unknown function (DUF1508); Region: DUF1508; cl01356
31964012910	Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and...; Region: SR_ResInv; cd03768
31964012911	Site-specific recombinases, DNA invertase Pin homologs [DNA replication, recombination, and repair]; Region: PinR; COG1961
31964012912	Presynaptic Site I dimer interface [polypeptide binding]; other site
31964012913	catalytic residues [active]
31964012914	Synaptic Antiparallel dimer interface [polypeptide binding]; other site
31964012915	Synaptic Flat tetramer interface [polypeptide binding]; other site
31964012916	Synaptic Site I dimer interface [polypeptide binding]; other site
31964012917	DNA binding site [nucleotide binding]
31964012918	Helix-turn-helix domain of Hin and related proteins, a family of DNA-binding domains unique to bacteria and represented by the Hin protein of Salmonella. The basic HTH domain is a simple fold comprised of three core helices that form a right-handed...; Region: HTH_Hin_like; cl17393
31964012919	DNA-binding interface [nucleotide binding]; DNA binding site
31964012920	HMMPfam hit to PF02796, Resolvase helix-turn-helix region, score 1.2e-06
31964012921	HMMPfam hit to PF00239, Resolvase, N-terminal,score 1.2e-15
31964012922	PS00398 Site-specific recombinases signature 2.
31964012923	Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. Alignment contains also inactive enzymes that have substitutions of the catalytic triad...; Region: Tryp_SPc; cl00149
31964012924	1 probable transmembrane helix predicted for CMS2989 by TMHMM2.0 at aa 43-65
31964012925	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964012926	PS00135 Serine proteases, trypsin family, serine active site.
31964012927	Transcriptional regulators [Transcription]; Region: GntR; COG1802
31964012928	Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators; Region: WHTH_GntR; cl17414
31964012929	DNA-binding site [nucleotide binding]; DNA binding site
31964012930	FCD domain; Region: FCD; pfam07729
31964012931	HMMPfam hit to PF07729, FCD domain, score 9.5e-23
31964012932	HMMPfam hit to PF00392, Bacterial regulatory protein, GntR, score 5.4e-12
31964012933	Solute carrier families 5 and 6-like; solute binding domain; Region: SLC5-6-like_sbd; cl00456
31964012934	Na binding site [ion binding]; other site
31964012935	HMMPfam hit to PF02133, Permease for cytosine/purines, uracil, thiamine, allantoin, score 7.2e-07
31964012936	12 probable transmembrane helices predicted for CMS2995 by TMHMM2.0 at aa 48-70, 75-97, 110-132, 147-169,174-196, 206-228, 248-270, 285-307, 335-354, 358-380,393-415 and 419-441
31964012937	Isochorismatase family; Region: Isochorismatase; pfam00857
31964012938	Cysteine hydrolases; This family contains amidohydrolases, like CSHase (N-carbamoylsarcosine amidohydrolase), involved in creatine metabolism and nicotinamidase, converting nicotinamide to nicotinic acid and ammonia in the pyridine nucleotide cycle. It...; Region: cysteine_hydrolases; cd00431
31964012939	catalytic triad [active]
31964012940	conserved cis-peptide bond; other site
31964012941	HMMPfam hit to PF00857, Isochorismatase hydrolase,score 6.2e-21
31964012942	8 probable transmembrane helices predicted for CMS2997 by TMHMM2.0 at aa 10-32, 37-59, 79-101, 114-136,192-214, 221-238, 242-261 and 274-296
31964012943	pyrimidine utilization transport protein G; Region: RutG; TIGR03616
31964012944	12 probable transmembrane helices predicted for CMS2998 by TMHMM2.0 at aa 13-35, 39-61, 66-88, 93-115,122-141, 151-173, 175-194, 220-242, 263-285, 300-322,329-351 and 366-400
31964012945	HMMPfam hit to PF00860, Xanthine/uracil/vitamin C permease, score 1.5e-83
31964012946	Winged helix-turn helix; Region: HTH_29; pfam13551
31964012947	leucine-zipper of insertion element IS481; Region: LZ_Tnp_IS481; pfam13011
31964012948	Integrase core domain; Region: rve; pfam00665
31964012949	Integrase core domain; Region: rve_3; pfam13683
31964012950	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.1e-38
31964012951	Homeodomain-like domain; Region: HTH_23; cl17451
31964012952	Winged helix-turn helix; Region: HTH_29; pfam13551
31964012953	Integrase core domain; Region: rve; pfam00665
31964012954	Integrase core domain; Region: rve_3; pfam13683
31964012955	HMMPfam hit to PF00665, Integrase, catalytic region, score 1.6e-41
31964012956	Membrane proteins related to metalloendopeptidases [Cell envelope biogenesis, outer membrane]; Region: NlpD; COG0739
31964012957	Peptidase family M23; Region: Peptidase_M23; pfam01551
31964012958	HMMPfam hit to PF01551, Peptidase M23B, score 1.9e-28
31964012959	1 probable transmembrane helix predicted for CMS3001 by TMHMM2.0 at aa 49-71
31964012960	Archaeal fructose-1,6-bisphosphatase and related enzymes of inositol monophosphatase family [Carbohydrate transport and metabolism]; Region: SuhB; COG0483
31964012961	IMPase, inositol monophosphatase and related domains. A family of Mg++ dependent phosphatases, inhibited by lithium, many of which may act on inositol monophosphate substrate. They dephosphorylate inositol phosphate to generate inositol, which may be...; Region: IMPase; cd01639
31964012962	active site
31964012963	dimerization interface [polypeptide binding]; other site
31964012964	HMMPfam hit to PF00459, Inositol monophosphatase,score 2.1e-72
31964012965	PS00629 Inositol monophosphatase family signature 1.
31964012966	Protein of unknown function (DUF1275); Region: DUF1275; pfam06912
31964012967	7 probable transmembrane helices predicted for CMS3004 by TMHMM2.0 at aa 10-32, 39-58, 63-80, 93-115,120-140, 173-195 and 199-221
31964012968	HMMPfam hit to PF06912, Protein of unknown function DUF1275, score 1e-12
31964012969	Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols. AKRs are present in all phyla and are of importance to both health and industrial...; Region: Aldo_ket_red; cd06660
31964012970	Aldo/keto reductase family; Region: Aldo_ket_red; pfam00248
31964012971	active site
31964012972	catalytic tetrad [active]
31964012973	HMMPfam hit to PF00248, Aldo/keto reductase, score 8.8e-48
31964012974	PS00213 Lipocalin signature.
31964012975	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG1666
31964012976	Proteins similar to Escherichia coli YajQ; Region: YajQ_like; cd11740
31964012977	HMMPfam hit to PF04461, Protein of unknown function DUF520, score 3.6e-86
31964012978	cardiolipin synthetase; Reviewed; Region: cls; PRK01642
31964012979	Phospholipase_D-nuclease N-terminal; Region: PLDc_N; pfam13396
31964012980	Catalytic domain, repeat 1, of Escherichia coli cardiolipin synthase and similar proteins; Region: PLDc_EcCLS_like_1; cd09152
31964012981	putative active site [active]
31964012982	catalytic site [active]
31964012983	Catalytic domain, repeat 2, of Escherichia coli cardiolipin synthase and similar proteins; Region: PLDc_EcCLS_like_2; cd09158
31964012984	putative active site [active]
31964012985	catalytic site [active]
31964012986	2 probable transmembrane helices predicted for CMS3007 by TMHMM2.0 at aa 4-26 and 33-55
31964012987	HMMPfam hit to PF00614, Phospholipase D/Transphosphatidylase, score 5e-05
31964012988	HMMPfam hit to PF00614, Phospholipase D/Transphosphatidylase, score 6.7e-06
31964012989	helix_turn_helix multiple antibiotic resistance protein; Region: HTH_MARR; smart00347
31964012990	MarR family; Region: MarR; pfam01047
31964012991	HMMPfam hit to PF01047, Bacterial regulatory protein, MarR, score 4.4e-12
31964012992	6 probable transmembrane helices predicted for CMS3009 by TMHMM2.0 at aa 10-32, 51-73, 77-99, 111-133,157-179 and 186-203
31964012993	HMMPfam hit to PF01478, Peptidase A24A, prepilin type IV, score 0.00014
31964012994	ferredoxin-NADP+ reductase; Region: PLN02852
31964012995	NAD(P)-binding Rossmann-like domain; Region: NAD_binding_8; cl17500
31964012996	Geranylgeranyl pyrophosphate synthase [Coenzyme metabolism]; Region: IspA; COG0142
31964012997	Trans-Isoprenyl Diphosphate Synthases, head-to-tail; Region: Trans_IPPS_HT; cd00685
31964012998	substrate binding pocket [chemical binding]; other site
31964012999	chain length determination region; other site
31964013000	substrate-Mg2+ binding site; other site
31964013001	catalytic residues [active]
31964013002	aspartate-rich region 1; other site
31964013003	active site lid residues [active]
31964013004	aspartate-rich region 2; other site
31964013005	HMMPfam hit to PF00348, Polyprenyl synthetase,score 3.5e-52
31964013006	Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism]; Region: UbiE; COG2226
31964013007	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
31964013008	HMMPfam hit to PF01209, UbiE/COQ5 methyltransferase, score 3.3e-71
31964013009	chorismate binding enzyme; Region: Chorismate_bind; pfam00425
31964013010	HMMPfam hit to PF00425, Anthranilate synthase component I and chorismate binding protein, score 3.1e-55
31964013011	10 probable transmembrane helices predicted for CMS3014 by TMHMM2.0 at aa 20-42, 52-74, 95-114, 124-146,216-238, 248-270, 282-304, 314-336, 349-371 and 381-400
31964013012	HMMPfam hit to PF07690, Major Facilitator Superfamily
31964013013	HMMPfam hit to PF01022, Bacterial regulatory protein, ArsR, score 2.8e-09
31964013014	Tyrosine phosphatase family; Region: Y_phosphatase3; pfam13350
31964013015	PS00383 Tyrosine specific protein phosphatases active site.
31964013016	2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1- carboxylate synthase; Validated; Region: PRK07449
31964013017	Pyrimidine (PYR) binding domain of 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexadiene-1- carboxylate synthase (MenD) and related proteins; Region: TPP_PYR_MenD; cd07037
31964013018	dimer interface [polypeptide binding]; other site
31964013019	tetramer interface [polypeptide binding]; other site
31964013020	PYR/PP interface [polypeptide binding]; other site
31964013021	TPP binding site [chemical binding]; other site
31964013022	Thiamine pyrophosphate (TPP) enzyme family, TPP-binding module; found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor. These enzymes include, among others, the E1 components of the pyruvate, the acetoin and...; Region: TPP_enzymes; cl01629
31964013023	TPP-binding site [chemical binding]; other site
31964013024	2 probable transmembrane helices predicted for CMS3018 by TMHMM2.0 at aa 5-23 and 38-57
31964013025	Protein of unknown function (DUF4229); Region: DUF4229; pfam14012
31964013026	2 probable transmembrane helices predicted for CMS3019 by TMHMM2.0 at aa 7-29 and 33-52
31964013027	1,4-dihydroxy-2-naphthoate octaprenyltransferase; Validated; Region: PRK06080
31964013028	UbiA prenyltransferase family; Region: UbiA; pfam01040
31964013029	9 probable transmembrane helices predicted for CMS3021 by TMHMM2.0 at aa 12-31, 41-63, 93-115, 119-138,150-172, 176-197, 218-240, 244-263 and 270-292
31964013030	HMMPfam hit to PF01040, UbiA prenyltransferase,score 4e-20
31964013031	Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction; Region: HP_PGM_like; cd07067
31964013032	catalytic core [active]
31964013033	HMMPfam hit to PF00300,Phosphoglycerate/bisphosphoglycerate mutase, score 5.4e-31
31964013034	Beta-lactamase enzyme family; Region: Beta-lactamase2; pfam13354
31964013035	Predicted metalloendopeptidase [Posttranslational modification, protein turnover, chaperones]; Region: PepO; COG3590
31964013036	Peptidase family M13 includes neprilysin, endothelin-converting enzyme I; Region: M13; cd08662
31964013037	active site
31964013038	Zn binding site [ion binding]; other site
31964013039	HMMPfam hit to PF01431, Peptidase M13, neprilysin,score 4.6e-84
31964013040	PS00142 Neutral zinc metallopeptidases,zinc-binding region signature.
31964013041	HMMPfam hit to PF05649, Peptidase M13, score 1.4e-121
31964013042	Homeodomain-like domain; Region: HTH_23; cl17451
31964013043	Winged helix-turn helix; Region: HTH_29; pfam13551
31964013044	Integrase core domain; Region: rve; pfam00665
31964013045	Integrase core domain; Region: rve_3; pfam13683
31964013046	HMMPfam hit to PF00665, Integrase, catalytic region, score 5.7e-38
31964013047	atypical
31964013048	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964013049	Trimeric dUTP diphosphatases; Region: trimeric_dUTPase; cd07557
31964013050	trimer interface [polypeptide binding]; other site
31964013051	active site
31964013052	HMMPfam hit to PF00692, DeoxyUTP pyrophosphatase,score 9.2e-13
31964013053	PS00017 ATP/GTP-binding site motif A (P-loop).
31964013054	submitted with no further information
31964013055	Catalytic domain of type II restriction endonucleases BfiI and NgoFVII, and uncharacterized proteins with a DEAD domain; Region: PLDc_Bfil_DEXD_like; cd09117
31964013056	PLD-like domain; Region: PLDc_2; pfam13091
31964013057	homodimer interface [polypeptide binding]; other site
31964013058	putative active site [active]
31964013059	catalytic site [active]
31964013060	Adenine-specific DNA methylase [DNA replication, recombination, and repair]; Region: COG3392
31964013061	D12 class N6 adenine-specific DNA methyltransferase; Region: MethyltransfD12; cl17344
31964013062	D12 class N6 adenine-specific DNA methyltransferase; Region: MethyltransfD12; cl17344
31964013063	PS00092 N-6 Adenine-specific DNA methylases signature.
31964013064	Adenine specific DNA methylase Mod [DNA replication, recombination, and repair]; Region: COG2189
31964013065	DNA methylase; Region: N6_N4_Mtase; pfam01555
31964013066	DNA methylase; Region: N6_N4_Mtase; pfam01555
31964013067	DNA modification methylase [DNA replication, recombination, and repair]; Region: COG0863
31964013068	PS00092 N-6 Adenine-specific DNA methylases signature.
31964013069	HMMPfam hit to PF01555, DNA methylase N-4/N-6,score 1.6e-27
31964013070	Transcriptional regulators [Transcription]; Region: FadR; COG2186
31964013071	HMMPfam hit to PF07729, FCD domain, score 0.00011
31964013072	H+/gluconate symporter and related permeases [Carbohydrate transport and metabolism / Amino acid transport and metabolism]; Region: GntT; COG2610
31964013073	fructuronate transporter; Provisional; Region: PRK10034; cl15264
31964013074	12 probable transmembrane helices predicted for CMS3035 by TMHMM2.0 at aa 9-31, 35-57, 62-84, 119-141,148-167, 187-209, 236-258, 278-300, 313-335, 350-372,404-426 and 441-463
31964013075	HMMPfam hit to PF02447, Gluconate transporter,score 8.7e-144
31964013076	leucine-zipper of insertion element IS481; Region: LZ_Tnp_IS481; pfam13011
31964013077	Winged helix-turn helix; Region: HTH_29; pfam13551
31964013078	Integrase core domain; Region: rve; pfam00665
31964013079	Integrase core domain; Region: rve_3; pfam13683
31964013080	HMMPfam hit to PF00665, Integrase, catalytic region, score 3.5E-36
31964013081	Transcriptional regulators [Transcription]; Region: PurR; COG1609
31964013082	Helix-turn-helix (HTH) DNA binding domain of the LacI family of transcriptional regulators; Region: HTH_LacI; cd01392
31964013083	DNA binding site [nucleotide binding]
31964013084	domain linker motif; other site
31964013085	Ligand binding domain of a transcription regulator of cellulose genes, CelR, which is highly homologous to the LacI-GalR family of bacterial transcription regulators; Region: PBP1_CelR; cd06295
31964013086	putative dimerization interface [polypeptide binding]; other site
31964013087	putative ligand binding site [chemical binding]; other site
31964013088	HMMPfam hit to PF00532, Periplasmic binding protein/LacI transcriptional regulator, score 6.6e-21
31964013089	ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism]; Region: UgpE; COG0395
31964013090	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964013091	dimer interface [polypeptide binding]; other site
31964013092	conserved gate region; other site
31964013093	putative PBP binding loops; other site
31964013094	ABC-ATPase subunit interface; other site
31964013095	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 3.1e-19
31964013096	6 probable transmembrane helices predicted for CMS3038 by TMHMM2.0 at aa 43-65, 108-130, 139-161,166-188, 216-238 and 271-293
31964013097	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964013098	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
31964013099	dimer interface [polypeptide binding]; other site
31964013100	conserved gate region; other site
31964013101	putative PBP binding loops; other site
31964013102	ABC-ATPase subunit interface; other site
31964013103	HMMPfam hit to PF00528, Binding-protein-dependent transport systems inner membrane component, score 7.4e-10
31964013104	6 probable transmembrane helices predicted for CMS3039 by TMHMM2.0 at aa 41-63, 100-122, 134-156,185-207, 234-256 and 298-317
31964013105	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
31964013106	Bacterial extracellular solute-binding protein; Region: SBP_bac_8; pfam13416
31964013107	HMMPfam hit to PF01547, Bacterial extracellular solute-binding protein, family 1, score 0.0013
31964013108	Predicted dehydrogenases and related proteins [General function prediction only]; Region: MviM; COG0673
31964013109	Oxidoreductase family, NAD-binding Rossmann fold; Region: GFO_IDH_MocA; pfam01408
31964013110	Oxidoreductase family, C-terminal alpha/beta domain; Region: GFO_IDH_MocA_C; pfam02894
31964013111	HMMPfam hit to PF01408, Oxidoreductase, N-terminal,score 1.5e-37
31964013112	HMMPfam hit to PF02894, Oxidoreductase, C-terminal,score 6e-13
31964013113	NADPH-dependent FMN reductase; Region: FMN_red; pfam03358
31964013114	Predicted flavoprotein [General function prediction only]; Region: COG0431
31964013115	HMMPfam hit to PF03358, NADPH-dependent FMN reductase, score 7.4e-49
31964013116	HMMPfam hit to PF00107, Zinc-containing alcohol dehydrogenase superfamily, score 5.9e-29
31964013117	PS00339 Aminoacyl-transfer RNA synthetases class-II signature 2.
31964013118	PS00059 Zinc-containing alcohol dehydrogenases signature.
31964013119	Patatins and Phospholipases; Region: Patatin_and_cPLA2; cl11396
31964013120	Manganese catalase, ferritin-like diiron-binding domain; Region: Mn_catalase; cd01051
31964013121	dimanganese center [ion binding]; other site
31964013122	HMMPfam hit to PF05067, Manganese containing catalase, score 6.8e-118
31964013123	Metallo-beta-lactamase superfamily; Region: Lactamase_B; smart00849
31964013124	HMMPfam hit to PF00753, Beta-lactamase-like, score 4.6e-29
31964013125	Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction; Region: HP_PGM_like; cd07067
31964013126	catalytic core [active]
31964013127	HMMPfam hit to PF00300,Phosphoglycerate/bisphosphoglycerate mutase, score 8.5e-13
31964013128	PS00175 Phosphoglycerate mutase family phosphohistidine signature.
31964013129	ribokinase/pfkB superfamily: Kinases that accept a wide variety of substrates, including carbohydrates and aromatic small molecules, all are phosphorylated at a hydroxyl group. The superfamily includes ribokinase, fructokinase, ketohexokinase; Region: ribokinase_pfkB_like; cl00192
31964013130	substrate binding site [chemical binding]; other site
31964013131	ATP binding site [chemical binding]; other site
31964013132	HMMPfam hit to PF01256, Protein of unknown function UPF0031, score 1.9e-30
31964013133	2 probable transmembrane helices predicted for CMS3053 by TMHMM2.0 at aa 10-32 and 48-70
31964013134	2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family; Region: DeoC; cd00959
31964013135	intersubunit interface [polypeptide binding]; other site
31964013136	active site
31964013137	catalytic residue [active]
31964013138	HMMPfam hit to PF01791, Deoxyribose-phosphate aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase,score 7e-81
31964013139	M18 Peptidase Aspartyl aminopeptidase; Region: M18_DAP; cd05658
31964013140	Aminopeptidase I zinc metalloprotease (M18); Region: Peptidase_M18; pfam02127
31964013141	active site
31964013142	metal binding site [ion binding]; metal-binding site
31964013143	HMMPfam hit to PF02127, Peptidase M18,aminopeptidase I, score 1.9e-131
31964013144	Domain of unknown function (DUF305); Region: DUF305; pfam03713
31964013145	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964013146	Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism]; Region: COG0412
31964013147	HMMPfam hit to PF01738, Dienelactone hydrolase,score 7.9e-09
31964013148	Domain of unknown function (DUF4383); Region: DUF4383; pfam14325
31964013149	4 probable transmembrane helices predicted for CMS3058 by TMHMM2.0 at aa 13-35, 50-72, 79-96 and 111-128
31964013150	5 probable transmembrane helices predicted for CMS3059 by TMHMM2.0 at aa 7-26, 30-52, 59-81, 91-110 and 184-206
31964013151	PIF1-like helicase; Region: PIF1; pfam05970
31964013152	AAA domain; Region: AAA_30; pfam13604
31964013153	PS00017 ATP/GTP-binding site motif A (P-loop).
31964013154	1 probable transmembrane helix predicted for CMS3061 by TMHMM2.0 at aa 15-37
31964013155	Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily; Region: Glyoxalase; pfam00903
31964013156	Escherichia coli PhnB and similar proteins; the E. coli phnB gene is found next to an operon involved in the cleavage of carbon-phosphorus bonds in unactivated alkylphosphonates; Region: PhnB_like; cd06588
31964013157	dimer interface [polypeptide binding]; other site
31964013158	HMMPfam hit to PF00903, Glyoxalase/bleomycin resistance protein/dioxygenase, score 7.3e-11
31964013159	PS00225 Crystallins beta and gamma 'Greek key' motif signature.
31964013160	PS00213 Lipocalin signature.
31964013161	ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]; Region: FepC; COG1120
31964013162	ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins; Region: ABC_Iron-Siderophores_B12_Hemin; cd03214
31964013163	Walker A/P-loop; other site
31964013164	ATP binding site [chemical binding]; other site
31964013165	Q-loop/lid; other site
31964013166	ABC transporter signature motif; other site
31964013167	Walker B; other site
31964013168	D-loop; other site
31964013169	H-loop/switch region; other site
31964013170	HMMPfam hit to PF00005, ABC transporter, score 5.5e-49
31964013171	PS00211 ABC transporters family signature.
31964013172	PS00017 ATP/GTP-binding site motif A (P-loop).
31964013173	PS00430 TonB-dependent receptor proteins signature 1.
31964013174	Transmembrane subunit (TM), of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters involved in the uptake of siderophores, heme, vitamin B12, or the divalent cations Mg2+ and Zn2+. PBP-dependent ABC transporters consist of...; Region: TM_ABC_iron-siderophores_like; cd06550
31964013175	ABC-ATPase subunit  interface; other site
31964013176	dimer interface [polypeptide binding]; other site
31964013177	putative PBP binding regions; other site
31964013178	HMMPfam hit to PF01032, Bacterial transport system permease protein, score 8.8e-84
31964013179	10 probable transmembrane helices predicted for CMS3064 by TMHMM2.0 at aa 35-54, 86-104, 117-139, 143-162,169-191, 195-214, 221-243, 263-285, 298-320 and 325-347
31964013180	iron-hydroxamate transporter permease subunit; Provisional; Region: PRK10577
31964013181	Transmembrane subunit (TM), of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters involved in the uptake of siderophores, heme, vitamin B12, or the divalent cations Mg2+ and Zn2+. PBP-dependent ABC transporters consist of...; Region: TM_ABC_iron-siderophores_like; cl00462
31964013182	Transmembrane subunit (TM), of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters involved in the uptake of siderophores, heme, vitamin B12, or the divalent cations Mg2+ and Zn2+. PBP-dependent ABC transporters consist of...; Region: TM_ABC_iron-siderophores_like; cd06550
31964013183	ABC-ATPase subunit  interface; other site
31964013184	dimer interface [polypeptide binding]; other site
31964013185	putative PBP binding regions; other site
31964013186	HMMPfam hit to PF01032, Bacterial transport system permease protein, score 3.9e-97
31964013187	10 probable transmembrane helices predicted for CMS3065 by TMHMM2.0 at aa 26-48, 76-98, 111-133, 137-159,166-188, 212-234, 247-269, 273-292, 297-316 and 326-344
31964013188	Fe3+-siderophore binding domain FhuD.  These proteins have been shown to function as initial receptors in ABC transport of Fe3+-siderophores in many eubacterial species. They belong to the TroA-like superfamily of helical backbone metal receptor proteins...; Region: FhuD; cd01146
31964013189	Periplasmic binding protein; Region: Peripla_BP_2; pfam01497
31964013190	siderophore binding site; other site
31964013191	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964013192	HMMPfam hit to PF01497, Periplasmic binding protein, score 1.6e-31
31964013193	5 probable transmembrane helices predicted for tmhmm2embl_unknown_000010_3215225_3215737 by TMHMM2.0 at aa 10-32, 44-63, 78-100, 107-129 and 144-161
31964013194	Copper resistance protein D; Region: CopD; cl00563
31964013195	Cytochrome c oxidase caa3 assembly factor (Caa3_CtaG); Region: Caa3_CtaG; pfam09678
31964013196	15 probable transmembrane helices predicted for CMS3068 by TMHMM2.0 at aa 15-32, 52-74, 89-111, 118-135,150-172, 184-206, 216-238, 259-281, 325-347, 360-379,389-411, 440-462, 477-496, 509-531 and 558-580
31964013197	HMMPfam hit to PF05425, Copper resistance D, score 4.2e-06
31964013198	Integration host factor (IHF) and HU are small heterodimeric members of the DNABII protein family that bind and bend DNA, functioning as architectural factors in many cellular processes including transcription, site-specific recombination, and...; Region: HU_IHF; cd00591
31964013199	IHF dimer interface [polypeptide binding]; other site
31964013200	IHF - DNA interface [nucleotide binding]; other site
31964013201	HMMPfam hit to PF00216, Histone-like bacterial DNA-binding protein, score 5.8e-29
31964013202	30S ribosomal protein S14; Reviewed; Region: rpsN; PRK08881
31964013203	HMMPfam hit to PF00253, Ribosomal protein S14,score 2.4e-12
31964013204	50S ribosomal protein L33; Validated; Region: rpmG; PRK00595
31964013205	HMMPfam hit to PF00471, Ribosomal protein L33,score 1.7e-11
31964013206	50S ribosomal protein L28; Reviewed; Region: rpmB; PRK00359
31964013207	HMMPfam hit to PF00830, Ribosomal protein L28,score 1.4e-24
31964013208	Ferric uptake regulator(Fur) and related metalloregulatory proteins; typically iron-dependent, DNA-binding repressors and activators; Region: Fur_like; cd07153
31964013209	metal binding site 2 [ion binding]; metal-binding site
31964013210	putative DNA binding helix; other site
31964013211	metal binding site 1 [ion binding]; metal-binding site
31964013212	dimer interface [polypeptide binding]; other site
31964013213	structural Zn2+ binding site [ion binding]; other site
31964013214	HMMPfam hit to PF01475, Ferric-uptake regulator,score 1.9e-23
31964013215	ABC-type Mn2+/Zn2+ transport systems, permease components [Inorganic ion transport and metabolism]; Region: ZnuB; COG1108
31964013216	Transmembrane subunit (TM), of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters involved in the uptake of siderophores, heme, vitamin B12, or the divalent cations Mg2+ and Zn2+. PBP-dependent ABC transporters consist of...; Region: TM_ABC_iron-siderophores_like; cl00462
31964013217	putative PBP binding regions; other site
31964013218	ABC-ATPase subunit  interface; other site
31964013219	7 probable transmembrane helices predicted for CMS3074 by TMHMM2.0 at aa 27-49, 74-96, 106-128, 149-171,191-213, 234-256 and 260-282
31964013220	HMMPfam hit to PF00950, ABC-3, score 2.7e-31
31964013221	ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism]; Region: ZnuC; COG1121
31964013222	ATP-binding cassette domain of the metal-type transporters; Region: ABC_Metallic_Cations; cd03235
31964013223	HMMPfam hit to PF00005, ABC transporter, score 4.9e-41
31964013224	PS00211 ABC transporters family signature.
31964013225	PS00017 ATP/GTP-binding site motif A (P-loop).
31964013226	Helical backbone metal receptor (TroA-like domain). These proteins have been shown to function in the ABC transport of ferric siderophores and metal ions such as Mn2+, Fe3+, Cu2+ and/or Zn2+.  Their ligand binding site is formed in the interface between...; Region: TroA-like; cl00262
31964013227	Periplasmic solute binding protein family; Region: SBP_bac_9; pfam01297
31964013228	intersubunit interface [polypeptide binding]; other site
31964013229	HMMPfam hit to PF01297, Periplasmic solute binding protein, score 1.6e-13
31964013230	branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed; Region: PRK11856
31964013231	Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases. 2-oxo acid dehydrogenase multienzyme complexes, like pyruvate dehydrogenase (PDH), 2-oxoglutarate dehydrogenase (OGDH) and branched-chain 2-oxo acid...; Region: lipoyl_domain; cd06849
31964013232	E3 interaction surface; other site
31964013233	lipoyl attachment site [posttranslational modification]; other site
31964013234	e3 binding domain; Region: E3_binding; pfam02817
31964013235	2-oxoacid dehydrogenases acyltransferase (catalytic domain); Region: 2-oxoacid_dh; pfam00198
31964013236	HMMPfam hit to PF00198, Catalytic domain of components of various dehydrogenase complexes, score 1.3e-101
31964013237	HMMPfam hit to PF02817, E3 binding, score 6.4e-07
31964013238	HMMPfam hit to PF00364, Biotin/lipoyl attachment,score 1.8e-25
31964013239	Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit [Energy production and conversion]; Region: AcoB; COG0022
31964013240	Pyrimidine (PYR) binding domain of the beta subunits of the E1 components of human pyruvate dehydrogenase complex (E1- PDHc) and related proteins; Region: TPP_PYR_E1-PDHc-beta_like; cd07036
31964013241	alpha subunit interface [polypeptide binding]; other site
31964013242	TPP binding site [chemical binding]; other site
31964013243	heterodimer interface [polypeptide binding]; other site
31964013244	Transketolase, C-terminal domain; Region: Transketolase_C; pfam02780
31964013245	HMMPfam hit to PF02780, Transketolase, C terminal,score 1.8e-44
31964013246	HMMPfam hit to PF02779, Transketolase, central region, score 3.1e-65
31964013247	pyruvate dehydrogenase E1 component, alpha subunit; Region: PDH_E1_alph_x; TIGR03181
31964013248	Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain...; Region: TPP_E1_PDC_ADC_BCADC; cd02000
31964013249	TPP-binding site [chemical binding]; other site
31964013250	tetramer interface [polypeptide binding]; other site
31964013251	heterodimer interface [polypeptide binding]; other site
31964013252	phosphorylation loop region [posttranslational modification]
31964013253	HMMPfam hit to PF00676, Dehydrogenase, E1 component, score 7.1e-61
31964013254	histidinol-phosphate aminotransferase; Validated; Region: PRK02731
31964013255	Aspartate aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). Pyridoxal phosphate combines with an alpha-amino acid to form a compound called a Schiff base or aldimine...; Region: AAT_like; cd00609
31964013256	pyridoxal 5'-phosphate binding site [chemical binding]; other site
31964013257	homodimer interface [polypeptide binding]; other site
31964013258	catalytic residue [active]
31964013259	HMMPfam hit to PF00155, Aminotransferase, class I and II, score 9.8e-28
31964013260	PS00599 Aminotransferases class-II pyridoxal-phosphate attachment site.
31964013261	Membrane protein of unknown function; Region: DUF360; pfam04020
31964013262	HMMPfam hit to PF04020, Membrane protein of unknown function, score 1.6e-10
31964013263	4 probable transmembrane helices predicted for CMS3081 by TMHMM2.0 at aa 7-29, 39-58, 65-87 and 102-124
31964013264	PGAP1-like protein; Region: PGAP1; pfam07819
31964013265	Low molecular weight phosphatase family; Region: LMWPc; cd00115
31964013266	Low molecular weight phosphotyrosine protein phosphatase; Region: LMWPc; pfam01451
31964013267	active site
31964013268	HMMPfam hit to PF01451, Low molecular weight phosphotyrosine protein phosphatase, score 5e-46
31964013269	adenylosuccinate lyase; Provisional; Region: PRK09285
31964013270	Lyase class I_like superfamily: contains the lyase class I family, histidine ammonia-lyase and phenylalanine ammonia-lyase, which catalyze similar beta-elimination reactions; Region: Lyase_I_like; cl00013
31964013271	tetramer interface [polypeptide binding]; other site
31964013272	HMMPfam hit to PF00206, Fumarate lyase, score 7.6e-33
31964013273	PS00163 Fumarate lyases signature.
31964013274	2 probable transmembrane helices predicted for CMS3086 by TMHMM2.0 at aa 13-35 and 45-67
31964013275	6 probable transmembrane helices predicted for CMS3087 by TMHMM2.0 at aa 21-38, 48-70, 77-99, 104-126,138-160 and 175-197
31964013276	1 probable transmembrane helix predicted for CMS3088 by TMHMM2.0 at aa 10-32
31964013277	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
31964013278	Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism]; Region: NagC; COG1940
31964013279	Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily; Region: NBD_sugar-kinase_HSP70_actin; cd00012
31964013280	nucleotide binding site [chemical binding]; other site
31964013281	HMMPfam hit to PF00480, ROK, score 1.3e-05
31964013282	Glycerate kinase [Carbohydrate transport and metabolism]; Region: COG1929
31964013283	Glycerate kinase family; Region: Gly_kinase; cl00841
31964013284	HMMPfam hit to PF02595, Glycerate kinase, score 2.8e-35
31964013285	This family is most closely related to the GT1 family of glycosyltransferases. The sucrose-phosphate synthases in this family may be unique to plants and photosynthetic bacteria. This enzyme catalyzes the synthesis of sucrose 6-phosphate from fructose...; Region: GT1_Sucrose_synthase; cd03800
31964013286	putative ADP-binding pocket [chemical binding]; other site
31964013287	HMMPfam hit to PF00534, Glycosyl transferase, group 1, score 4.3e-37
31964013288	helix_turn_helix, mercury resistance; Region: HTH_MERR; smart00422
31964013289	MerR HTH family regulatory protein; Region: MerR_1; pfam13411
31964013290	DNA binding residues [nucleotide binding]
31964013291	HMMPfam hit to PF00376, Bacterial regulatory protein, MerR, score 1.6e-11
31964013292	PS00552 Bacterial regulatory proteins, merR family signature.
31964013293	Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis]; Region: PrfC; COG4108
31964013294	Release Factor 3 (RF3) protein involved in the terminal step of translocation in bacteria; Region: RF3; cd04169
31964013295	G1 box; other site
31964013296	putative GEF interaction site [polypeptide binding]; other site
31964013297	GTP/Mg2+ binding site [chemical binding]; other site
31964013298	Switch I region; other site
31964013299	G2 box; other site
31964013300	G3 box; other site
31964013301	Switch II region; other site
31964013302	G4 box; other site
31964013303	G5 box; other site
31964013304	RF3_II: this subfamily represents the domain II of bacterial Release Factor 3 (RF3). Termination of protein synthesis by the ribosome requires two release factor (RF) classes. The class II RF3 is a GTPase that removes class I RFs (RF1 or RF2) from the...; Region: RF3_II; cd03689
31964013305	HMMPfam hit to PF00009, Protein synthesis factor,GTP-binding, score 6.8e-65
31964013306	PS00301 GTP-binding elongation factors signature.
31964013307	HMMPfam hit to PF03144, Elongation factor Tu,domain 2, score 1.6e-06
31964013308	Zinc finger domain containing protein (CHY type) [Function unknown]; Region: COG4357
31964013309	CHY zinc finger; Region: zf-CHY; pfam05495
31964013310	PS00903 Cytidine and deoxycytidylate deaminases zinc-binding region signature.
31964013311	HMMPfam hit to PF05495, CHY zinc finger, score 2.3e-21
31964013312	replicative DNA helicase; Region: DnaB; TIGR00665
31964013313	DnaB-like helicase N terminal domain; Region: DnaB; pfam00772
31964013314	DnaB helicase C terminal domain. The hexameric helicase DnaB unwinds the DNA duplex at the  chromosome replication fork. Although the mechanism by which DnaB both couples ATP hydrolysis to translocation along DNA and denatures the duplex is unknown, a...; Region: DnaB_C; cd00984
31964013315	Walker A motif; other site
31964013316	ATP binding site [chemical binding]; other site
31964013317	Walker B motif; other site
31964013318	DNA binding loops [nucleotide binding]
31964013319	HMMPfam hit to PF03796, DnaB-like helicase,C-terminal, score 2.9e-111
31964013320	PS00017 ATP/GTP-binding site motif A (P-loop).
31964013321	HMMPfam hit to PF00772, DnaB-like helicase,N-terminal, score 4.2e-38
31964013322	50S ribosomal protein L9; Reviewed; Region: rplI; PRK00137
31964013323	Ribosomal protein L9, N-terminal domain; Region: Ribosomal_L9_N; pfam01281
31964013324	Ribosomal protein L9, C-terminal domain; Region: Ribosomal_L9_C; pfam03948
31964013325	HMMPfam hit to PF03948, Ribosomal protein L9, score 4.6e-22
31964013326	HMMPfam hit to PF01281, Ribosomal protein L9, score 4e-15
31964013327	PS00651 Ribosomal protein L9 signature.
31964013328	30S ribosomal protein S18; Reviewed; Region: rpsR; PRK00391
31964013329	HMMPfam hit to PF01084, Ribosomal protein S18,score 2.6e-26
31964013330	PS00057 Ribosomal protein S18 signature.
31964013331	Single-stranded DNA-binding protein [DNA replication, recombination, and repair]; Region: Ssb; COG0629
31964013332	SSB_OBF: A subfamily of OB folds similar to the OB fold of ssDNA-binding protein (SSB). SSBs bind with high affinity to ssDNA. They bind to and protect ssDNA intermediates during DNA metabolic pathways. All bacterial and eukaryotic SSBs studied to date...; Region: SSB_OBF; cd04496
31964013333	dimer interface [polypeptide binding]; other site
31964013334	ssDNA binding site [nucleotide binding]; other site
31964013335	tetramer (dimer of dimers) interface [polypeptide binding]; other site
31964013336	HMMPfam hit to PF00436, Single-strand binding protein/Primosomal replication protein n, score 1.3e-26
31964013337	30S ribosomal protein S6; Reviewed; Region: rpsF; PRK00453
31964013338	HMMPfam hit to PF01250, Ribosomal protein S6, score 2.3e-32
31964013339	PS01048 Ribosomal protein S6 signature.
31964013340	tRNA adenylyltransferase; Region: tRNA_CCA_actino; TIGR02692
31964013341	Nucleotidyltransferase (NT) domain of ClassII CCA-adding enzymes; Region: NT_ClassII-CCAase; cd05398
31964013342	active site
31964013343	NTP binding site [chemical binding]; other site
31964013344	metal binding triad [ion binding]; metal-binding site
31964013345	Probable RNA and SrmB- binding site of polymerase A; Region: PolyA_pol_RNAbd; pfam12627
31964013346	Metal dependent phosphohydrolases with conserved 'HD' motif; Region: HDc; cd00077
31964013347	Zn2+ binding site [ion binding]; other site
31964013348	Mg2+ binding site [ion binding]; other site
31964013349	HMMPfam hit to PF01966, Metal-dependent phosphohydrolase, HD subdomain, score 6.6e-13
31964013350	HMMPfam hit to PF01743, Polynucleotide adenylyltransferase, score 4.6e-60
31964013351	1 probable transmembrane helix predicted for CMS3101 by TMHMM2.0 at aa 687-709
31964013352	MurJ/MviN, a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins; Region: MATE_MurJ_like; cd13123
31964013353	14 probable transmembrane helices predicted for CMS3102 by TMHMM2.0 at aa 22-44, 59-81, 94-116, 131-153,165-187, 202-224, 245-267, 282-304, 340-362, 372-394,407-429, 433-455, 476-498 and 508-530
31964013354	HMMPfam hit to PF03023, Virulence factor MVIN-like,score 9.2e-54
31964013355	thioredoxin-disulfide reductase; Region: TRX_reduct; TIGR01292
31964013356	NAD(P)-binding Rossmann-like domain; Region: NAD_binding_8; cl17500
31964013357	Pyridine nucleotide-disulphide oxidoreductase; Region: Pyr_redox; pfam00070
31964013358	HMMPfam hit to PF00070, FAD-dependent pyridine nucleotide-disulphide oxidoreductase, score 1.2e-71
31964013359	PS00573 Pyridine nucleotide-disulphide oxidoreductases class-II active site.
31964013360	TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains. Group I TRX is a small ancient protein that alter the redox...; Region: TRX_family; cd02947
31964013361	Thioredoxin-like; Region: Thioredoxin_8; pfam13905
31964013362	catalytic residues [active]
31964013363	HMMPfam hit to PF00085, Thioredoxin-related, score 8e-32
31964013364	PS00194 Thioredoxin family active site.
31964013365	Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism]; Region: COG0436
31964013366	Aspartate aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). Pyridoxal phosphate combines with an alpha-amino acid to form a compound called a Schiff base or aldimine...; Region: AAT_like; cd00609
31964013367	pyridoxal 5'-phosphate binding site [chemical binding]; other site
31964013368	homodimer interface [polypeptide binding]; other site
31964013369	catalytic residue [active]
31964013370	HMMPfam hit to PF00155, Aminotransferase, class I and II, score 2.8e-12
31964013371	D-alanine--D-alanine ligase; Reviewed; Region: ddl; PRK01372
31964013372	D-ala D-ala ligase N-terminus; Region: Dala_Dala_lig_N; pfam01820
31964013373	ATP-grasp domain; Region: ATP-grasp_4; cl17255
31964013374	HMMPfam hit to PF01820, D-alanine--D-alanine ligase, N-terminal, score 2.8e-12
31964013375	HMMPfam hit to PF07478, D-alanine--D-alanine ligase, C-terminal, score 1.9e-39
31964013376	ParB/RepB/Spo0J family partition protein; Region: parB_part; TIGR00180
31964013377	ParB-like nuclease domain; Region: ParBc; pfam02195
31964013378	HMMPfam hit to PF02195, ParB-like nuclease, score 3e-28
31964013379	ATPases involved in chromosome partitioning [Cell division and chromosome partitioning]; Region: Soj; COG1192
31964013380	ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the...; Region: ParA; cd02042
31964013381	P-loop; other site
31964013382	Magnesium ion binding site [ion binding]; other site
31964013383	Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases); Region: Ras_like_GTPase; cl17170
31964013384	G2 box; other site
31964013385	Switch I region; other site
31964013386	G3 box; other site
31964013387	ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the...; Region: ParA; cd02042
31964013388	Magnesium ion binding site [ion binding]; other site
31964013389	The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain. Functionally, proteins in this superfamily use the energy from hydrolysis of NTP to transfer electron or ion; Region: Fer4_NifH; cl17203
31964013390	HMMPfam hit to PF01656, Cobyrinic acid a,c-diamide synthase, score 3.2e-61
31964013391	rRNA small subunit methyltransferase G; Region: GidB; pfam02527
31964013392	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
31964013393	S-adenosylmethionine binding site [chemical binding]; other site
31964013394	jag_K homology RNA-binding domain. The KH domain is found in proteins homologous to the Bacillus subtilis protein Jag, which is associated with SpoIIIJ and is necessary for the third stage of sporulation.  The KH motif is a beta-alpha-alpha-beta-beta...; Region: jag_KH; cd02414
31964013395	G-X-X-G motif; other site
31964013396	R3H domain found in proteins homologous to Bacillus subtilus Jag, which is associated with SpoIIIJ. SpoIIIJ is necessary for the third stage of sporulation. The name of the R3H domain comes from the characteristic spacing of the most conserved arginine...; Region: R3H_jag; cd02644
31964013397	RxxxH motif; other site
31964013398	HMMPfam hit to PF01424, Single-stranded nucleic acid binding R3H, score 4.3e-13
31964013399	putative inner membrane protein translocase component YidC; Provisional; Region: PRK01315
31964013400	membrane protein insertase, YidC/Oxa1 family, C-terminal domain; Region: yidC_oxa1_cterm; TIGR03592
31964013401	HMMPfam hit to PF02096, 60 kDa inner membrane protein, score 4.3e-56
31964013402	4 probable transmembrane helices predicted for CMS3112 by TMHMM2.0 at aa 5-27, 37-59, 175-197 and 217-239
31964013403	hypothetical protein; Provisional; Region: PRK14378
31964013404	HMMPfam hit to PF01809, Protein of unknown function DUF37, score 7.1e-33
31964013405	Ribonuclease P; Region: Ribonuclease_P; pfam00825
31964013406	HMMPfam hit to PF00825, Bacterial ribonuclease P protein, score 9.4e-14
31964013407	1 probable transmembrane helix predicted for tmhmm2embl_unknown_003072_3257619_3257939 by TMHMM2.0 at aa 60-82
31964013408	PS00648 Bacterial ribonuclease P protein component signature.
31964013409	Ribosomal protein L34; Region: Ribosomal_L34; cl00370
31964013410	HMMPfam hit to PF00468, Ribosomal protein L34,score 1.3e-20
31964013411	PS00784 Ribosomal protein L34 signature.
31964013412	VbhA antitoxin and related proteins; Region: VbhA_like; cd11586
31964013413	VbhA antitoxin and related proteins; Region: VbhA_like; cd11586
31964013414	DNA recombination-mediator protein A; Region: DNA_processg_A; pfam02481
31964013415	DNA protecting protein DprA; Region: dprA; TIGR00732
31964013416	Helix-turn-helix domain; Region: HTH_17; pfam12728
31964013417	Lsr2; Region: Lsr2; pfam11774
31964013418	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
31964013419	cell division ATP-binding protein FtsE; Region: FtsE; TIGR02673
31964013420	Walker A/P-loop; other site
31964013421	ATP binding site [chemical binding]; other site
31964013422	Q-loop/lid; other site
31964013423	ABC transporter signature motif; other site
31964013424	Walker B; other site
31964013425	D-loop; other site
31964013426	H-loop/switch region; other site
31964013428	LanC-like proteins. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthionine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as a precursor peptide and then post-translationally modified to contain...; Region: LanC_like; cl04955
31964013429	active site
31964013430	zinc binding site [ion binding]; other site
31964013431	LabA_like proteins; Region: LabA_like; cd06167
31964013432	putative metal binding site [ion binding]; other site
31964013433	Uncharacterized conserved protein [Function unknown]; Region: COG1432
31964013434	Protein of unknown function (DUF1524); Region: DUF1524; pfam07510
31964013435	Homeodomain-like domain; Region: HTH_23; cl17451
31964013436	Winged helix-turn helix; Region: HTH_29; pfam13551
31964013437	Integrase core domain; Region: rve; pfam00665
31964013438	Integrase core domain; Region: rve_3; pfam13683
31964013439	ATPases associated with a variety of cellular activities; Region: AAA; smart00382
31964013440	Domain of unknown function DUF87; Region: DUF87; pfam01935
31964013441	HerA helicase [Replication, recombination, and repair]; Region: COG0433
31964013442	Site-specific DNA methylase [DNA replication, recombination, and repair]; Region: Dcm; COG0270
31964013443	Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology. Cytosine-specific DNA methylases are found both in prokaryotes and eukaryotes. DNA methylation, or the covalent addition of a methyl group...; Region: Cyt_C5_DNA_methylase; cd00315
31964013444	cofactor binding site; other site
31964013445	DNA binding site [nucleotide binding]
31964013446	substrate interaction site [chemical binding]; other site
31964013447	FtsK/SpoIIIE family; Region: FtsK_SpoIIIE; pfam01580
31964013448	Domain of unknown function (DUF4326); Region: DUF4326; pfam14216
31964013449	Protein of unknown function (DUF1524); Region: DUF1524; pfam07510
31964013450	leucine-zipper of insertion element IS481; Region: LZ_Tnp_IS481; pfam13011
31964013451	Winged helix-turn helix; Region: HTH_29; pfam13551
31964013452	Integrase core domain; Region: rve; pfam00665
31964013453	Integrase core domain; Region: rve_3; pfam13683
31964013454	Protein of unknown function (DUF3800); Region: DUF3800; pfam12686
31964013455	Divergent AAA domain; Region: AAA_4; pfam04326
31964013456	Type II secretory pathway, prepilin signal peptidase PulO and related peptidases [Cell motility and secretion / Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion]; Region: PulO; COG1989
31964013457	Type IV leader peptidase family; Region: Peptidase_A24; pfam01478
31964013458	Lysine Motif is a small domain involved in binding peptidoglycan; Region: LysM; cd00118
31964013459	Bacterial transcriptional activator domain; Region: BTAD; smart01043
31964013460	Type II secretion system (T2SS), protein F; Region: T2SF; pfam00482
31964013461	Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion]; Region: CpaF; COG4962
31964013462	RecA-like NTPases. This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and...; Region: RecA-like_NTPases; cl17233
31964013463	Walker A motif; other site
31964013464	ATP binding site [chemical binding]; other site
31964013465	Walker B motif; other site
31964013466	SAF domains of the flagella basal body P-ring formation protein FlgA and the flp pilus assembly CpaB; Region: SAF_CpaB_FlgA_like; cd11614
31964013467	Transcriptional regulators [Transcription]; Region: MarR; COG1846
31964013468	Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to...; Region: HTH_ARSR; cd00090
31964013469	dimerization interface [polypeptide binding]; other site
31964013470	putative DNA binding site [nucleotide binding]; other site
31964013471	putative Zn2+ binding site [ion binding]; other site
31964013472	AAA-like domain; Region: AAA_10; pfam12846
31964013473	Cell wall-associated hydrolases (invasion-associated proteins) [Cell envelope biogenesis, outer membrane]; Region: Spr; COG0791
31964013474	NlpC/P60 family; Region: NLPC_P60; cl17555
31964013475	FtsK/SpoIIIE family; Region: FtsK_SpoIIIE; pfam01580
31964013476	Respiratory-chain NADH dehydrogenase 24 Kd subunit; Region: Complex1_24kDa; pfam01257
31964013477	ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the...; Region: ParA; cd02042
31964013478	CobQ/CobB/MinD/ParA nucleotide binding domain; Region: CbiA; pfam01656
31964013479	P-loop; other site
31964013480	Magnesium ion binding site [ion binding]; other site
31964013481	HD domain; Region: HD_4; pfam13328
31964013482	RelA- and SpoT-like ppGpp Synthetases and Hydrolases, catalytic domain; Region: Rel-Spo_like; cl11966
31964013483	metal binding triad [ion binding]; metal-binding site
31964013484	Prophage CP4-57 regulatory protein (AlpA); Region: Phage_AlpA; cl17523
31964013485	Helix-turn-helix XRE-family like proteins; Region: HTH_XRE; smart00530
31964013486	sequence-specific DNA binding site [nucleotide binding]; other site
31964013487	salt bridge; other site
31964013488	Domain of unknown function (DUF3846); Region: DUF3846; pfam12957
31964013489	Trypsin-like peptidase domain; Region: Trypsin_2; pfam13365
31964013490	VbhA antitoxin and related proteins; Region: VbhA_like; cd11586
31964013491	VbhA antitoxin and related proteins; Region: VbhA_like; cd11586