-- dump date   	20140620_001442
-- class       	Genbank::misc_feature
-- table       	misc_feature_note
-- id	note
529507000001	bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional; Region: thrA; PRK09436
529507000002	AAK_AK-HSDH: Amino Acid Kinase Superfamily (AAK), AK-HSDH; this CD includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK - homoserine dehydrogenase (HSDH). These aspartokinases are found in bacteria (E. coli...; Region: AAK_AK-HSDH; cd04257
529507000003	putative catalytic residues [active]
529507000004	putative nucleotide binding site [chemical binding]; other site
529507000005	putative aspartate binding site [chemical binding]; other site
529507000006	ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH); Region: ACT_AKi-HSDH-ThrA-like_1; cd04921
529507000007	dimer interface [polypeptide binding]; other site
529507000008	putative threonine allosteric regulatory site; other site
529507000009	ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH); Region: ACT_AKi-HSDH-ThrA_2; cd04922
529507000010	putative threonine allosteric regulatory site; other site
529507000011	Homoserine dehydrogenase, NAD binding domain; Region: NAD_binding_3; pfam03447
529507000012	Homoserine dehydrogenase; Region: Homoserine_dh; pfam00742
529507000013	HMMPfam hit to PF00696, amino acid kinase family, score 1.3e-58
529507000014	PS00324 aspartokinase signature.
529507000015	HMMPfam hit to PF01842, ACT domain, score 3.8e-10
529507000016	HMMPfam hit to PF01842, ACT domain, score 0.0001
529507000017	HMMPfam hit to PF03447, homoserine dehydrogenase, NAD binding d, score 7.5e-51
529507000018	HMMPfam hit to PF00742, homoserine dehydrogenase, score 8.9e-93
529507000019	PS00017 ATP/GTP-binding site motif A (P-loop).
529507000020	PS01042 homoserine dehydrogenase signature.
529507000021	homoserine kinase; Provisional; Region: PRK01212
529507000022	GHMP kinases N terminal domain; Region: GHMP_kinases_N; pfam00288
529507000023	GHMP kinases C terminal; Region: GHMP_kinases_C; pfam08544
529507000024	HMMPfam hit to PF00288, GHMP kinases ATP-binding protei, score 2.5e-36
529507000025	PS00627 GHMP kinases ATP-binding domain.
529507000026	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507000027	Threonine synthase [Amino acid transport and metabolism]; Region: ThrC; COG0498
529507000028	Threonine synthase catalyzes the final step of threonine biosynthesis. The conversion of O-phosphohomoserine into threonine and inorganic phosphate is pyridoxal 5'-phosphate dependent. The Thr-synth_1 CD includes members from higher plants; Region: Thr-synth_2; cd01560
529507000029	pyridoxal 5'-phosphate binding site [chemical binding]; other site
529507000030	catalytic residue [active]
529507000031	HMMPfam hit to PF00291, Pyridoxal-phosphate dependent enzyme, score 5.7e-30
529507000032	PS00165 Serine/threonine dehydratases pyridoxal-phosphate attachment site.
529507000033	RTX toxins and related Ca2+-binding proteins [Secondary metabolites biosynthesis, transport, and catabolism]; Region: COG2931
529507000034	PS00141 Eukaryotic and viral aspartyl proteases active site.
529507000035	2 probable transmembrane helices predicted for PMI0004 by TMHMM2.0 at aa 1705-1727 and 1732-1754
529507000036	HMMPfam hit to PF00353, Hemolysin-type calcium-binding repeat, score 5.6
529507000037	HMMPfam hit to PF00353, Hemolysin-type calcium-binding repeat, score 6.2
529507000038	HMMPfam hit to PF00353, Hemolysin-type calcium-binding repeat, score 0.072
529507000039	HMMPfam hit to PF00353, Hemolysin-type calcium-binding repeat, score 2.4
529507000040	HMMPfam hit to PF00353, Hemolysin-type calcium-binding repeat, score 0.011
529507000041	HMMPfam hit to PF00353, Hemolysin-type calcium-binding repeat, score 0.48
529507000042	hypothetical protein; Validated; Region: PRK02101
529507000043	HMMPfam hit to PF03883, Protein of unknown function (DUF328), score 3.4e-167
529507000044	transaldolase-like protein; Provisional; Region: PTZ00411
529507000045	Transaldolases including both TalA and TalB; Region: Transaldolase_TalAB; cd00957
529507000046	active site
529507000047	dimer interface [polypeptide binding]; other site
529507000048	catalytic residue [active]
529507000049	HMMPfam hit to PF00923, Transaldolase, score 2.5e-174
529507000050	PS01054 Transaldolase signature 1.
529507000051	PS00958 Transaldolase active site.
529507000052	FOG: TPR repeat, SEL1 subfamily [General function prediction only]; Region: COG0790
529507000053	Sel1-like repeats; Region: SEL1; smart00671
529507000054	Sel1-like repeats; Region: SEL1; smart00671
529507000055	Sel1-like repeats; Region: SEL1; smart00671
529507000056	Sel1-like repeats; Region: SEL1; smart00671
529507000057	Sel1-like repeats; Region: SEL1; smart00671
529507000058	Sel1-like repeats; Region: SEL1; smart00671
529507000059	Sel1-like repeats; Region: SEL1; smart00671
529507000060	Signal peptide predicted for PMI0007 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.975 between residues 21 and 22
529507000061	MogA_MoaB family. Members of this family are involved in biosynthesis of the molybdenum cofactor (MoCF) an essential cofactor of a diverse group of redox enzymes. MoCF biosynthesis is an evolutionarily conserved pathway present in eubacteria, archaea; Region: MogA_MoaB; cd00886
529507000062	MPT binding site; other site
529507000063	trimer interface [polypeptide binding]; other site
529507000064	HMMPfam hit to PF00994, Probable molybdopterin binding domain, score 4.5e-41
529507000065	PS01078 Molybdenum cofactor biosynthesis proteins signature 1.
529507000066	molecular chaperone DnaK; Provisional; Region: dnaK; PRK00290
529507000067	Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily; Region: NBD_sugar-kinase_HSP70_actin; cl17037
529507000068	nucleotide binding site [chemical binding]; other site
529507000069	HMMPfam hit to PF00012, Hsp70 protein, score 0
529507000070	PS00297 Heat shock hsp70 proteins family signature 1.
529507000071	PS00329 Heat shock hsp70 proteins family signature 2.
529507000072	PS01036 Heat shock hsp70 proteins family signature 3.
529507000073	chaperone protein DnaJ; Provisional; Region: PRK10767
529507000074	DnaJ domain or J-domain.  DnaJ/Hsp40 (heat shock protein 40) proteins are highly conserved and play crucial roles in protein translation, folding, unfolding, translocation, and degradation. They act primarily by stimulating the ATPase activity of Hsp70s; Region: DnaJ; cd06257
529507000075	HSP70 interaction site [polypeptide binding]; other site
529507000076	C-terminal substrate binding domain of DnaJ and HSP40; Region: DnaJ_C; cl03262
529507000077	substrate binding site [polypeptide binding]; other site
529507000078	Zinc finger domain of DnaJ and HSP40; Region: DnaJ_zf; cd10719
529507000079	Zn binding sites [ion binding]; other site
529507000080	C-terminal substrate binding domain of DnaJ and HSP40; Region: DnaJ_C; cd10747
529507000081	dimer interface [polypeptide binding]; other site
529507000082	HMMPfam hit to PF00226, DnaJ domain, score 7.5e-41
529507000083	PS00636 Nt-dnaJ domain signature.
529507000084	HMMPfam hit to PF00684, DnaJ central domain (4 repeats), score 1.4e-41
529507000085	PS00637 CXXCXGXG dnaJ domain signature.
529507000086	PS00190 Cytochrome c family heme-binding site signature.
529507000087	PS00190 Cytochrome c family heme-binding site signature.
529507000088	PS00190 Cytochrome c family heme-binding site signature.
529507000089	HMMPfam hit to PF01556, DnaJ C terminal region, score 1.2e-77
529507000090	pH-dependent sodium/proton antiporter; Reviewed; Region: nhaA; PRK09561
529507000091	Signal peptide predicted for PMI0011 by SignalP 2.0 HMM (Signal peptide probability 0.952) with cleavage site probability 0.719 between residues 30 and 31
529507000092	HMMPfam hit to PF06965, Na+/H+ antiporter, score 3.9e-234
529507000093	11 probable transmembrane helices predicted for PMI0011 by TMHMM2.0 at aa 16-38, 58-77, 94-116, 126-145, 152-174, 179-199, 206-237, 257-279, 286-308, 328-350 and 363-385
529507000094	transcriptional activator NhaR; Provisional; Region: nhaR; PRK11062
529507000095	Bacterial regulatory helix-turn-helix protein, lysR family; Region: HTH_1; pfam00126
529507000096	The C-terminal substrate binding domain of LysR-type transcriptional activator of the nhaA gene, encoding Na+/H+ antiporter, contains the type 2 periplasmic binding fold; Region: PBP2_NhaR; cd08429
529507000097	putative dimerization interface [polypeptide binding]; other site
529507000098	HMMPfam hit to PF00126, Bacterial regulatory helix-turn-helix protei, score 5.7e-19
529507000099	PS00044 Bacterial regulatory proteins, lysR family signature.
529507000100	30S ribosomal protein S20; Reviewed; Region: rpsT; PRK00239
529507000101	HMMPfam hit to PF01649, Ribosomal protein S20, score 4.7e-44
529507000102	bifunctional riboflavin kinase/FMN adenylyltransferase; Reviewed; Region: PRK05627
529507000103	FAD synthetase, N-terminal domain of the bifunctional enzyme; Region: FAD_synthetase_N; cd02064
529507000104	active site
529507000105	Riboflavin kinase; Region: Flavokinase; smart00904
529507000106	HMMPfam hit to PF06574, Riboflavin kinase (Flavokinase), score 3.3e-92
529507000107	HMMPfam hit to PF01687, Riboflavin kinase / FAD synthetase, score 2.7e-60
529507000108	isoleucyl-tRNA synthetase; Reviewed; Region: ileS; PRK05743
529507000109	nucleotidyl transferase superfamily; Region: nt_trans; cl00015
529507000110	active site
529507000111	HIGH motif; other site
529507000112	nucleotide binding site [chemical binding]; other site
529507000113	Leucyl-tRNA synthetase, Domain 2; Region: tRNA-synt_1_2; pfam13603
529507000114	catalytic core domain of isoleucyl-tRNA synthetases; Region: IleRS_core; cd00818
529507000115	active site
529507000116	KMSKS motif; other site
529507000117	Anticodon-binding domain of bacterial and eukaryotic mitochondrial isoleucyl tRNA synthetases; Region: Anticodon_Ia_Ile_BEm; cd07960
529507000118	tRNA binding surface [nucleotide binding]; other site
529507000119	anticodon binding site; other site
529507000120	Zinc finger found in FPG and IleRS; Region: zf-FPG_IleRS; pfam06827
529507000121	HMMPfam hit to PF00133, tRNA synthetases class I (I, L, M and V), score 0
529507000122	PS00178 Aminoacyl-transfer RNA synthetases class-I signature.
529507000123	HMMPfam hit to PF06827, Zinc finger found in FPG and IleRS, score 1.6e-13
529507000124	lipoprotein signal peptidase; Reviewed; Region: lspA; PRK00376
529507000125	lipoprotein signal peptidase; Provisional; Region: PRK14787
529507000126	HMMPfam hit to PF01252, Signal peptidase (SPase) II, score 2.7e-75
529507000127	4 probable transmembrane helices predicted for PMI0016 by TMHMM2.0 at aa 13-35, 68-87, 100-122 and 137-159
529507000128	PS00327 Bacterial rhodopsins retinal binding site.
529507000129	FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional; Region: PRK15095
529507000130	FKBP-type peptidyl-prolyl cis-trans isomerase; Region: FKBP_C; pfam00254
529507000131	HMMPfam hit to PF00254, FKBP-type peptidyl-prolyl cis-trans isomeras, score 9.4e-05
529507000132	PS00453 FKBP-type peptidyl-prolyl cis-trans isomerase signature 1.
529507000133	4-hydroxy-3-methylbut-2-enyl diphosphate reductase; Reviewed; Region: ispH; PRK01045
529507000134	4-Hydroxy-3-methylbut-2-enyl diphosphate reductase IspH [Lipid metabolism]; Region: lytB; COG0761
529507000135	HMMPfam hit to PF02401, LytB protein, score 1e-177
529507000136	Dihydrodipicolinate reductase [Amino acid transport and metabolism]; Region: DapB; COG0289
529507000137	Dihydrodipicolinate reductase, N-terminus; Region: DapB_N; pfam01113
529507000138	Dihydrodipicolinate reductase, C-terminus; Region: DapB_C; pfam05173
529507000139	HMMPfam hit to PF01113, Dihydrodipicolinate reductase, N-terminus, score 2.8e-58
529507000140	HMMPfam hit to PF05173, Dihydrodipicolinate reductase, C-terminus, score 2e-77
529507000141	PS01298 Dihydrodipicolinate reductase signature.
529507000142	carbamoyl phosphate synthase small subunit; Reviewed; Region: PRK12564
529507000143	Carbamoyl-phosphate synthase small chain, CPSase domain; Region: CPSase_sm_chain; smart01097
529507000144	Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II; Region: GATase1_CPSase; cd01744
529507000145	catalytic site [active]
529507000146	subunit interface [polypeptide binding]; other site
529507000147	HMMPfam hit to PF00988, Carbamoyl-phosphate synthase small ch, score 1.1e-91
529507000148	HMMPfam hit to PF00117, Glutamine amidotransferase class-I, score 1.8e-75
529507000149	PS00442 Glutamine amidotransferases class-I active site.
529507000150	carbamoyl phosphate synthase large subunit; Reviewed; Region: carB; PRK05294
529507000151	Carbamoyl-phosphate synthase L chain, N-terminal domain; Region: CPSase_L_chain; pfam00289
529507000152	Carbamoyl-phosphate synthase L chain, ATP binding domain; Region: CPSase_L_D2; pfam02786
529507000153	Carbamoyl-phosphate synthetase large chain, oligomerisation domain; Region: CPSase_L_D3; pfam02787
529507000154	Carbamoyl-phosphate synthase L chain, N-terminal domain; Region: CPSase_L_chain; pfam00289
529507000155	ATP-grasp domain; Region: ATP-grasp_4; cl17255
529507000156	Methylglyoxal synthase-like domain from type II glutamine-dependent carbamoyl phosphate synthetase (CSP). CSP, a CarA and CarB heterodimer, catalyzes the production of carbamoyl phosphate which is subsequently employed in the metabolic pathways...; Region: MGS_CPS_II; cd01424
529507000157	IMP binding site; other site
529507000158	dimer interface [polypeptide binding]; other site
529507000159	interdomain contacts; other site
529507000160	partial ornithine binding site; other site
529507000161	Signal peptide predicted for PMI0021 by SignalP 2.0 HMM (Signal peptide probability 0.936) with cleavage site probability 0.838 between residues 26 and 27
529507000162	HMMPfam hit to PF00289, Carbamoyl-phosphate synthase L chain,, score 4e-63
529507000163	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507000164	HMMPfam hit to PF02786, Carbamoyl-phosphate synthase L chain,, score 7.5e-135
529507000165	PS00866 Carbamoyl-phosphate synthase subdomain signature 1.
529507000166	PS00867 Carbamoyl-phosphate synthase subdomain signature 2.
529507000167	HMMPfam hit to PF02787, Carbamoyl-phosphate synthetase large c, score 9.9e-68
529507000168	HMMPfam hit to PF00289, Carbamoyl-phosphate synthase L chain,, score 1.1e-26
529507000169	HMMPfam hit to PF02786, Carbamoyl-phosphate synthase L chain,, score 9.3e-29
529507000170	PS00866 Carbamoyl-phosphate synthase subdomain signature 1.
529507000171	PS00867 Carbamoyl-phosphate synthase subdomain signature 2.
529507000172	HMMPfam hit to PF02142, MGS-like domain, score 1.6e-32
529507000173	Hok/gef family; Region: HOK_GEF; pfam01848
529507000174	HMMPfam hit to PF01848, Hok/gef family, score 2.3e-07
529507000175	1 probable transmembrane helix predicted for PMI0022 by TMHMM2.0 at aa 4-23
529507000176	Lysine Motif is a small domain involved in binding peptidoglycan; Region: LysM; cd00118
529507000177	Protein of unknown function (DUF3442); Region: DUF3442; pfam11924
529507000178	Bacterial Ig-like domain (group 1); Region: Big_1; cl17740
529507000179	Bacterial Ig-like domain (group 1); Region: BID_1; smart00634
529507000180	Bacterial Ig-like domain (group 1); Region: BID_1; smart00634
529507000181	Bacterial Ig-like domain (group 1); Region: BID_1; smart00634
529507000182	Bacterial Ig-like domain (group 1); Region: Big_1; cl17740
529507000183	Bacterial Ig-like domain (group 1); Region: BID_1; smart00634
529507000184	Bacterial Ig-like domain (group 1); Region: Big_1; cl17740
529507000185	Bacterial Ig-like domain (group 1); Region: Big_1; cl17740
529507000186	HMMPfam hit to PF02369, Bacterial Ig-like domain (group 1), score 0.00024
529507000187	HMMPfam hit to PF02369, Bacterial Ig-like domain (group 1), score 2.6e-07
529507000188	HMMPfam hit to PF02369, Bacterial Ig-like domain (group 1), score 4.2e-07
529507000189	HMMPfam hit to PF02369, Bacterial Ig-like domain (group 1), score 2.8e-07
529507000190	HMMPfam hit to PF02369, Bacterial Ig-like domain (group 1), score 1.4e-08
529507000191	HMMPfam hit to PF02369, Bacterial Ig-like domain (group 1), score 1.9e-09
529507000192	HMMPfam hit to PF02369, Bacterial Ig-like domain (group 1), score 1.1e-07
529507000193	Predicted helix-turn-helix motif with score 1048.000, SD 2.76 at aa 154-175, sequence VTQYAISQISSKSNQKIEQWLN
529507000194	HMMPfam hit to PF01476, LysM domain, score 0.00023
529507000195	Signal peptide predicted for PMI0023 by SignalP 2.0 HMM (Signal peptide probability 0.947) with cleavage site probability 0.946 between residues 46 and 47
529507000196	Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols. AKRs are present in all phyla and are of importance to both health and industrial...; Region: Aldo_ket_red; cd06660
529507000197	Aldo/keto reductase family; Region: Aldo_ket_red; pfam00248
529507000198	active site
529507000199	catalytic tetrad [active]
529507000200	HMMPfam hit to PF00248, Aldo/keto reductase family, score 2.6e-127
529507000201	PS00063 Aldo/keto reductase family active site signature.
529507000202	PS00062 Aldo/keto reductase family signature 2.
529507000203	PS00798 Aldo/keto reductase family signature 1.
529507000204	Uncharacterized oxidoreductases, Fe-dependent alcohol dehydrogenase family [Energy production and conversion]; Region: COG1979
529507000205	Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process; Region: BDH; cd08187
529507000206	dimer interface [polypeptide binding]; other site
529507000207	active site
529507000208	metal binding site [ion binding]; metal-binding site
529507000209	HMMPfam hit to PF00465, Iron-containing alcohol dehydrogenase, score 2.7e-35
529507000210	PS00060 Iron-containing alcohol dehydrogenases signature 2.
529507000211	PS00913 Iron-containing alcohol dehydrogenases signature 1.
529507000212	PS00343 Gram-positive cocci surface proteins 'anchoring' hexapeptide.
529507000213	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
529507000214	S-adenosylmethionine binding site [chemical binding]; other site
529507000215	Uncharacterized membrane-associated protein [Function unknown]; Region: DedA; COG0586
529507000216	SNARE associated Golgi protein; Region: SNARE_assoc; cl00429
529507000217	5 probable transmembrane helices predicted for PMI0027 by TMHMM2.0 at aa 30-52, 72-94, 129-151, 161-183 and 196-218
529507000218	HMMPfam hit to PF00597, DedA family, score 5.9e-42
529507000219	cystathionine beta-lyase; Provisional; Region: PRK08114
529507000220	CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis. This pathway is unique to microorganisms and plants, rendering the enzyme an attractive target for the development of...; Region: CGS_like; cd00614
529507000221	homodimer interface [polypeptide binding]; other site
529507000222	substrate-cofactor binding pocket; other site
529507000223	pyridoxal 5'-phosphate binding site [chemical binding]; other site
529507000224	catalytic residue [active]
529507000225	HMMPfam hit to PF01053, Cys/Met metabolism PLP-dependent enzy, score 2.7e-134
529507000226	PS00868 Cys/Met metabolism enzymes pyridoxal-phosphate attachment site.
529507000227	MotA/TolQ/ExbB proton channel family; Region: MotA_ExbB; cl00568
529507000228	Signal peptide predicted for PMI0029 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 1.000 between residues 20 and 21
529507000229	3 probable transmembrane helices predicted for PMI0029 by TMHMM2.0 at aa 130-152, 235-257 and 281-303
529507000230	HMMPfam hit to PF01618, MotA/TolQ/ExbB proton channel family, score 7.7e-50
529507000231	Biopolymer transport protein ExbD/TolR; Region: ExbD; cl00537
529507000232	Biopolymer transport protein [Intracellular trafficking and secretion]; Region: ExbD; COG0848
529507000233	HMMPfam hit to PF02472, Biopolymer transport protein ExbD/TolR, score 2.4e-20
529507000234	1 probable transmembrane helix predicted for PMI0030 by TMHMM2.0 at aa 20-42
529507000235	hydrogenase 2 small subunit; Provisional; Region: PRK10468
529507000236	Tat (twin-arginine translocation) pathway signal sequence; Region: TAT_signal_seq; TIGR01409
529507000237	NADH ubiquinone oxidoreductase, 20 Kd subunit; Region: Oxidored_q6; pfam01058
529507000238	Signal peptide predicted for PMI0031 by SignalP 2.0 HMM (Signal peptide probability 0.994) with cleavage site probability 0.832 between residues 37 and 38
529507000239	HMMPfam hit to PF01058, NADH ubiquinone oxidoreductase, 20 Kd sub, score 1.8e-05
529507000240	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507000241	1 probable transmembrane helix predicted for PMI0031 by TMHMM2.0 at aa 334-356
529507000242	hydrogenase 2 protein HybA; Provisional; Region: PRK10882
529507000243	4Fe-4S binding domain; Region: Fer4; cl02805
529507000244	Signal peptide predicted for PMI0032 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.983 between residues 26 and 27
529507000245	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 0.008
529507000246	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 9.3e-05
529507000247	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
529507000248	putative hydrogenase 2 b cytochrome subunit; Provisional; Region: PRK10881
529507000249	Polysulphide reductase, NrfD; Region: NrfD; pfam03916
529507000250	10 probable transmembrane helices predicted for PMI0033 by TMHMM2.0 at aa 13-32, 52-74, 87-109, 131-153, 174-196, 211-233, 246-268, 283-302, 315-337 and 352-374
529507000251	hydrogenase 2 large subunit; Provisional; Region: PRK10467
529507000252	Ni,Fe-hydrogenase I large subunit [Energy production and conversion]; Region: HyaB; COG0374
529507000253	HMMPfam hit to PF00374, Nickel-dependent hydrogenase, score 1e-263
529507000254	PS00507 Nickel-dependent hydrogenases large subunit signature 1.
529507000255	PS00508 Nickel-dependent hydrogenases large subunit signature 2.
529507000256	Endopeptidases belonging to membrane-bound hydrogenases group. These hydrogenases transfer electrons from H2 to a cytochrome that is bound to a membrane-located complex coupling electron transfer to transmembrane proton translocation. Endopeptidase HybD...; Region: H2MP_MemB-H2up; cd06062
529507000257	putative substrate-binding site; other site
529507000258	nickel binding site [ion binding]; other site
529507000259	HMMPfam hit to PF01750, Hydrogenase maturation protease, score 5.1e-36
529507000260	hydrogenase 2-specific chaperone; Provisional; Region: PRK10465
529507000261	The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain. Functionally, proteins in this superfamily use the energy from hydrolysis of NTP to transfer electron or ion; Region: Fer4_NifH; cl17203
529507000262	The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain. Functionally, proteins in this superfamily use the energy from hydrolysis of NTP to transfer electron or ion; Region: Fer4_NifH; cl17203
529507000263	HMMPfam hit to PF02492, CobW/HypB/UreG, nucleotide-binding domain, score 1.3e-71
529507000264	hydrogenase 2 accessory protein HypG; Provisional; Region: PRK10413
529507000265	HMMPfam hit to PF01455, HupF/HypC family, score 2.3e-28
529507000266	PS01097 Hydrogenases expression/synthesis hupF/hypC family signature.
529507000267	hydrogenase isoenzymes formation protein HypD; Provisional; Region: PRK15062
529507000268	hydrogenase expression/formation protein HypD; Region: hypD; TIGR00075
529507000269	HMMPfam hit to PF01924, Hydrogenase formation hypA family, score 2.1e-224
529507000270	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507000271	HypE (Hydrogenase expression/formation protein). HypE is involved in Ni-Fe hydrogenase biosynthesis.  HypE dehydrates its own carbamoyl moiety in an ATP-dependent process to yield the enzyme thiocyanate. The N-terminal domain of HypE is related to the...; Region: HypE; cd02197
529507000272	dimerization interface [polypeptide binding]; other site
529507000273	hydrogenase expression/formation protein HypE; Region: hypE; TIGR02124
529507000274	ATP binding site [chemical binding]; other site
529507000275	HMMPfam hit to PF00586, AIR synthase related protein, N-terminal dom, score 7e-40
529507000276	HMMPfam hit to PF02769, AIR synthase related protein, C-terminal dom, score 7.6e-35
529507000277	putative inner membrane protein; Provisional; Region: PRK11099
529507000278	Sulphur transport; Region: Sulf_transp; pfam04143
529507000279	Signal peptide predicted for PMI0041 by SignalP 2.0 HMM (Signal peptide probability 0.898) with cleavage site probability 0.446 between residues 33 and 34
529507000280	10 probable transmembrane helices predicted for PMI0041 by TMHMM2.0 at aa 21-43, 81-103, 116-138, 148-170, 197-216, 221-238, 259-281, 286-308, 321-341 and 361-383
529507000281	HMMPfam hit to PF04143, YeeE/YedE family (DUF395), score 9.7e-20
529507000282	HMMPfam hit to PF04143, YeeE/YedE family (DUF395), score 3.9e-22
529507000283	YedF is a bacterial SirA-like protein of unknown function.  SirA  (also known as UvrY,  and YhhP) belongs to a family of a two-component response regulators that controls secondary metabolism and virulence. The other member of this two-component system...; Region: YedF; cd03422
529507000284	CPxP  motif; other site
529507000285	HMMPfam hit to PF01206, SirA-like protein, score 5.2e-41
529507000286	PS01148 Uncharacterized protein family UPF0033 signature.
529507000287	recombination associated protein; Reviewed; Region: rdgC; PRK00321
529507000288	HMMPfam hit to PF04381, exonuclease, RdgC, score 4.7e-187
529507000289	Outer membrane protein (porin) [Cell envelope biogenesis, outer membrane]; Region: OmpC; COG3203
529507000290	Porins form aqueous channels for the diffusion of small hydrophillic molecules across the outer membrane. Individual 16-strand anti-parallel beta-barrels form a central pore, and trimerizes thru mainly hydrophobic interactions at the interface. Trimers...; Region: gram_neg_porins; cd00342
529507000291	eyelet of channel; other site
529507000292	trimer interface [polypeptide binding]; other site
529507000293	Signal peptide predicted for PMI0044 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.997 between residues 27 and 28
529507000294	bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase periplasmic precursor protein; Reviewed; Region: cpdB; PRK09420
529507000295	Escherichia coli CpdB and related proteins, N-terminal metallophosphatase domain; Region: MPP_CpdB_N; cd07410
529507000296	active site
529507000297	metal binding site [ion binding]; metal-binding site
529507000298	5'-nucleotidase, C-terminal domain; Region: 5_nucleotid_C; pfam02872
529507000299	Signal peptide predicted for PMI0045 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.990 between residues 21 and 22
529507000300	HMMPfam hit to PF00149, Calcineurin-like phosphoesterase, score 8.4e-18
529507000301	PS00785 5'-nucleotidase signature 1.
529507000302	HMMPfam hit to PF02872, 5'-nucleotidase, C-terminal domain, score 1.5e-56
529507000303	Ribonuclease T2 (RNase T2) is a widespread family of secreted RNases found in every organism examined thus far.  This family includes RNase Rh, RNase MC1, RNase LE, and self-incompatibility RNases (S-RNases).  Plant T2 RNases are expressed during leaf...; Region: RNase_T2; cl00208
529507000304	CAS motifs; other site
529507000305	active site
529507000306	Signal peptide predicted for PMI0046 by SignalP 2.0 HMM (Signal peptide probability 0.997) with cleavage site probability 0.596 between residues 21 and 22
529507000307	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507000308	PS00017 ATP/GTP-binding site motif A (P-loop).
529507000309	PS00531 Ribonuclease T2 family histidine active site 2.
529507000310	5'-nucleotidase/2',3'-cyclic phosphodiesterase and related esterases [Nucleotide transport and metabolism]; Region: UshA; COG0737
529507000311	Bacillus subtilis YhcR endonuclease and related proteins, N-terminal metallophosphatase domain; Region: MPP_YhcR_N; cd07412
529507000312	putative active site [active]
529507000313	putative metal binding site [ion binding]; other site
529507000314	5'-nucleotidase, C-terminal domain; Region: 5_nucleotid_C; pfam02872
529507000315	Signal peptide predicted for PMI0047 by SignalP 2.0 HMM (Signal peptide probability 0.992) with cleavage site probability 0.615 between residues 23 and 24
529507000316	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507000317	HMMPfam hit to PF00149, Calcineurin-like phosphoesterase, score 2.1e-11
529507000318	HMMPfam hit to PF02872, 5'-nucleotidase, C-terminal domain, score 3.9e-41
529507000319	Nitroreductase-like family 4.  A subfamily of the nitroreductase family containing uncharacterized proteins that are similar to nitroreductase. Nitroreductase catalyzes the reduction of nitroaromatic compounds such as nitrotoluenes, nitrofurans and...; Region: Nitroreductase_4; cd02140
529507000320	dimer interface [polypeptide binding]; other site
529507000321	FMN binding site [chemical binding]; other site
529507000322	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
529507000323	AAA domain; Region: AAA_23; pfam13476
529507000324	Walker A/P-loop; other site
529507000325	ATP binding site [chemical binding]; other site
529507000326	Q-loop/lid; other site
529507000327	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
529507000328	ABC transporter signature motif; other site
529507000329	Walker B; other site
529507000330	D-loop; other site
529507000331	H-loop/switch region; other site
529507000332	HMMPfam hit to PF00904, no description, score 1.9e+02
529507000333	HMMPfam hit to PF00904, no description, score 3.7e+02
529507000334	HMMPfam hit to PF00904, no description, score 1.5e+02
529507000335	Predicted helix-turn-helix motif with score 1072.000, SD 2.84 at aa 762-783, sequence KTYQQQSEHLHQQQQQLAQHIQ
529507000336	HMMPfam hit to PF00904, no description, score 2.9e+02
529507000337	HMMPfam hit to PF00904, no description, score 2.4e+02
529507000338	HMMPfam hit to PF00904, no description, score 1.8e+02
529507000339	HMMPfam hit to PF00904, no description, score 91
529507000340	HMMPfam hit to PF00904, no description, score 1e+02
529507000341	HMMPfam hit to PF00904, no description, score 2.8e+02
529507000342	HMMPfam hit to PF02463, RecF/RecN/SMC N terminal domain, score 2.2e-05
529507000343	PS00017 ATP/GTP-binding site motif A (P-loop).
529507000344	exonuclease subunit SbcD; Provisional; Region: PRK10966
529507000345	Mre11 nuclease, N-terminal metallophosphatase domain; Region: MPP_Mre11_N; cd00840
529507000346	active site
529507000347	metal binding site [ion binding]; metal-binding site
529507000348	DNA binding site [nucleotide binding]
529507000349	Type 5 capsule protein repressor C-terminal domain; Region: SbcD_C; pfam12320
529507000350	HMMPfam hit to PF00149, Calcineurin-like phosphoesterase, score 6.9e-18
529507000351	phosphate regulon transcriptional regulatory protein PhoB; Region: PhoB; TIGR02154
529507000352	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
529507000353	active site
529507000354	phosphorylation site [posttranslational modification]
529507000355	intermolecular recognition site; other site
529507000356	dimerization interface [polypeptide binding]; other site
529507000357	Effector domain of response regulator. Bacteria and certain eukaryotes like protozoa and higher plants use two-component signal transduction systems to detect and respond to changes in the environment. The system consists of a sensor histidine kinase and...; Region: trans_reg_C; cd00383
529507000358	DNA binding site [nucleotide binding]
529507000359	HMMPfam hit to PF00072, Response regulator receiver domain, score 1.5e-35
529507000360	HMMPfam hit to PF00486, Transcriptional regulatory protein, C te, score 2.8e-25
529507000361	phosphate regulon sensor protein; Provisional; Region: phoR; PRK11006
529507000362	Domain of unknown function (DUF3329); Region: DUF3329; pfam11808
529507000363	PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in...; Region: PAS; cd00130
529507000364	putative active site [active]
529507000365	heme pocket [chemical binding]; other site
529507000366	Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via...; Region: HisKA; cd00082
529507000367	dimer interface [polypeptide binding]; other site
529507000368	phosphorylation site [posttranslational modification]
529507000369	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
529507000370	ATP binding site [chemical binding]; other site
529507000371	Mg2+ binding site [ion binding]; other site
529507000372	G-X-G motif; other site
529507000373	Signal peptide predicted for PMI0052 by SignalP 2.0 HMM (Signal peptide probability 0.861) with cleavage site probability 0.777 between residues 23 and 24
529507000374	1 probable transmembrane helix predicted for PMI0052 by TMHMM2.0 at aa 12-34
529507000375	HMMPfam hit to PF00989, PAS domain, score 7.1e-06
529507000376	HMMPfam hit to PF00512, His Kinase A (phosphoacceptor) domain, score 2.7e-25
529507000377	HMMPfam hit to PF02518, Histidine kinase-, DNA gyrase B-, and HSP90, score 4.7e-39
529507000378	Branched-chain amino acid transport protein; Region: Branch_AA_trans; cl00547
529507000379	Signal peptide predicted for PMI0053 by SignalP 2.0 HMM (Signal peptide probability 0.894) with cleavage site probability 0.802 between residues 24 and 25
529507000380	HMMPfam hit to PF05525, Branched-chain amino acid transport p, score 1.8e-215
529507000381	12 probable transmembrane helices predicted for PMI0053 by TMHMM2.0 at aa 13-35, 40-62, 83-105, 120-139, 151-173, 188-210, 223-245, 278-300, 312-334, 339-361, 368-387 and 410-427
529507000382	HipA N-terminal domain; Region: Couple_hipA; pfam13657
529507000383	HipA-like N-terminal domain; Region: HipA_N; pfam07805
529507000384	HipA-like C-terminal domain; Region: HipA_C; pfam07804
529507000385	HMMPfam hit to PF07804, HipA-like C-terminal domain, score 3.7e-25
529507000386	HMMPfam hit to PF07805, HipA-like N-terminal domain, score 6e-06
529507000387	2 probable transmembrane helices predicted for PMI0056 by TMHMM2.0 at aa 63-85 and 149-171
529507000388	2 probable transmembrane helices predicted for PMI0057 by TMHMM2.0 at aa 57-79 and 149-171
529507000389	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507000390	membrane protein (pseudogene);Highly similar to PMI0056, PMI0057, PMI0060, PMI0061, PMI0062 and PMI0063; This CDS contains an in frame TAG stop codon.
529507000391	1 probable transmembrane helix predicted for PMI0059 by TMHMM2.0 at aa 57-79
529507000392	2 probable transmembrane helices predicted for PMI0060 by TMHMM2.0 at aa 57-79 and 144-166
529507000393	2 probable transmembrane helices predicted for PMI0061 by TMHMM2.0 at aa 57-79 and 149-171
529507000394	2 probable transmembrane helices predicted for PMI0062 by TMHMM2.0 at aa 57-79 and 149-171
529507000395	2 probable transmembrane helices predicted for PMI0063 by TMHMM2.0 at aa 57-79 and 150-172
529507000396	Enterobacterial putative membrane protein (DUF943); Region: DUF943; pfam06092
529507000397	HMMPfam hit to PF06092, Enterobacterial membrane protein (D, score 4e-26
529507000398	1 probable transmembrane helix predicted for PMI0064 by TMHMM2.0 at aa 7-26
529507000399	hypothetical protein; Provisional; Region: PRK09946
529507000400	thiosulfate reductase cytochrome B subunit; Provisional; Region: PRK15006
529507000401	Thiosulfate reductase cytochrome B subunit (membrane anchoring protein) [Energy production and conversion]; Region: COG4117
529507000402	HMMPfam hit to PF01292, Cytochrome b561 family, score 0.00014
529507000403	5 probable transmembrane helices predicted for PMI0066 by TMHMM2.0 at aa 31-53, 80-102, 117-139, 187-206 and 221-243
529507000404	cytochrome c nitrite reductase, Fe-S protein; Region: cyt_nit_nrfC; TIGR03149
529507000405	4Fe-4S binding domain; Region: Fer4; cl02805
529507000406	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 9.1e-07
529507000407	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
529507000408	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 0.0011
529507000409	1 probable transmembrane helix predicted for PMI0067 by TMHMM2.0 at aa 7-29
529507000410	Signal peptide predicted for PMI0067 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.954 between residues 27 and 28
529507000411	hypothetical protein; Provisional; Region: PRK09947
529507000412	putative oxidoreductase; Provisional; Region: PRK09849
529507000413	Aldehyde ferredoxin oxidoreductase, N-terminal domain; Region: AFOR_N; pfam02730
529507000414	Aldehyde ferredoxin oxidoreductase, domains 2 & 3; Region: AFOR_C; pfam01314
529507000415	HMMPfam hit to PF01314, Aldehyde ferredoxin oxidoreductase, domains, score 2.2e-201
529507000416	HMMPfam hit to PF02730, Aldehyde ferredoxin oxidoreductase, N-termin, score 6.5e-107
529507000417	hypothetical protein; Provisional; Region: PRK09898
529507000418	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 1.3e-05
529507000419	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
529507000420	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 4.1e-05
529507000421	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
529507000422	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 0.004
529507000423	PS00190 Cytochrome c family heme-binding site signature.
529507000424	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507000425	1 probable transmembrane helix predicted for PMI0071 by TMHMM2.0 at aa 13-32
529507000426	Gamma-glutamyltransferase [Amino acid transport and metabolism]; Region: Ggt; COG0405
529507000427	Gamma-glutamyltranspeptidase; Region: G_glu_transpept; pfam01019
529507000428	HMMPfam hit to PF01019, Gamma-glutamyltranspeptidase, score 2.7e-252
529507000429	PS00462 Gamma-glutamyltranspeptidase signature.
529507000430	peroxidase; Provisional; Region: PRK15000
529507000431	Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides; Region: PRX_Typ2cys; cd03015
529507000432	dimer interface [polypeptide binding]; other site
529507000433	decamer (pentamer of dimers) interface [polypeptide binding]; other site
529507000434	catalytic triad [active]
529507000435	peroxidatic and resolving cysteines [active]
529507000436	HMMPfam hit to PF00578, AhpC/TSA family, score 3.3e-56
529507000437	Protein of unknown function, DUF479; Region: DUF479; cl01203
529507000438	HMMPfam hit to PF04336, Protein of unknown function, DUF479, score 6.2e-79
529507000439	S-adenosylmethionine:tRNA ribosyltransferase-isomerase; Provisional; Region: queA; PRK00147
529507000440	S-adenosylmethionine:tRNA ribosyltransferase-isomerase; Region: queA; TIGR00113
529507000441	HMMPfam hit to PF02547, Queuosine biosynthesis protein, score 1.3e-128
529507000442	queuine tRNA-ribosyltransferase; Provisional; Region: tgt; PRK00112
529507000443	tRNA-guanine family transglycosylase; Region: tgt_general; TIGR00449
529507000444	HMMPfam hit to PF01702, Queuine tRNA-ribosyltransferase, score 3.3e-165
529507000445	preprotein translocase subunit YajC; Validated; Region: yajC; PRK05585
529507000446	HMMPfam hit to PF02699, Preprotein translocase subunit, score 3.2e-43
529507000447	1 probable transmembrane helix predicted for PMI0077 by TMHMM2.0 at aa 20-42
529507000448	SecD export protein N-terminal TM region; Region: SecD-TM1; pfam13721
529507000449	preprotein translocase subunit SecD; Reviewed; Region: secD; PRK05812
529507000450	SecD/SecF GG Motif; Region: Sec_GG; pfam07549
529507000451	protein-export membrane protein, SecD/SecF family; Region: 2A0604s01; TIGR00916
529507000452	Signal peptide predicted for PMI0078 by SignalP 2.0 HMM (Signal peptide probability 0.967) with cleavage site probability 0.549 between residues 24 and 25
529507000453	6 probable transmembrane helices predicted for PMI0078 by TMHMM2.0 at aa 7-29, 450-472, 475-497, 502-524, 548-570 and 580-602
529507000454	HMMPfam hit to PF07549, SecD/SecF GG Motif, score 0.00054
529507000455	HMMPfam hit to PF02355, Protein export membrane protein, score 1.6e-06
529507000456	preprotein translocase subunit SecF; Reviewed; Region: secF; PRK13022
529507000457	SecD/SecF GG Motif; Region: Sec_GG; pfam07549
529507000458	Protein export membrane protein; Region: SecD_SecF; pfam02355
529507000459	6 probable transmembrane helices predicted for PMI0079 by TMHMM2.0 at aa 39-58, 157-176, 183-205, 209-231, 262-284 and 289-311
529507000460	HMMPfam hit to PF07549, SecD/SecF GG Motif, score 8.4e-06
529507000461	HMMPfam hit to PF02355, Protein export membrane protein, score 3.2e-96
529507000462	PS00120 Lipases, serine active site.
529507000463	transcriptional regulator NrdR; Validated; Region: nrdR; PRK00464
529507000464	ATP cone domain; Region: ATP-cone; pfam03477
529507000465	PS00190 Cytochrome c family heme-binding site signature.
529507000466	HMMPfam hit to PF03477, ATP cone domain, score 1.2e-31
529507000467	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase; Provisional; Region: ribD; PRK10786
529507000468	Riboflavin-specific deaminase. Riboflavin biosynthesis protein RibD (Diaminohydroxyphosphoribosylaminopyrimidine deaminase) catalyzes the deamination of 2,5-diamino-6-ribosylamino-4(3H)-pyrimidinone 5'-phosphate, which is an intermediate step in the...; Region: Riboflavin_deaminase-reductase; cd01284
529507000469	catalytic motif [active]
529507000470	Zn binding site [ion binding]; other site
529507000471	RibD C-terminal domain; Region: RibD_C; cl17279
529507000472	HMMPfam hit to PF00383, Cytidine and deoxycytidylate deaminase, score 4.3e-45
529507000473	PS00903 Cytidine and deoxycytidylate deaminases zinc-binding region signature.
529507000474	HMMPfam hit to PF01872, RibD C-terminal domain, score 8.3e-60
529507000475	PS00017 ATP/GTP-binding site motif A (P-loop).
529507000476	lumazine synthase (6,7-dimethyl-8-ribityllumazine synthase, LS), catalyzes the penultimate step in the biosynthesis of riboflavin (vitamin B2); type-I; Region: Lumazine_synthase-I; cd09209
529507000477	homopentamer interface [polypeptide binding]; other site
529507000478	active site
529507000479	HMMPfam hit to PF00885, 6,7-dimethyl-8-ribityllumazine synthase, score 3.8e-88
529507000480	Transcription termination factor NusB (N protein-Utilization Substance B). NusB plays a key role in the regulation of ribosomal RNA biosynthesis in eubacteria by modulating the efficiency of transcriptional antitermination. NusB along with other Nus...; Region: Terminator_NusB; cd00619
529507000481	putative RNA binding site [nucleotide binding]; other site
529507000482	HMMPfam hit to PF01029, NusB family, score 4.6e-45
529507000483	thiamine monophosphate kinase; Provisional; Region: PRK05731
529507000484	ThiL (Thiamine-monophosphate kinase) plays a dual role in de novo biosynthesis and in salvage of exogenous thiamine. Thiamine salvage occurs in two steps, with thiamine kinase catalyzing the formation of thiamine phosphate, and ThiL catalyzing the...; Region: ThiL; cd02194
529507000485	ATP binding site [chemical binding]; other site
529507000486	dimerization interface [polypeptide binding]; other site
529507000487	HMMPfam hit to PF02769, AIR synthase related protein, C-terminal dom, score 0.0003
529507000488	hypothetical protein; Provisional; Region: PRK10220
529507000489	PhnA Zinc-Ribbon; Region: PhnA_Zn_Ribbon; pfam08274
529507000490	PhnA protein; Region: PhnA; pfam03831
529507000491	HMMPfam hit to PF03831, PhnA protein, score 2.2e-36
529507000492	plasmid-associated protein (pseudogene);This CDS appears to have a frame shift mutation near the N-terminus.
529507000493	HMMPfam hit to PF01850, PIN domain, score 8.2e-22
529507000494	Virulence-associated protein and related proteins [Function unknown]; Region: VagC; COG4456
529507000495	HMMPfam hit to PF04014, SpoVT / AbrB like domain, score 0.0049
529507000496	transcriptional repressor RbsR; Provisional; Region: PRK10423
529507000497	Helix-turn-helix (HTH) DNA binding domain of the LacI family of transcriptional regulators; Region: HTH_LacI; cd01392
529507000498	DNA binding site [nucleotide binding]
529507000499	domain linker motif; other site
529507000500	Ligand-binding domain of purine repressor, PurR, which functions as the master regulatory protein of de novo purine nucleotide biosynthesis in Escherichia coli; Region: PBP1_PurR; cd06275
529507000501	dimerization interface [polypeptide binding]; other site
529507000502	ligand binding site [chemical binding]; other site
529507000503	HMMPfam hit to PF00532, Periplasmic binding proteins and sugar b, score 2.7e-18
529507000504	HMMPfam hit to PF00356, Bacterial regulatory proteins, lacI fami, score 9e-14
529507000505	Predicted helix-turn-helix motif with score 2156.000, SD 6.53 at aa 2-23, sequence ATMKDVARLAGVSTSTVSHVIN
529507000506	PS00356 Bacterial regulatory proteins, lacI family signature.
529507000507	Sugar kinases, ribokinase family [Carbohydrate transport and metabolism]; Region: RbsK; COG0524
529507000508	Ribokinase catalyses the phosphorylation of ribose to ribose-5-phosphate using ATP. This reaction is the first step in the ribose metabolism. It traps ribose within the cell after uptake and also prepares the sugar for use in the synthesis of nucleotides...; Region: ribokinase; cd01174
529507000509	substrate binding site [chemical binding]; other site
529507000510	dimer interface [polypeptide binding]; other site
529507000511	ATP binding site [chemical binding]; other site
529507000512	HMMPfam hit to PF00294, pfkB family carbohydrate kinase, score 3.8e-93
529507000513	PS00584 pfkB family of carbohydrate kinases signature 2.
529507000514	PS00583 pfkB family of carbohydrate kinases signature 1.
529507000515	D-ribose transporter subunit RbsB; Provisional; Region: PRK10653
529507000516	Periplasmic sugar-binding domain of the thermophilic Thermoanaerobacter tengcongensis ribose binding protein (ttRBP) and its mesophilic homologs; Region: PBP1_ribose_binding; cd06323
529507000517	ligand binding site [chemical binding]; other site
529507000518	dimerization interface [polypeptide binding]; other site
529507000519	HMMPfam hit to PF00532, Periplasmic binding proteins and sugar b, score 6.4e-10
529507000520	Signal peptide predicted for PMI0090 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.992 between residues 25 and 26
529507000521	Branched-chain amino acid transport system / permease component; Region: BPD_transp_2; pfam02653
529507000522	Transmembrane subunit (TM) of Escherichia coli AraH and related proteins. E. coli AraH is the TM of a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of the monosaccharide arabinose. This group...; Region: TM_PBP1_transp_AraH_like; cd06579
529507000523	TM-ABC transporter signature motif; other site
529507000524	HMMPfam hit to PF02653, Branched-chain amino acid transport syst, score 3.3e-75
529507000525	7 probable transmembrane helices predicted for PMI0091 by TMHMM2.0 at aa 23-45, 66-88, 98-120, 127-146, 170-192, 222-244 and 276-298
529507000526	Signal peptide predicted for PMI0091 by SignalP 2.0 HMM (Signal peptide probability 0.981) with cleavage site probability 0.441 between residues 43 and 44
529507000527	D-ribose transporter ATP binding protein; Provisional; Region: PRK10762
529507000528	First domain of the ATP-binding cassette component of monosaccharide transport system; Region: ABC_Carb_Monos_I; cd03216
529507000529	Walker A/P-loop; other site
529507000530	ATP binding site [chemical binding]; other site
529507000531	Q-loop/lid; other site
529507000532	ABC transporter signature motif; other site
529507000533	Walker B; other site
529507000534	D-loop; other site
529507000535	H-loop/switch region; other site
529507000536	Second domain of the ATP-binding cassette component of monosaccharide transport system; Region: ABC_Carb_Monos_II; cd03215
529507000537	HMMPfam hit to PF00005, ABC transporter, score 3.8e-32
529507000538	PS00211 ABC transporters family signature.
529507000539	HMMPfam hit to PF00005, ABC transporter, score 3.9e-53
529507000540	PS00017 ATP/GTP-binding site motif A (P-loop).
529507000541	D-ribose pyranase; Provisional; Region: PRK11797
529507000542	HMMPfam hit to PF05025, RbsD / FucU transport protein family, score 2.8e-70
529507000543	1-deoxy-D-xylulose-5-phosphate synthase; Provisional; Region: PRK05444
529507000544	Thiamine pyrophosphate (TPP) family, DXS subfamily, TPP-binding module; 1-Deoxy-D-xylulose-5-phosphate synthase (DXS) is a regulatory enzyme of the mevalonate-independent pathway involved in terpenoid biosynthesis. Terpeniods are plant natural products...; Region: TPP_DXS; cd02007
529507000545	TPP-binding site; other site
529507000546	Pyrimidine (PYR) binding domain of 1-deoxy-D-xylulose-5-phosphate synthase (DXS), transketolase (TK), and related proteins; Region: TPP_PYR_DXS_TK_like; cd07033
529507000547	PYR/PP interface [polypeptide binding]; other site
529507000548	dimer interface [polypeptide binding]; other site
529507000549	TPP binding site [chemical binding]; other site
529507000550	Transketolase, C-terminal domain; Region: Transketolase_C; pfam02780
529507000551	HMMPfam hit to PF02780, Transketolase, C-terminal domain, score 4.6e-41
529507000552	HMMPfam hit to PF02779, Transketolase, pyridine binding domai, score 8.4e-63
529507000553	PS00802 Transketolase signature 2.
529507000554	PS00801 Transketolase signature 1.
529507000555	Geranylgeranyl pyrophosphate synthase [Coenzyme metabolism]; Region: IspA; COG0142
529507000556	Trans-Isoprenyl Diphosphate Synthases, head-to-tail; Region: Trans_IPPS_HT; cd00685
529507000557	substrate binding pocket [chemical binding]; other site
529507000558	chain length determination region; other site
529507000559	substrate-Mg2+ binding site; other site
529507000560	catalytic residues [active]
529507000561	aspartate-rich region 1; other site
529507000562	active site lid residues [active]
529507000563	aspartate-rich region 2; other site
529507000564	HMMPfam hit to PF00348, Polyprenyl synthetase, score 1.7e-113
529507000565	PS00444 Polyprenyl synthetases signature 2.
529507000566	PS00723 Polyprenyl synthetases signature 1.
529507000567	exodeoxyribonuclease VII small subunit; Provisional; Region: PRK00977
529507000568	HMMPfam hit to PF02609, Exonuclease VII small subunit, score 1.1e-31
529507000569	tRNA s(4)U8 sulfurtransferase; Provisional; Region: PRK01269
529507000570	THUMP domain of thiamine biosynthesis protein ThiI; Region: THUMP_ThiI; cd11716
529507000571	ThiI is required for thiazole synthesis in the thiamine biosynthesis pathway. It belongs to the Adenosine Nucleotide Hydrolysis suoerfamily and predicted to bind to Adenosine nucleotide; Region: ThiI; cd01712
529507000572	Ligand Binding Site [chemical binding]; other site
529507000573	Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein. The cysteine containing enzymatically active version of the domain is also found in the Cdc25 class of protein phosphatases and a variety of proteins...; Region: RHOD; cd00158
529507000574	active site residue [active]
529507000575	HMMPfam hit to PF02926, THUMP domain, score 1.2e-20
529507000576	HMMPfam hit to PF02568, Thiamine biosynthesis protein (ThiI), score 3.2e-103
529507000577	conserved hypothetical protein (fragment);This CDS appears to be truncated at N-terminus relative to database matches.
529507000578	Signal peptide predicted for PMI0100 by SignalP 2.0 HMM (Signal peptide probability 0.871) with cleavage site probability 0.465 between residues 30 and 31
529507000579	oxidative-stress-resistance chaperone; Provisional; Region: PRK11574
529507000580	Type 1 glutamine amidotransferase (GATase1)-like domain found in Human DJ-1; Region: GATase1_DJ-1; cd03135
529507000581	conserved cys residue [active]
529507000582	HMMPfam hit to PF01965, DJ-1/PfpI family, score 2.4e-38
529507000583	2-dehydropantoate 2-reductase; Reviewed; Region: PRK06522
529507000584	Ketopantoate reductase PanE/ApbA; Region: ApbA; pfam02558
529507000585	Ketopantoate reductase PanE/ApbA C terminal; Region: ApbA_C; pfam08546
529507000586	HMMPfam hit to PF02558, Ketopantoate reductase PanE/ApbA, score 3.6e-59
529507000587	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG1666
529507000588	Proteins similar to Escherichia coli YajQ; Region: YajQ_like; cd11740
529507000589	HMMPfam hit to PF04461, Protein of unknown function (DUF520), score 6.8e-111
529507000590	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507000591	Major Facilitator Superfamily; Region: MFS_1; pfam07690
529507000592	putative substrate translocation pore; other site
529507000593	HMMPfam hit to PF00083, Sugar (and other) transporter, score 1.8e-05
529507000594	12 probable transmembrane helices predicted for PMI0104 by TMHMM2.0 at aa 13-35, 50-72, 79-98, 102-124, 137-159, 164-186, 217-239, 249-271, 280-302, 306-328, 340-362 and 367-389
529507000595	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 3.5e-55
529507000596	protoheme IX farnesyltransferase; Provisional; Region: PRK13362
529507000597	UbiA prenyltransferase family; Region: UbiA; pfam01040
529507000598	HMMPfam hit to PF01040, UbiA prenyltransferase family, score 1.1e-80
529507000599	9 probable transmembrane helices predicted for PMI0105 by TMHMM2.0 at aa 86-108, 118-140, 160-182, 187-206, 213-235, 240-262, 289-311, 315-332 and 344-361
529507000600	PS00943 UbiA prenyltransferase family signature.
529507000601	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507000602	cytochrome o ubiquinol oxidase subunit IV; Provisional; Region: PRK10582
529507000603	Ubiquinol oxidase subunit III subfamily. Ubiquinol oxidase, the terminal oxidase in the respiratory chains of aerobic bacteria, is a multi-chain transmembrane protein located in the cell membrane.  It catalyzes the reduction of O2 and simultaneously...; Region: Ubiquinol_oxidase_III; cd02863
529507000604	Subunit I/III interface [polypeptide binding]; other site
529507000605	Subunit III/IV interface [polypeptide binding]; other site
529507000606	HMMPfam hit to PF00510, Cytochrome c oxidase subunit III, score 8.8e-06
529507000607	5 probable transmembrane helices predicted for PMI0106 by TMHMM2.0 at aa 25-47, 62-84, 97-116, 136-158 and 179-201
529507000608	Heme/copper-type cytochrome/quinol oxidases, subunit 1 [Energy production and conversion]; Region: CyoB; COG0843
529507000609	Ubiquinol oxidase subunit I.  Ubiquinol oxidase, the terminal oxidase in the respiratory chains of aerobic bacteria, is a multi-chain transmembrane protein located in the cell membrane.  It catalyzes the reduction of O2 and simultaneously pumps protons...; Region: Ubiquinol_Oxidase_I; cd01662
529507000610	D-pathway; other site
529507000611	Putative ubiquinol binding site [chemical binding]; other site
529507000612	Low-spin heme (heme b) binding site [chemical binding]; other site
529507000613	Putative water exit pathway; other site
529507000614	Binuclear center (heme o3/CuB) [ion binding]; other site
529507000615	K-pathway; other site
529507000616	Putative proton exit pathway; other site
529507000617	14 probable transmembrane helices predicted for PMI0107 by TMHMM2.0 at aa 24-46, 65-87, 113-135, 148-170, 199-221, 241-263, 283-305, 318-340, 355-377, 390-412, 422-444, 465-487, 502-524 and 598-620
529507000618	HMMPfam hit to PF00115, Cytochrome C and Quinol oxidase polypeptide, score 2.5e-256
529507000619	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507000620	PS00077 Heme-copper oxidase catalytic subunit, copper B binding region signature.
529507000621	cytochrome o ubiquinol oxidase subunit II; Provisional; Region: PRK10525
529507000622	Cytochrome C oxidase subunit II, periplasmic domain; Region: COX2; pfam00116
529507000623	COX Aromatic Rich Motif; Region: COX_ARM; pfam06481
529507000624	HMMPfam hit to PF06481, COX Aromatic Rich Motif, score 8.5e-14
529507000625	HMMPfam hit to PF00116, Cytochrome C oxidase subunit II, periplasmic, score 1.1e-06
529507000626	3 probable transmembrane helices predicted for PMI0108 by TMHMM2.0 at aa 13-34, 49-71 and 92-112
529507000627	Signal peptide predicted for PMI0108 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.756 between residues 32 and 33
529507000628	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507000629	hypothetical protein; Provisional; Region: PRK11528
529507000630	HMMPfam hit to PF07135, Protein of unknown function (DUF1384), score 1.1e-145
529507000631	Signal peptide predicted for PMI0109 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.997 between residues 20 and 21
529507000632	ATP-dependent RNA helicase DbpA; Provisional; Region: PRK11776
529507000633	DEAD-box helicases. A diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker  B motif; Region: DEADc; cd00268
529507000634	ATP binding site [chemical binding]; other site
529507000635	Mg++ binding site [ion binding]; other site
529507000636	motif III; other site
529507000637	Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may...; Region: HELICc; cd00079
529507000638	nucleotide binding region [chemical binding]; other site
529507000639	ATP-binding site [chemical binding]; other site
529507000640	RNA recognition motif in Escherichia coli RNA helicase dbpA and similar proteins; Region: RRM_EcDbpA_like; cd12501
529507000641	putative RNA binding site [nucleotide binding]; other site
529507000642	HMMPfam hit to PF00270, DEAD/DEAH box helicase, score 2.4e-69
529507000643	PS00017 ATP/GTP-binding site motif A (P-loop).
529507000644	PS00039 DEAD-box subfamily ATP-dependent helicases signature.
529507000645	HMMPfam hit to PF00271, Helicase conserved C-terminal domain, score 2.1e-32
529507000646	HMMPfam hit to PF03880, DbpA RNA binding domain, score 2.5e-31
529507000647	muropeptide transporter; Reviewed; Region: ampG; PRK11902
529507000648	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507000649	putative substrate translocation pore; other site
529507000650	14 probable transmembrane helices predicted for PMI0111 by TMHMM2.0 at aa 13-35, 50-69, 82-101, 106-123, 144-166, 176-193, 228-250, 260-282, 287-309, 319-341, 354-376, 380-402, 427-449 and 479-501
529507000651	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 4.9e-28
529507000652	Signal peptide predicted for PMI0111 by SignalP 2.0 HMM (Signal peptide probability 0.998) with cleavage site probability 0.563 between residues 32 and 33
529507000653	hypothetical protein; Provisional; Region: PRK11627
529507000654	Uncharacterized lipoprotein; Region: Lipoprotein_16; pfam03923
529507000655	HMMPfam hit to PF03923, Uncharacterized lipoprotein, score 1.2e-05
529507000656	BolA-like protein; Region: BolA; cl00386
529507000657	HMMPfam hit to PF01722, BolA-like protein, score 5.2e-33
529507000658	trigger factor; Provisional; Region: tig; PRK01490
529507000659	FKBP-type peptidyl-prolyl cis-trans isomerase; Region: FKBP_C; pfam00254
529507000660	Bacterial trigger factor protein (TF) C-terminus; Region: Trigger_C; pfam05698
529507000661	HMMPfam hit to PF05697, Bacterial trigger factor protein (TF), score 5.7e-75
529507000662	HMMPfam hit to PF00254, FKBP-type peptidyl-prolyl cis-trans isomera, score 2.3e-27
529507000663	HMMPfam hit to PF05698, Bacterial trigger factor protein (TF) C-ter, score 2e-55
529507000664	Protease subunit of ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion]; Region: ClpP; COG0740
529507000665	Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease; Region: S14_ClpP_2; cd07017
529507000666	oligomer interface [polypeptide binding]; other site
529507000667	active site residues [active]
529507000668	HMMPfam hit to PF00574, Clp protease, score 3.5e-140
529507000669	PS00381 Endopeptidase Clp serine active site.
529507000670	PS00382 Endopeptidase Clp histidine active site.
529507000671	ATP-dependent protease ATP-binding subunit ClpX; Provisional; Region: clpX; PRK05342
529507000672	ClpX C4-type zinc finger; Region: zf-C4_ClpX; pfam06689
529507000673	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
529507000674	Walker A motif; other site
529507000675	ATP binding site [chemical binding]; other site
529507000676	Walker B motif; other site
529507000677	C-terminal, D2-small domain, of ClpB protein; Region: ClpB_D2-small; smart01086
529507000678	HMMPfam hit to PF06689, ClpX C4-type zinc finger, score 6.6e-26
529507000679	HMMPfam hit to PF07724, ATPase family associated with various cell, score 2.3e-79
529507000680	HMMPfam hit to PF00004, ATPase family associated with various cell, score 5.2e-23
529507000681	PS00017 ATP/GTP-binding site motif A (P-loop).
529507000682	DNA-binding ATP-dependent protease La; Provisional; Region: PRK10787
529507000683	Found in ATP-dependent protease La (LON); Region: LON; smart00464
529507000684	Found in ATP-dependent protease La (LON); Region: LON; smart00464
529507000685	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
529507000686	Walker A motif; other site
529507000687	ATP binding site [chemical binding]; other site
529507000688	Walker B motif; other site
529507000689	arginine finger; other site
529507000690	Lon protease (S16) C-terminal proteolytic domain; Region: Lon_C; pfam05362
529507000691	HMMPfam hit to PF02190, ATP-dependent protease La (LON) domain, score 1.9e-71
529507000692	HMMPfam hit to PF00004, ATPase family associated with various cellul, score 3.4e-43
529507000693	PS00017 ATP/GTP-binding site motif A (P-loop).
529507000694	HMMPfam hit to PF05362, Lon protease (S16) C-terminal proteolytic do, score 5.7e-151
529507000695	PS01046 ATP-dependent serine proteases, lon family, serine active site.
529507000696	Integration host factor (IHF) and HU are small heterodimeric members of the DNABII protein family that bind and bend DNA, functioning as architectural factors in many cellular processes including transcription, site-specific recombination, and...; Region: HU_IHF; cd00591
529507000697	IHF dimer interface [polypeptide binding]; other site
529507000698	IHF - DNA interface [nucleotide binding]; other site
529507000699	HMMPfam hit to PF00216, Bacterial DNA-binding protein, score 5.7e-50
529507000700	PS00045 Bacterial histone-like DNA-binding proteins signature.
529507000701	periplasmic folding chaperone; Provisional; Region: PRK10788
529507000702	SurA N-terminal domain; Region: SurA_N_3; cl07813
529507000703	PPIC-type PPIASE domain; Region: Rotamase_2; pfam13145
529507000704	Signal peptide predicted for PMI0119 by SignalP 2.0 HMM (Signal peptide probability 0.939) with cleavage site probability 0.556 between residues 42 and 43
529507000705	1 probable transmembrane helix predicted for PMI0119 by TMHMM2.0 at aa 13-35
529507000706	HMMPfam hit to PF00639, PPIC-type PPIASE domain, score 1.3e-11
529507000707	Helix-hairpin-helix motif; Region: HHH_3; pfam12836
529507000708	Helix-hairpin-helix motif; Region: HHH; pfam00633
529507000709	Signal peptide predicted for PMI0120 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 1.000 between residues 30 and 31
529507000710	HMMPfam hit to PF00633, Helix-hairpin-helix motif, score 5.4e-06
529507000711	4-hydroxybenzoyl-CoA thioesterase (4HBT). Catalyzes the final step in the 4-chlorobenzoate degradation pathway in which 4-chlorobenzoate is converted to 4-hydroxybenzoate in certain soil-dwelling bacteria. 4HBT forms a homotetramer with four active sites; Region: 4HBT; cd00586
529507000712	active site
529507000713	HMMPfam hit to PF03061, Thioesterase superfamily, score 4.2e-12
529507000714	ExsB is a transcription regulator related protein. It is a subfamily of a Adenosine nucleotide binding superfamily of proteins. This protein family is represented by a single member in nearly every completed large (> 1000 genes) prokaryotic genome. In...; Region: ExsB; cd01995
529507000715	Ligand Binding Site [chemical binding]; other site
529507000716	PS00190 Cytochrome c family heme-binding site signature.
529507000717	HMMPfam hit to PF06508, ExsB, score 2.1e-42
529507000718	Transcriptional regulators [Transcription]; Region: Lrp; COG1522
529507000719	Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to...; Region: HTH_ARSR; cd00090
529507000720	putative DNA binding site [nucleotide binding]; other site
529507000721	putative Zn2+ binding site [ion binding]; other site
529507000722	AsnC family; Region: AsnC_trans_reg; pfam01037
529507000723	HMMPfam hit to PF01037, AsnC family, score 4.5e-47
529507000724	ABC transporter transmembrane region; Region: ABC_membrane; pfam00664
529507000725	putative multidrug transporter membrane\ATP-binding components; Provisional; Region: PRK10789
529507000726	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
529507000727	Walker A/P-loop; other site
529507000728	ATP binding site [chemical binding]; other site
529507000729	Q-loop/lid; other site
529507000730	ABC transporter signature motif; other site
529507000731	Walker B; other site
529507000732	D-loop; other site
529507000733	H-loop/switch region; other site
529507000734	HMMPfam hit to PF00664, ABC transporter transmembrane region, score 5.3e-57
529507000735	6 probable transmembrane helices predicted for PMI0124 by TMHMM2.0 at aa 21-43, 58-77, 129-151, 156-175, 242-264 and 279-301
529507000736	HMMPfam hit to PF00005, ABC transporter, score 9.4e-50
529507000737	PS00017 ATP/GTP-binding site motif A (P-loop).
529507000738	PS00211 ABC transporters family signature.
529507000739	putative multidrug transporter membrane\ATP-binding components; Provisional; Region: PRK10790
529507000740	ABC transporter transmembrane region; Region: ABC_membrane; pfam00664
529507000741	ATP-binding cassette domain of glucan transporter and related proteins, subfamily C; Region: ABCC_Glucan_exporter_like; cd03254
529507000742	Walker A/P-loop; other site
529507000743	ATP binding site [chemical binding]; other site
529507000744	Q-loop/lid; other site
529507000745	ABC transporter signature motif; other site
529507000746	Walker B; other site
529507000747	D-loop; other site
529507000748	H-loop/switch region; other site
529507000749	Signal peptide predicted for PMI0125 by SignalP 2.0 HMM (Signal peptide probability 0.910) with cleavage site probability 0.809 between residues 43 and 44
529507000750	HMMPfam hit to PF00664, ABC transporter transmembrane region, score 8.7e-30
529507000751	6 probable transmembrane helices predicted for PMI0125 by TMHMM2.0 at aa 33-55, 70-89, 143-165, 170-189, 254-276 and 280-299
529507000752	HMMPfam hit to PF00005, ABC transporter, score 9.4e-53
529507000753	PS00017 ATP/GTP-binding site motif A (P-loop).
529507000754	PS00211 ABC transporters family signature.
529507000755	Nitrogen regulatory protein PII [Amino acid transport and metabolism]; Region: GlnK; COG0347
529507000756	Nitrogen regulatory protein P-II; Region: P-II; smart00938
529507000757	HMMPfam hit to PF00543, Nitrogen regulatory protein P-II, score 1.6e-63
529507000758	PS00496 P-II protein urydylation site.
529507000759	PS00638 P-II protein C-terminal region signature.
529507000760	ammonium transporter; Provisional; Region: PRK10666
529507000761	Signal peptide predicted for PMI0127 by SignalP 2.0 HMM (Signal peptide probability 0.997) with cleavage site probability 0.966 between residues 24 and 25
529507000762	12 probable transmembrane helices predicted for PMI0127 by TMHMM2.0 at aa 5-24, 39-61, 73-95, 123-145, 150-172, 187-209, 222-241, 251-273, 285-302, 306-328, 341-363 and 378-400
529507000763	HMMPfam hit to PF00909, Ammonium Transporter Family, score 2.8e-164
529507000764	PS01219 Ammonium transporters signature.
529507000765	acyl-CoA thioesterase II; Provisional; Region: PRK10526
529507000766	Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP)...; Region: Thioesterase_II_repeat2; cd03445
529507000767	active site
529507000768	Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP)...; Region: Thioesterase_II_repeat1; cd03444
529507000769	catalytic triad [active]
529507000770	dimer interface [polypeptide binding]; other site
529507000771	HMMPfam hit to PF02551, Acyl-CoA thioesterase, score 2.1e-53
529507000772	HMMPfam hit to PF02551, Acyl-CoA thioesterase, score 1.7e-39
529507000773	gene expression modulator; Provisional; Region: PRK10945
529507000774	HMMPfam hit to PF05321, Haemolysin expression modulating protein, score 4.9e-36
529507000775	Hha toxicity attenuator; Provisional; Region: PRK10667
529507000776	multidrug efflux system protein AcrB; Provisional; Region: PRK15127
529507000777	Protein export membrane protein; Region: SecD_SecF; cl14618
529507000778	Protein export membrane protein; Region: SecD_SecF; cl14618
529507000779	HMMPfam hit to PF00873, AcrB/AcrD/AcrF family, score 0
529507000780	11 probable transmembrane helices predicted for PMI0131 by TMHMM2.0 at aa 10-32, 337-359, 369-391, 438-460, 470-492, 541-563, 608-630, 875-894, 898-920, 977-999 and 1009-1031
529507000781	RND family efflux transporter, MFP subunit; Region: RND_mfp; TIGR01730
529507000782	Biotin-lipoyl like; Region: Biotin_lipoyl_2; pfam13533
529507000783	HlyD family secretion protein; Region: HlyD_3; pfam13437
529507000784	HMMPfam hit to PF00529, HlyD family secretion protein, score 3.3e-74
529507000785	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507000786	DNA-binding transcriptional repressor AcrR; Provisional; Region: PRK10668
529507000787	Bacterial regulatory proteins, tetR family; Region: TetR_N; pfam00440
529507000788	MAATS-type transcriptional repressor, C-terminal region; Region: TetR_C_2; pfam08361
529507000789	HMMPfam hit to PF00440, Bacterial regulatory proteins, tetR family, score 8e-21
529507000790	PS01081 Bacterial regulatory proteins, tetR family signature.
529507000791	Predicted helix-turn-helix motif with score 2108.000, SD 6.37 at aa 32-53, sequence TSLSDIATEAGVTRGAIYWHFK
529507000792	Uncharacterized conserved protein involved in intracellular sulfur reduction [Inorganic ion transport and metabolism]; Region: DsrE; COG1553
529507000793	HMMPfam hit to PF02635, DsrE/DsrF-like family, score 1.2e-34
529507000794	hypothetical protein; Provisional; Region: PRK11281
529507000795	Tail length tape measure protein; Region: Phage_HK97_TLTM; pfam06120
529507000796	Mechanosensitive ion channel inner membrane domain 1; Region: MscS_TM; pfam12794
529507000797	Mechanosensitive ion channel; Region: MS_channel; pfam00924
529507000798	Signal peptide predicted for PMI0135 by SignalP 2.0 HMM (Signal peptide probability 0.996) with cleavage site probability 0.983 between residues 43 and 44
529507000799	12 probable transmembrane helices predicted for PMI0135 by TMHMM2.0 at aa 12-34, 527-544, 573-595, 605-624, 651-669, 679-701, 714-736, 746-768, 823-845, 865-887, 908-930 and 945-967
529507000800	PS00018 EF-hand calcium-binding domain.
529507000801	HMMPfam hit to PF00924, Mechanosensitive ion channel, score 8.2e-78
529507000802	PS01246 Uncharacterized protein family UPF0003 signature.
529507000803	hypothetical protein; Provisional; Region: PRK11038
529507000804	Primosomal replication protein priB and priC; Region: priB_priC; cl11483
529507000805	HMMPfam hit to PF07445, Primosomal replication protein priB and pri, score 1.6e-56
529507000806	Phosphoribosyl transferase (PRT)-type I domain; Region: PRTases_typeI; cd06223
529507000807	active site
529507000808	HMMPfam hit to PF00156, Phosphoribosyl transferase domain, score 3e-46
529507000809	PS00103 Purine/pyrimidine phosphoribosyl transferases signature.
529507000810	DNA polymerase III subunits gamma and tau; Validated; Region: PRK07994
529507000811	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
529507000812	Walker A motif; other site
529507000813	ATP binding site [chemical binding]; other site
529507000814	Walker B motif; other site
529507000815	arginine finger; other site
529507000816	DNA polymerase III subunits gamma and tau domain III; Region: DNA_pol3_gamma3; pfam12169
529507000817	DNA polymerase III subunits tau domain IV DnaB-binding; Region: DNA_pol3_tau_4; pfam12168
529507000818	DNA polymerase III tau subunit V interacting with alpha; Region: DNA_pol3_tau_5; pfam12170
529507000819	HMMPfam hit to PF00004, ATPase family associated with various cellul, score 1.2e-10
529507000820	PS00017 ATP/GTP-binding site motif A (P-loop).
529507000821	PS00215 Mitochondrial energy transfer proteins signature.
529507000822	PS00339 Aminoacyl-transfer RNA synthetases class-II signature 2.
529507000823	hypothetical protein; Validated; Region: PRK00153
529507000824	HMMPfam hit to PF02575, Uncharacterised BCR, YbaB family COG0718, score 5.2e-53
529507000825	recombination protein RecR; Reviewed; Region: recR; PRK00076
529507000826	RecR protein; Region: RecR; pfam02132
529507000827	TOPRIM_recR: topoisomerase-primase (TOPRIM) nucleotidyl transferase/hydrolase domain of the type found in Escherichia coli RecR.  RecR participates in the RecFOR pathway of homologous recombinational repair in prokaryotes. This pathway provides a...; Region: TOPRIM_recR; cd01025
529507000828	putative active site [active]
529507000829	putative metal-binding site [ion binding]; other site
529507000830	tetramer interface [polypeptide binding]; other site
529507000831	HMMPfam hit to PF02132, RecR protein, score 1.4e-17
529507000832	PS01300 RecR protein signature.
529507000833	HMMPfam hit to PF01751, Toprim domain, score 2.3e-19
529507000834	carbon starvation protein A; Provisional; Region: PRK15015
529507000835	Carbon starvation protein CstA; Region: CstA; pfam02554
529507000836	C-terminal domain on CstA (DUF4161); Region: DUF4161; pfam13722
529507000837	Signal peptide predicted for PMI0142 by SignalP 2.0 HMM (Signal peptide probability 0.948) with cleavage site probability 0.744 between residues 27 and 28
529507000838	16 probable transmembrane helices predicted for PMI0142 by TMHMM2.0 at aa 12-29, 34-56, 89-111, 121-140, 161-183, 193-215, 220-242, 257-279, 286-305, 325-347, 364-386, 486-505, 532-551, 566-588, 595-617 and 663-685
529507000839	HMMPfam hit to PF02554, Carbon starvation protein CstA, score 8.6e-278
529507000840	Uncharacterized small protein [Function unknown]; Region: COG2879
529507000841	HMMPfam hit to PF04328, Protein of unknown function (DUF466), score 4.5e-43
529507000842	putative GTP-binding protein YjiA; Provisional; Region: PRK11537
529507000843	The function of this protein family is unkown. The amino acid sequence of YjiA protein in E. coli contains several conserved motifs that characterizes it as a P-loop GTPase. YijA gene is among the genes significantly induced in response to DNA-damage...; Region: CobW_like; cd03112
529507000844	P-loop, Walker A motif; other site
529507000845	Base recognition motif; other site
529507000846	Cobalamin synthesis protein cobW C-terminal domain; Region: CobW_C; pfam07683
529507000847	HMMPfam hit to PF02492, CobW/HypB/UreG, nucleotide-binding domain, score 2.5e-68
529507000848	PS00017 ATP/GTP-binding site motif A (P-loop).
529507000849	HMMPfam hit to PF07683, Cobalamin synthesis protein cobW C-terminal, score 2.2e-35
529507000850	L-cysteine desulfidase [Amino acid transport and metabolism]; Region: COG3681
529507000851	HMMPfam hit to PF06354, Protein of unknown function (DUF1063), score 1.6e-215
529507000852	C4-dicarboxylate transporter [Energy production and conversion]; Region: DcuC; cl17322
529507000853	C4-dicarboxylate anaerobic carrier; Region: DcuC; pfam03606
529507000854	HMMPfam hit to PF03606, C4-dicarboxylate anaerobic carrier, score 2.3e-90
529507000855	11 probable transmembrane helices predicted for PMI0146 by TMHMM2.0 at aa 4-19, 26-48, 79-101, 114-136, 151-173, 194-216, 244-266, 273-292, 312-334, 346-368 and 435-454
529507000856	peptidase T; Region: peptidase-T; TIGR01882
529507000857	M20 Peptidase T specifically cleaves tripeptides; Region: M20_peptT; cd03892
529507000858	metal binding site [ion binding]; metal-binding site
529507000859	dimer interface [polypeptide binding]; other site
529507000860	HMMPfam hit to PF07687, Peptidase dimerisation domain, score 2.4e-10
529507000861	PS00759 ArgE / dapE / ACY1 / CPG2 / yscS family signature 2.
529507000862	PS00758 ArgE / dapE / ACY1 / CPG2 / yscS family signature 1.
529507000863	Uncharacterized subfamily of the multidrug and toxic compound extrusion (MATE) proteins; Region: MATE_like_8; cd13134
529507000864	Na+-driven multidrug efflux pump [Defense mechanisms]; Region: NorM; COG0534
529507000865	10 probable transmembrane helices predicted for PMI0149 by TMHMM2.0 at aa 12-34, 56-78, 91-113, 128-150, 162-184, 194-216, 237-259, 274-296, 317-334 and 384-406
529507000866	HMMPfam hit to PF01554, MatE, score 5.7e-29
529507000867	PS00267 Tachykinin family signature.
529507000868	HMMPfam hit to PF01554, MatE, score 1.5e-31
529507000869	diaminopimelate dehydrogenase; Region: DAP-DH; TIGR01921
529507000870	Oxidoreductase family, NAD-binding Rossmann fold; Region: GFO_IDH_MocA; pfam01408
529507000871	HMMPfam hit to PF01408, Oxidoreductase family, NAD-binding Rossm, score 1.3e-05
529507000872	TIM-barrel signal transduction protein; Region: TIM-br_sig_trns; pfam09370
529507000873	hypothetical protein; Provisional; Region: PRK02399
529507000874	Uncharacterized protein family (UPF0261); Region: UPF0261; pfam06792
529507000875	HMMPfam hit to PF06792, Uncharacterised protein family (UPF0261), score 7e-226
529507000876	PS00290 Immunoglobulins and major histocompatibility complex proteins signature.
529507000877	Transcriptional regulator [Transcription]; Region: AcrR; COG1309
529507000878	Helix-turn-helix domain of Hin and related proteins, a family of DNA-binding domains unique to bacteria and represented by the Hin protein of Salmonella. The basic HTH domain is a simple fold comprised of three core helices that form a right-handed...; Region: HTH_Hin_like; cd00569
529507000879	DNA-binding interface [nucleotide binding]; DNA binding site
529507000880	HMMPfam hit to PF00440, Bacterial regulatory proteins, tetR family, score 3.5e-09
529507000881	Predicted helix-turn-helix motif with score 1737.000, SD 5.10 at aa 36-57, sequence PTVSELAAHAGVSRATAYRYFP
529507000882	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG2964
529507000883	YheO-like PAS domain; Region: PAS_6; pfam08348
529507000884	HTH domain; Region: HTH_22; pfam13309
529507000885	Predicted helix-turn-helix motif with score 1438.000, SD 4.08 at aa 188-209, sequence KAMEITAQYLGVSRATVYNDLK
529507000886	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cd04301
529507000887	Coenzyme A binding pocket [chemical binding]; other site
529507000888	HMMPfam hit to PF00583, Acetyltransferase (GNAT) family, score 1.1e-17
529507000889	PS00213 Lipocalin signature.
529507000890	membrane protein AbrB duplication; Region: Gneg_AbrB_dup; TIGR03082
529507000891	Putative ammonia monooxygenase [General function prediction only]; Region: AbrB; COG3180
529507000892	membrane protein AbrB duplication; Region: Gneg_AbrB_dup; TIGR03082
529507000893	Signal peptide predicted for PMI0157 by SignalP 2.0 HMM (Signal peptide probability 0.990) with cleavage site probability 0.654 between residues 28 and 29
529507000894	9 probable transmembrane helices predicted for PMI0157 by TMHMM2.0 at aa 10-41, 53-75, 80-102, 139-158, 173-195, 200-219, 232-254, 261-283 and 320-337
529507000895	HMMPfam hit to PF05145, ammonia monooxygenase, score 2.6e-31
529507000896	Signal peptide predicted for PMI0158 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.828 between residues 36 and 37
529507000897	multicopper oxidase; Provisional; Region: PRK10965
529507000898	Multicopper oxidase; Region: Cu-oxidase_3; pfam07732
529507000899	Multicopper oxidase; Region: Cu-oxidase; pfam00394
529507000900	Multicopper oxidase; Region: Cu-oxidase_2; pfam07731
529507000901	Signal peptide predicted for PMI0159 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.971 between residues 28 and 29
529507000902	HMMPfam hit to PF07732, Multicopper oxidase, score 1.7e-41
529507000903	PS00017 ATP/GTP-binding site motif A (P-loop).
529507000904	HMMPfam hit to PF07731, Multicopper oxidase, score 3.7e-17
529507000905	PS00080 Multicopper oxidases signature 2.
529507000906	Phosphoribosyl transferase (PRT)-type I domain; Region: PRTases_typeI; cd06223
529507000907	active site
529507000908	HMMPfam hit to PF00156, Phosphoribosyl transferase domain, score 1.6e-37
529507000909	PS00103 Purine/pyrimidine phosphoribosyl transferases signature.
529507000910	Carbonic anhydrases (CA) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism in which the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide is followed by the regeneration of an...; Region: beta_CA_cladeA; cd00883
529507000911	active site clefts [active]
529507000912	zinc binding site [ion binding]; other site
529507000913	dimer interface [polypeptide binding]; other site
529507000914	HMMPfam hit to PF00484, Carbonic anhydrase, score 1.6e-60
529507000915	PS00705 Prokaryotic-type carbonic anhydrases signature 2.
529507000916	PS00704 Prokaryotic-type carbonic anhydrases signature 1.
529507000917	ABC-type multidrug transport system, ATPase component [Defense mechanisms]; Region: CcmA; COG1131
529507000918	ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A; Region: ABC_DR_subfamily_A; cd03230
529507000919	Walker A/P-loop; other site
529507000920	ATP binding site [chemical binding]; other site
529507000921	Q-loop/lid; other site
529507000922	ABC transporter signature motif; other site
529507000923	Walker B; other site
529507000924	D-loop; other site
529507000925	H-loop/switch region; other site
529507000926	HMMPfam hit to PF00005, ABC transporter, score 6.7e-50
529507000927	PS00017 ATP/GTP-binding site motif A (P-loop).
529507000928	PS00211 ABC transporters family signature.
529507000929	inner membrane transport permease; Provisional; Region: PRK15066
529507000930	ABC-type multidrug transport system, permease component [Defense mechanisms]; Region: COG0842
529507000931	HMMPfam hit to PF01061, ABC-2 type transporter, score 2.8e-46
529507000932	6 probable transmembrane helices predicted for PMI0163 by TMHMM2.0 at aa 20-42, 62-84, 104-126, 141-163, 176-198 and 226-248
529507000933	PS00890 ABC-2 type transport system integral membrane proteins signature.
529507000934	benzoate transport; Region: 2A0115; TIGR00895
529507000935	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507000936	putative substrate translocation pore; other site
529507000937	HMMPfam hit to PF00083, Sugar (and other) transporter, score 5.1e-29
529507000938	12 probable transmembrane helices predicted for PMI0164 by TMHMM2.0 at aa 25-47, 57-79, 91-110, 115-137, 150-172, 177-194, 233-255, 265-287, 294-313, 318-340, 353-375 and 385-404
529507000939	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 7.4e-50
529507000940	HMMPfam hit to PF06779, Protein of unknown function (DUF1228), score 0.00043
529507000941	PS00217 Sugar transport proteins signature 2.
529507000942	PS00216 Sugar transport proteins signature 1.
529507000943	Protein of unknown function (DUF2526); Region: DUF2526; pfam10735
529507000944	heat shock protein HtpX; Provisional; Region: PRK02870
529507000945	HMMPfam hit to PF01435, Peptidase family M48, score 9.6e-30
529507000946	4 probable transmembrane helices predicted for PMI0166 by TMHMM2.0 at aa 16-38, 53-75, 182-204 and 219-241
529507000947	PS00453 FKBP-type peptidyl-prolyl cis-trans isomerase signature 1.
529507000948	Signal peptide predicted for PMI0166 by SignalP 2.0 HMM (Signal peptide probability 0.841) with cleavage site probability 0.343 between residues 34 and 35
529507000949	LemA family; Region: LemA; cl00742
529507000950	HMMPfam hit to PF04011, LemA family, score 5.9e-19
529507000951	2 probable transmembrane helices predicted for PMI0167 by TMHMM2.0 at aa 4-21 and 142-164
529507000952	DMSO reductase anchor subunit (DmsC); Region: DmsC; cl17519
529507000953	8 probable transmembrane helices predicted for PMI0168 by TMHMM2.0 at aa 5-27, 47-66, 81-103, 116-138, 148-170, 183-202, 212-231 and 238-260
529507000954	DMSO reductase, iron-sulfur subunit; Region: DMSO_dmsB; TIGR02951
529507000955	4Fe-4S binding domain; Region: Fer4; cl02805
529507000956	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 4.5e-07
529507000957	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
529507000958	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507000959	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 0.0026
529507000960	Anaerobic dehydrogenases, typically selenocysteine-containing [Energy production and conversion]; Region: BisC; COG0243
529507000961	Molybdopterin-Binding (MopB) domain of the MopB superfamily of proteins, a  large, diverse, heterogeneous superfamily of enzymes that, in general, bind molybdopterin as a cofactor. The MopB domain is found in a wide variety of molybdenum- and...; Region: Molybdopterin-Binding; cl09928
529507000962	molybdopterin cofactor binding site; other site
529507000963	Molybdopterin-Binding, C-terminal (MopB_CT) domain of the MopB superfamily of proteins, a  large, diverse, heterogeneous superfamily of enzymes that, in general, bind molybdopterin as a cofactor. The MopB domain is found in a wide variety of molybdenum-...; Region: MopB_CT; cl09929
529507000964	molybdopterin cofactor binding site; other site
529507000965	HMMPfam hit to PF01568, Molydopterin dinucleotide binding dom, score 1.4e-18
529507000966	HMMPfam hit to PF00384, Molybdopterin oxidoreductase, score 2.2e-62
529507000967	PS00490 Prokaryotic molybdopterin oxidoreductases signature 2.
529507000968	Predicted helix-turn-helix motif with score 1249.000, SD 3.44 at aa 363-384, sequence WTIEKTSKETDIPQETIIRLAR
529507000969	Signal peptide predicted for PMI0170 by SignalP 2.0 HMM (Signal peptide probability 0.993) with cleavage site probability 0.562 between residues 32 and 33
529507000970	IclR helix-turn-helix domain; Region: HTH_IclR; cl17605
529507000971	Transcriptional regulator [Transcription]; Region: IclR; COG1414
529507000972	Bacterial transcriptional regulator; Region: IclR; pfam01614
529507000973	Predicted helix-turn-helix motif with score 1127.000, SD 3.03 at aa 27-48, sequence ARSSEIAKACSLSKSRLHKYLV
529507000974	Tat-translocated enzyme; Region: tat_substr_1; TIGR01412
529507000975	Predicted iron-dependent peroxidase [Inorganic ion transport and metabolism]; Region: COG2837
529507000976	HMMPfam hit to PF04261, Dyp-type peroxidase family, score 4.4e-125
529507000977	Signal peptide predicted for PMI0172 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.990 between residues 39 and 40
529507000978	Imelysin; Region: Peptidase_M75; cl09159
529507000979	Signal peptide predicted for PMI0173 by SignalP 2.0 HMM (Signal peptide probability 0.978) with cleavage site probability 0.957 between residues 27 and 28
529507000980	Iron permease FTR1 family; Region: FTR1; cl00475
529507000981	HMMPfam hit to PF03239, Iron permease FTR1 family, score 1.1e-14
529507000982	7 probable transmembrane helices predicted for PMI0174 by TMHMM2.0 at aa 4-26, 38-60, 70-92, 113-135, 150-172, 177-199 and 251-270
529507000983	Cupredoxin-like domain; Region: Cupredoxin_1; pfam13473
529507000984	Signal peptide predicted for PMI0175 by SignalP 2.0 HMM (Signal peptide probability 0.996) with cleavage site probability 0.884 between residues 36 and 37
529507000985	Fe2+ transport protein; Region: Iron_transport; pfam10634
529507000986	Signal peptide predicted for PMI0176 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.991 between residues 21 and 22
529507000987	transposase (fragment)
529507000988	Predicted helix-turn-helix motif with score 1067.000, SD 2.82 at aa 1-22, sequence MKEEDICRENGISNACYYNWKS
529507000989	type VI secretion system effector, Hcp1 family; Region: VI_effect_Hcp1; TIGR03344
529507000990	HMMPfam hit to PF05638, Protein of unknown function (DUF796), score 5.6e-12
529507000991	2 probable transmembrane helices predicted for PMI0179 by TMHMM2.0 at aa 5-27 and 32-54
529507000992	Signal peptide predicted for PMI0179 by SignalP 2.0 HMM (Signal peptide probability 0.665) with cleavage site probability 0.510 between residues 34 and 35
529507000993	2 probable transmembrane helices predicted for PMI0180 by TMHMM2.0 at aa 38-60 and 80-102
529507000994	Predicted transcriptional regulators [Transcription]; Region: HipB; COG1396
529507000995	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
529507000996	non-specific DNA binding site [nucleotide binding]; other site
529507000997	salt bridge; other site
529507000998	sequence-specific DNA binding site [nucleotide binding]; other site
529507000999	HMMPfam hit to PF01381, Helix-turn-helix, score 5.6e-13
529507001000	Predicted helix-turn-helix motif with score 2045.000, SD 6.15 at aa 32-53, sequence LSAKAVAERVGVSQQQFSRYEN
529507001001	bifunctional glutathionylspermidine amidase/glutathionylspermidine synthetase; Provisional; Region: PRK10507
529507001002	CHAP domain; Region: CHAP; pfam05257
529507001003	Glutathionylspermidine synthase [Amino acid transport and metabolism]; Region: Gsp; COG0754
529507001004	HMMPfam hit to PF05257, CHAP domain, score 1.1e-26
529507001005	1 probable transmembrane helix predicted for PMI0183 by TMHMM2.0 at aa 66-85
529507001006	HMMPfam hit to PF03738, Glutathionylspermidine synthase, score 2.3e-15
529507001007	DNA-binding transcriptional regulator DsdC; Provisional; Region: PRK10086
529507001008	Bacterial regulatory helix-turn-helix protein, lysR family; Region: HTH_1; pfam00126
529507001009	The C-terminal substrate domain of LysR-type GcdR, TrPI, HvR and beta-lactamase regulators, and that of other closely related homologs; contains the type 2 periplasmic binding fold; Region: PBP2_GcdR_TrpI_HvrB_AmpR_like; cd08432
529507001010	dimerization interface [polypeptide binding]; other site
529507001011	substrate binding pocket [chemical binding]; other site
529507001012	HMMPfam hit to PF03466, LysR substrate binding domain, score 1.8e-24
529507001013	HMMPfam hit to PF00126, Bacterial regulatory helix-turn-helix, score 1.6e-19
529507001014	PS00044 Bacterial regulatory proteins, lysR family signature.
529507001015	Predicted helix-turn-helix motif with score 1632.000, SD 4.75 at aa 32-53, sequence LSFALAAEELSLTPSAISHRIN
529507001016	permease DsdX; Provisional; Region: PRK09921
529507001017	gluconate transporter; Region: gntP; TIGR00791
529507001018	Signal peptide predicted for PMI0186 by SignalP 2.0 HMM (Signal peptide probability 0.709) with cleavage site probability 0.648 between residues 45 and 46
529507001019	12 probable transmembrane helices predicted for PMI0186 by TMHMM2.0 at aa 5-23, 27-44, 57-76, 104-126, 139-161, 176-198, 225-244, 259-281, 301-323, 343-365, 385-407 and 422-444
529507001020	HMMPfam hit to PF02447, GntP family permease, score 2e-215
529507001021	D-Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- or D-serine  to pyruvate and ammonia.  D-serine dehydratase serves as a detoxifying enzyme in most E. coli strains where D-serine is a competitive...; Region: D-Ser-dehyd; cd06447
529507001022	Pyridoxal-phosphate dependent enzyme; Region: PALP; pfam00291
529507001023	pyridoxal 5'-phosphate binding pocket [chemical binding]; other site
529507001024	catalytic residue [active]
529507001025	HMMPfam hit to PF00291, Pyridoxal-phosphate dependent enzyme, score 1.9e-47
529507001026	PS00165 Serine/threonine dehydratases pyridoxal-phosphate attachment site.
529507001027	ferric transporter ATP-binding subunit; Provisional; Region: fbpC; PRK11432
529507001028	ATP-binding cassette domain of the carbohydrate and solute transporters-like; Region: ABC_Carb_Solutes_like; cd03259
529507001029	Walker A/P-loop; other site
529507001030	ATP binding site [chemical binding]; other site
529507001031	Q-loop/lid; other site
529507001032	ABC transporter signature motif; other site
529507001033	Walker B; other site
529507001034	D-loop; other site
529507001035	H-loop/switch region; other site
529507001036	TOBE domain; Region: TOBE_2; pfam08402
529507001037	HMMPfam hit to PF00005, ABC transporter, score 3e-70
529507001038	PS00211 ABC transporters family signature.
529507001039	PS00017 ATP/GTP-binding site motif A (P-loop).
529507001040	ABC-type Fe3+ transport system, permease component [Inorganic ion transport and metabolism]; Region: ThiP; COG1178
529507001041	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
529507001042	dimer interface [polypeptide binding]; other site
529507001043	conserved gate region; other site
529507001044	putative PBP binding loops; other site
529507001045	ABC-ATPase subunit interface; other site
529507001046	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
529507001047	dimer interface [polypeptide binding]; other site
529507001048	conserved gate region; other site
529507001049	putative PBP binding loops; other site
529507001050	ABC-ATPase subunit interface; other site
529507001051	HMMPfam hit to PF00528, Binding-protein-dependent transport syst, score 7.8e-08
529507001052	15 probable transmembrane helices predicted for PMI0189 by TMHMM2.0 at aa 23-42, 57-79, 91-113, 118-137, 149-171, 204-226, 239-261, 281-303, 330-352, 387-409, 430-452, 496-518, 530-552, 619-641 and 662-684
529507001053	HMMPfam hit to PF00528, Binding-protein-dependent transport syst, score 1.2e-07
529507001054	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507001055	Bacterial extracellular solute-binding protein; Region: SBP_bac_11; pfam13531
529507001056	ABC-type Fe3+ transport system, periplasmic component [Inorganic ion transport and metabolism]; Region: AfuA; COG1840
529507001057	HMMPfam hit to PF01547, Bacterial extracellular solute-binding prot, score 7.5e-12
529507001058	Signal peptide predicted for PMI0190 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.892 between residues 25 and 26
529507001059	regulatory protein UhpC; Provisional; Region: PRK11663
529507001060	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507001061	putative substrate translocation pore; other site
529507001062	12 probable transmembrane helices predicted for PMI0191 by TMHMM2.0 at aa 19-41, 56-78, 85-107, 111-133, 145-167, 172-191, 235-257, 277-299, 311-330, 334-356, 368-390 and 400-422
529507001063	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 2.8e-54
529507001064	Signal transduction histidine kinase, glucose-6-phosphate specific [Signal transduction mechanisms]; Region: UhpB; COG3851
529507001065	MASE1; Region: MASE1; pfam05231
529507001066	Histidine kinase; Region: HisKA_3; pfam07730
529507001067	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
529507001068	ATP binding site [chemical binding]; other site
529507001069	Mg2+ binding site [ion binding]; other site
529507001070	G-X-G motif; other site
529507001071	HMMPfam hit to PF02518, Histidine kinase-, DNA gyrase B-, and HSP90, score 4.7e-14
529507001072	HMMPfam hit to PF07730, Histidine kinase, score 7.9e-16
529507001073	Predicted helix-turn-helix motif with score 1029.000, SD 2.69 at aa 355-376, sequence EQIERLAQQIHQSTRQLLRQLR
529507001074	HMMPfam hit to PF05231, MASE1, score 2.2e-52
529507001075	7 probable transmembrane helices predicted for PMI0192 by TMHMM2.0 at aa 7-29, 39-61, 82-104, 114-136, 143-165, 185-204 and 211-233
529507001076	Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription]; Region: CitB; COG2197
529507001077	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
529507001078	active site
529507001079	phosphorylation site [posttranslational modification]
529507001080	intermolecular recognition site; other site
529507001081	dimerization interface [polypeptide binding]; other site
529507001082	C-terminal DNA-binding domain of LuxR-like proteins. This domain contains a helix-turn-helix motif and binds DNA. Proteins belonging to this group are response regulators; some act as transcriptional activators, others as transcriptional repressors. Many...; Region: LuxR_C_like; cd06170
529507001083	DNA binding residues [nucleotide binding]
529507001084	dimerization interface [polypeptide binding]; other site
529507001085	HMMPfam hit to PF00196, Bacterial regulatory proteins, luxR fami, score 3.4e-22
529507001086	PS00622 Bacterial regulatory proteins, luxR family signature.
529507001087	Predicted helix-turn-helix motif with score 1056.000, SD 2.78 at aa 161-182, sequence INVKAIAVQLNLSHKTVHVHRA
529507001088	HMMPfam hit to PF00072, Response regulator receiver domain, score 2.4e-37
529507001089	Aspartate alpha-decarboxylase or L-aspartate 1-decarboxylase, a pyruvoyl group-dependent  decarboxylase in beta-alanine production; Region: Asp_decarbox; cd06919
529507001090	tetramerization interface [polypeptide binding]; other site
529507001091	active site
529507001092	HMMPfam hit to PF02261, Aspartate decarboxylase, score 1.6e-82
529507001093	Pantoate-beta-alanine ligase; Region: PanC; cd00560
529507001094	pantoate--beta-alanine ligase; Region: panC; TIGR00018
529507001095	active site
529507001096	ATP-binding site [chemical binding]; other site
529507001097	pantoate-binding site; other site
529507001098	HXXH motif; other site
529507001099	HMMPfam hit to PF02569, Pantoate-beta-alanine ligase, score 8.1e-137
529507001100	Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway. Ketopantoate hydroxymethyltransferase (KPHMT) catalyzes the first committed step in the biosynthesis of pantothenate (vitamin B5), which is a...; Region: KPHMT-like; cd06557
529507001101	oligomerization interface [polypeptide binding]; other site
529507001102	active site
529507001103	metal binding site [ion binding]; metal-binding site
529507001104	HMMPfam hit to PF02548, Ketopantoate hydroxymethyltransferase, score 4.9e-151
529507001105	7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK). Folate derivatives are essential cofactors in the biosynthesis of purines, pyrimidines, and amino acids as well as formyl-tRNA. Mammalian cells are able to utilize pre-formed folates after...; Region: HPPK; cd00483
529507001106	catalytic center binding site [active]
529507001107	ATP binding site [chemical binding]; other site
529507001108	HMMPfam hit to PF01288, 7,8-dihydro-6-hydroxymethylpterin-pyrophosph, score 8.8e-64
529507001109	PS00794 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase signature.
529507001110	poly(A) polymerase; Region: pcnB; TIGR01942
529507001111	Nucleotidyltransferase (NT) domain of ClassII CCA-adding enzymes; Region: NT_ClassII-CCAase; cd05398
529507001112	active site
529507001113	NTP binding site [chemical binding]; other site
529507001114	metal binding triad [ion binding]; metal-binding site
529507001115	Probable RNA and SrmB- binding site of polymerase A; Region: PolyA_pol_RNAbd; pfam12627
529507001116	Polymerase A arginine-rich C-terminus; Region: PolyA_pol_arg_C; pfam12626
529507001117	HMMPfam hit to PF01743, Poly A polymerase family, score 1.2e-67
529507001118	Signal peptide predicted for PMI0199 by SignalP 2.0 HMM (Signal peptide probability 0.746) with cleavage site probability 0.742 between residues 31 and 32
529507001119	RNA polymerase-binding transcription factor; Provisional; Region: dksA; PRK10778
529507001120	HMMPfam hit to PF01258, Prokaryotic dksA/traR C4-type zinc finge, score 4.6e-35
529507001121	PS01102 Prokaryotic dksA/traR C4-type zinc finger.
529507001122	putative DNA-binding transcriptional regulator; Reviewed; Region: PRK00347
529507001123	HMMPfam hit to PF03749, Sugar fermentation stimulation protein, score 6.2e-107
529507001124	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507001125	ATP-dependent RNA helicase HrpB; Provisional; Region: PRK11664
529507001126	DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region; Region: DEXDc; cd00046
529507001127	ATP binding site [chemical binding]; other site
529507001128	putative Mg++ binding site [ion binding]; other site
529507001129	Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may...; Region: HELICc; cd00079
529507001130	nucleotide binding region [chemical binding]; other site
529507001131	ATP-binding site [chemical binding]; other site
529507001132	Helicase associated domain (HA2) Add an annotation; Region: HA2; smart00847
529507001133	ATP-dependent helicase C-terminal; Region: HrpB_C; pfam08482
529507001134	HMMPfam hit to PF00270, DEAD/DEAH box helicase, score 2.6e-11
529507001135	PS00017 ATP/GTP-binding site motif A (P-loop).
529507001136	HMMPfam hit to PF00271, Helicase conserved C-terminal domain, score 3.9e-11
529507001137	HMMPfam hit to PF04408, Helicase associated domain (HA2), score 0.00039
529507001138	bifunctional glycosyl transferase/transpeptidase; Reviewed; Region: mrcB; PRK09506
529507001139	Transglycosylase; Region: Transgly; pfam00912
529507001140	Penicillin binding protein transpeptidase domain; Region: Transpeptidase; cl17760
529507001141	Signal peptide predicted for PMI0204 by SignalP 2.0 HMM (Signal peptide probability 0.997) with cleavage site probability 0.925 between residues 41 and 42
529507001142	1 probable transmembrane helix predicted for PMI0204 by TMHMM2.0 at aa 17-39
529507001143	HMMPfam hit to PF00912, Transglycosylase, score 3.6e-82
529507001144	HMMPfam hit to PF00905, Penicillin binding protein transpeptid, score 1.2e-20
529507001145	glutamate-1-semialdehyde aminotransferase; Provisional; Region: PRK00062
529507001146	Acetyl ornithine aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD correspond to ornithine aminotransferase, acetylornithine aminotransferase; Region: OAT_like; cd00610
529507001147	inhibitor-cofactor binding pocket; inhibition site
529507001148	pyridoxal 5'-phosphate binding site [chemical binding]; other site
529507001149	catalytic residue [active]
529507001150	HMMPfam hit to PF00202, Aminotransferase class-III, score 9.3e-119
529507001151	PS00600 Aminotransferases class-III pyridoxal-phosphate attachment site.
529507001152	iron-sulfur cluster insertion protein ErpA; Provisional; Region: PRK13623
529507001153	HMMPfam hit to PF01521, HesB-like domain, score 1.6e-56
529507001154	PS01152 Hypothetical hesB/yadR/yfhF family signature.
529507001155	type VI secretion system effector, Hcp1 family; Region: VI_effect_Hcp1; TIGR03344
529507001156	HMMPfam hit to PF05638, Protein of unknown function (DUF796), score 1.3e-82
529507001157	type VI secretion system Vgr family protein; Region: VI_Rhs_Vgr; TIGR03361
529507001158	Phage late control gene D protein (GPD); Region: Phage_GPD; pfam05954
529507001159	Phage-related baseplate assembly protein; Region: Phage_base_V; pfam04717
529507001160	Putative type VI secretion system Rhs element Vgr; Region: T6SS_Vgr; pfam13296
529507001161	Uncharacterized protein conserved in bacteria (DUF2345); Region: DUF2345; cl01733
529507001162	HMMPfam hit to PF04524, Protein of unknown function, DUF586, score 1.2e-43
529507001163	Domain of unknown function (DUF4123); Region: DUF4123; pfam13503
529507001164	Lipase (class 3).  Lipases are esterases that can hydrolyze long-chain acyl-triglycerides into di- and monoglycerides, glycerol, and free fatty acids at a water/lipid interface.  A typical feature of lipases is "interfacial activation," the...; Region: Lipase_3; cd00519
529507001165	active site flap/lid [active]
529507001166	nucleophilic elbow; other site
529507001167	catalytic triad [active]
529507001168	HMMPfam hit to PF01764, Lipase (class 3), score 4.7e-25
529507001169	Signal peptide predicted for PMI0211 by SignalP 2.0 HMM (Signal peptide probability 0.933) with cleavage site probability 0.596 between residues 28 and 29
529507001170	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507001171	vitamin B12-transporter protein BtuF; Provisional; Region: PRK03379
529507001172	Cobalamin binding protein BtuF.  These proteins have been shown to function as initial receptors in ABC transport of vitamin B12 (cobalamin) in eubacterial and some archaeal species.  They belong to the TroA superfamily of helical backbone metal receptor...; Region: BtuF; cd01144
529507001173	cobalamin binding residues [chemical binding]; other site
529507001174	putative BtuC binding residues; other site
529507001175	dimer interface [polypeptide binding]; other site
529507001176	HMMPfam hit to PF01497, Periplasmic binding protein, score 2.2e-30
529507001177	1 probable transmembrane helix predicted for PMI0213 by TMHMM2.0 at aa 13-30
529507001178	Signal peptide predicted for PMI0213 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.993 between residues 29 and 30
529507001179	5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase; Validated; Region: PRK05584
529507001180	5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase; Region: MTA/SAH-Nsdase; TIGR01704
529507001181	HMMPfam hit to PF01048, Phosphorylase family, score 1.4e-95
529507001182	deoxyguanosinetriphosphate triphosphohydrolase; Provisional; Region: dgt; PRK04926
529507001183	Metal dependent phosphohydrolases with conserved 'HD' motif; Region: HDc; cd00077
529507001184	Zn2+ binding site [ion binding]; other site
529507001185	Mg2+ binding site [ion binding]; other site
529507001186	Phosphohydrolase-associated domain; Region: HD_assoc; pfam13286
529507001187	HMMPfam hit to PF01966, HD domain, score 0.00022
529507001188	23S rRNA m(5)U1939 methyltransferase; Reviewed; Region: rumA; PRK13168
529507001189	TRAM domain; Region: TRAM; pfam01938
529507001190	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
529507001191	S-adenosylmethionine binding site [chemical binding]; other site
529507001192	HMMPfam hit to PF01938, TRAM domain, score 4e-10
529507001193	HMMPfam hit to PF05958, tRNA (Uracil-5-)-methyltransferase, score 1.1e-09
529507001194	PS01230 RNA methyltransferase trmA family signature 1.
529507001195	PS01231 RNA methyltransferase trmA family signature 2.
529507001196	(p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional; Region: relA; PRK10872
529507001197	HD domain; Region: HD_4; pfam13328
529507001198	Nucleotidyltransferase (NT) domain of RelA- and SpoT-like ppGpp synthetases and hydrolases; Region: NT_Rel-Spo_like; cd05399
529507001199	synthetase active site [active]
529507001200	NTP binding site [chemical binding]; other site
529507001201	metal binding site [ion binding]; metal-binding site
529507001202	TGS_RelA_SpoT: The RelA (SpoT) protein, also referred to as ppGpp hydrolase/synthetase, is a ribosome-associated protein that is activated during amino acid starvation and thought to mediate the stringent response. RelA contains a TGS domain, named after...; Region: TGS_RelA_SpoT; cd01668
529507001203	ACT  domain found C-terminal of the RelA/SpoT domains; Region: ACT_RelA-SpoT; cd04876
529507001204	HMMPfam hit to PF04607, Region found in RelA / SpoT proteins, score 9.3e-49
529507001205	HMMPfam hit to PF02824, TGS domain, score 5.7e-32
529507001206	HMMPfam hit to PF01842, ACT domain, score 1e-13
529507001207	nucleoside triphosphate pyrophosphohydrolase; Reviewed; Region: mazG; PRK09562
529507001208	Nucleoside Triphosphate Pyrophosphohydrolase (EC 3.6.1.8) N-terminal tandem-domain of MazG proteins from Escherichia coli and bacterial homologs; Region: NTP-PPase_MazG_Nterm; cd11528
529507001209	homodimer interface [polypeptide binding]; other site
529507001210	metal binding site [ion binding]; metal-binding site
529507001211	Nucleoside Triphosphate Pyrophosphohydrolase (EC 3.6.1.8) C-terminal tandem-domain of MazG proteins from Escherichia coli and bacterial homologs' Region: NTP-PPase_MazG_Cterm; cd11529
529507001212	homodimer interface [polypeptide binding]; other site
529507001213	active site
529507001214	putative chemical substrate binding site [chemical binding]; other site
529507001215	metal binding site [ion binding]; metal-binding site
529507001216	HMMPfam hit to PF03819, MazG nucleotide pyrophosphohydrolase domain, score 8.6e-42
529507001217	HMMPfam hit to PF03819, MazG nucleotide pyrophosphohydrolase domain, score 2.9e-06
529507001218	CTP synthetase; Validated; Region: pyrG; PRK05380
529507001219	CTP synthetase (CTPs) is a two-domain protein, which consists of an N-terminal synthetase domain and C-terminal glutaminase domain. The enzymes hydrolyze the amide bond of glutamine to ammonia and glutamate at the glutaminase domains and transfer nascent...; Region: CTGs; cd03113
529507001220	Catalytic site [active]
529507001221	active site
529507001222	UTP binding site [chemical binding]; other site
529507001223	Type 1 glutamine amidotransferase (GATase1) domain found in Cytidine Triphosphate Synthetase; Region: GATase1_CTP_Synthase; cd01746
529507001224	active site
529507001225	putative oxyanion hole; other site
529507001226	catalytic triad [active]
529507001227	Signal peptide predicted for PMI0220 by SignalP 2.0 HMM (Signal peptide probability 0.974) with cleavage site probability 0.942 between residues 26 and 27
529507001228	HMMPfam hit to PF06418, CTP synthase N-terminus, score 7.5e-216
529507001229	1 probable transmembrane helix predicted for PMI0220 by TMHMM2.0 at aa 7-29
529507001230	HMMPfam hit to PF00117, Glutamine amidotransferase class-I, score 1.9e-76
529507001231	PS00442 Glutamine amidotransferases class-I active site.
529507001232	enolase; Provisional; Region: eno; PRK00077
529507001233	Enolase: Enolases are homodimeric enzymes that catalyse the reversible dehydration of 2-phospho-D-glycerate to phosphoenolpyruvate as part of the glycolytic and gluconeogenesis pathways. The reaction is facilitated by the presence of metal ions; Region: enolase; cd03313
529507001234	dimer interface [polypeptide binding]; other site
529507001235	metal binding site [ion binding]; metal-binding site
529507001236	substrate binding pocket [chemical binding]; other site
529507001237	HMMPfam hit to PF03952, Enolase, N-terminal domain, score 2.9e-70
529507001238	HMMPfam hit to PF00113, Enolase, C-terminal TIM barrel domain, score 1.5e-180
529507001239	PS00164 Enolase signature.
529507001240	Di- and tricarboxylate transporters [Inorganic ion transport and metabolism]; Region: CitT; COG0471
529507001241	Permease SLC13 (solute carrier 13).  The sodium/dicarboxylate cotransporter NaDC-1 has been shown to translocate Krebs cycle intermediates such as succinate, citrate, and alpha-ketoglutarate across plasma membranes rabbit, human, and rat kidney. It is...; Region: SLC13_permease; cd01115
529507001242	transmembrane helices; other site
529507001243	HMMPfam hit to PF00939, Sodium:sulfate symporter transmembrane, score 3.5e-15
529507001244	13 probable transmembrane helices predicted for PMI0222 by TMHMM2.0 at aa 20-39, 59-81, 94-113, 142-164, 176-198, 213-235, 264-286, 291-310, 317-339, 354-371, 378-400, 404-426 and 439-458
529507001245	PS01271 Sodium:sulfate symporter family signature.
529507001246	Pyruvate decarboxylase and related thiamine pyrophosphate-requiring enzymes [Carbohydrate transport and metabolism / Coenzyme metabolism / General function prediction only]; Region: COG3961
529507001247	Pyrimidine (PYR) binding domain of pyruvate decarboxylase (PDC), indolepyruvate decarboxylase (IPDC) and related proteins; Region: TPP_PYR_PDC_IPDC_like; cd07038
529507001248	dimer interface [polypeptide binding]; other site
529507001249	PYR/PP interface [polypeptide binding]; other site
529507001250	TPP binding site [chemical binding]; other site
529507001251	Thiamine pyrophosphate enzyme, central domain; Region: TPP_enzyme_M; pfam00205
529507001252	Thiamine pyrophosphate (TPP) family, PDC_IPDC subfamily, TPP-binding module; composed of proteins similar to pyruvate decarboxylase (PDC) and indolepyruvate decarboxylase (IPDC). PDC, a key enzyme in alcoholic fermentation, catalyzes the conversion of...; Region: TPP_PDC_IPDC; cd02005
529507001253	TPP-binding site [chemical binding]; other site
529507001254	dimer interface [polypeptide binding]; other site
529507001255	HMMPfam hit to PF02776, Thiamine pyrophosphate enzyme, N-termina, score 1.3e-42
529507001256	HMMPfam hit to PF00205, Thiamine pyrophosphate enzyme, central d, score 0.00028
529507001257	PS00290 Immunoglobulins and major histocompatibility complex proteins signature.
529507001258	membrane-bound lytic murein transglycosylase D; Provisional; Region: mltD; PRK10783
529507001259	Lytic Transglycosylase (LT)  and Goose Egg White Lysozyme (GEWL) domain. Members include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as, the eukaryotic "goose-type" lysozymes (GEWL).  LTs...; Region: LT_GEWL; cd00254
529507001260	N-acetyl-D-glucosamine binding site [chemical binding]; other site
529507001261	catalytic residue [active]
529507001262	Lysine Motif is a small domain involved in binding peptidoglycan; Region: LysM; cd00118
529507001263	Lysine Motif is a small domain involved in binding peptidoglycan; Region: LysM; cd00118
529507001264	HMMPfam hit to PF01476, LysM domain, score 1.5e-09
529507001265	HMMPfam hit to PF01476, LysM domain, score 1.2e-16
529507001266	HMMPfam hit to PF01464, Transglycosylase SLT domain, score 2.9e-33
529507001267	PS00922 Prokaryotic transglycosylases signature.
529507001268	HMMPfam hit to PF06474, MLTD_N, score 1.9e-10
529507001269	Signal peptide predicted for PMI0224 by SignalP 2.0 HMM (Signal peptide probability 0.974) with cleavage site probability 0.524 between residues 19 and 20
529507001270	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507001271	hydroxyacylglutathione hydrolase; Region: GSH_gloB; TIGR03413
529507001272	HMMPfam hit to PF00753, Metallo-beta-lactamase superfamily, score 4.6e-32
529507001273	PS00430 TonB-dependent receptor proteins signature 1.
529507001274	Methyltransferase domain; Region: Methyltransf_11; pfam08241
529507001275	RNase HI family found mainly in prokaryotes; Region: RNase_HI_prokaryote_like; cd09278
529507001276	RNA/DNA hybrid binding site [nucleotide binding]; other site
529507001277	active site
529507001278	HMMPfam hit to PF00075, RNase H, score 5.7e-65
529507001279	DNA polymerase III, epsilon subunit, Proteobacterial; Region: dnaQ_proteo; TIGR01406
529507001280	DEDDh 3'-5' exonuclease domain of the epsilon subunit of Escherichia coli DNA polymerase III and similar proteins; Region: DNA_pol_III_epsilon_Ecoli_like; cd06131
529507001281	active site
529507001282	catalytic site [active]
529507001283	substrate binding site [chemical binding]; other site
529507001284	HMMPfam hit to PF00929, Exonuclease, score 2.1e-48
529507001285	ABC-type enterobactin transport system, permease component [Inorganic ion transport and metabolism]; Region: FepG; COG4779
529507001286	Transmembrane subunit (TM), of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters involved in the uptake of siderophores, heme, vitamin B12, or the divalent cations Mg2+ and Zn2+. PBP-dependent ABC transporters consist of...; Region: TM_ABC_iron-siderophores_like; cl00462
529507001287	Transmembrane subunit (TM), of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters involved in the uptake of siderophores, heme, vitamin B12, or the divalent cations Mg2+ and Zn2+. PBP-dependent ABC transporters consist of...; Region: TM_ABC_iron-siderophores_like; cd06550
529507001288	ABC-ATPase subunit  interface; other site
529507001289	dimer interface [polypeptide binding]; other site
529507001290	putative PBP binding regions; other site
529507001291	9 probable transmembrane helices predicted for PMI0229 by TMHMM2.0 at aa 31-53, 82-104, 116-138, 143-162, 175-197, 222-244, 269-291, 306-325 and 332-354
529507001292	HMMPfam hit to PF01032, FecCD transport family, score 4.6e-93
529507001293	ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]; Region: FepC; COG1120
529507001294	ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins; Region: ABC_Iron-Siderophores_B12_Hemin; cd03214
529507001295	Walker A/P-loop; other site
529507001296	ATP binding site [chemical binding]; other site
529507001297	Q-loop/lid; other site
529507001298	ABC transporter signature motif; other site
529507001299	Walker B; other site
529507001300	D-loop; other site
529507001301	H-loop/switch region; other site
529507001302	HMMPfam hit to PF00005, ABC transporter, score 1.6e-46
529507001303	PS00017 ATP/GTP-binding site motif A (P-loop).
529507001304	PS00211 ABC transporters family signature.
529507001305	Citrate lyase beta subunit [Carbohydrate transport and metabolism]; Region: CitE; COG2301
529507001306	HMMPfam hit to PF03328, HpcH/HpaI aldolase/citrate lyase family, score 2.6e-13
529507001307	IucA / IucC family; Region: IucA_IucC; pfam04183
529507001308	Ferric iron reductase FhuF-like transporter; Region: FhuF; pfam06276
529507001309	HMMPfam hit to PF04183, IucA / IucC family, score 1.2e-101
529507001310	TonB-dependent siderophore receptor; Region: TonB-siderophor; TIGR01783
529507001311	TonB dependent/Ligand-Gated channels are created by a monomeric 22 strand (22,24) anti-parallel beta-barrel. Ligands apparently bind to the large extracellular loops. The N-terminal 150-200 residues form a plug from the periplasmic end of barrel; Region: ligand_gated_channel; cd01347
529507001312	N-terminal plug; other site
529507001313	ligand-binding site [chemical binding]; other site
529507001314	Signal peptide predicted for PMI0233 by SignalP 2.0 HMM (Signal peptide probability 0.966) with cleavage site probability 0.764 between residues 23 and 24
529507001315	HMMPfam hit to PF07715, TonB-dependent Receptor Plug Domain, score 4.5e-16
529507001316	HMMPfam hit to PF00593, TonB dependent receptor, score 1.5e-26
529507001317	This hit extended beyond the end of the feature by 1 aa and was clipped.; PS01156 TonB-dependent receptor proteins signature 2.
529507001318	Diaminopimelate decarboxylase [Amino acid transport and metabolism]; Region: LysA; COG0019
529507001319	Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Y4yA; Region: PLPDE_III_Y4yA_like; cd06842
529507001320	dimer interface [polypeptide binding]; other site
529507001321	active site
529507001322	pyridoxal 5'-phosphate (PLP) binding site [chemical binding]; other site
529507001323	catalytic residues [active]
529507001324	substrate binding site [chemical binding]; other site
529507001325	HMMPfam hit to PF02784, Pyridoxal-dependent decarboxylase, pyri, score 7.1e-10
529507001326	PS00879 Orn/DAP/Arg decarboxylases family 2 signature 2.
529507001327	Cysteine synthase [Amino acid transport and metabolism]; Region: CysK; COG0031
529507001328	CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase. CBS is a unique heme-containing enzyme that catalyzes a pyridoxal 5'-phosphate (PLP)-dependent condensation of serine and homocysteine to give cystathionine; Region: CBS_like; cd01561
529507001329	dimer interface [polypeptide binding]; other site
529507001330	pyridoxal 5'-phosphate binding site [chemical binding]; other site
529507001331	catalytic residue [active]
529507001332	HMMPfam hit to PF00291, Pyridoxal-phosphate dependent enzyme, score 5.4e-68
529507001333	NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; Region: NAD_Gly3P_dh_N; pfam01210
529507001334	NAD/NADP octopine/nopaline dehydrogenase, alpha-helical domain; Region: Octopine_DH; pfam02317
529507001335	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507001336	Major Facilitator Superfamily; Region: MFS_1; pfam07690
529507001337	putative substrate translocation pore; other site
529507001338	12 probable transmembrane helices predicted for PMI0237 by TMHMM2.0 at aa 7-26, 46-68, 81-103, 108-130, 137-159, 164-186, 211-233, 253-275, 282-304, 309-331, 343-365 and 369-391
529507001339	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 8.2e-36
529507001340	ferrichrome/ferrioxamine B periplasmic transporter; Provisional; Region: PRK14048
529507001341	Periplasmic binding protein TroA_f.  These proteins are predicted to function as initial receptors in the ABC metal ion uptake in eubacteria and archaea.  They belong to the TroA superfamily of helical backbone metal receptor proteins that share a...; Region: TroA_f; cd01139
529507001342	putative ligand binding residues [chemical binding]; other site
529507001343	Signal peptide predicted for PMI0238 by SignalP 2.0 HMM (Signal peptide probability 0.997) with cleavage site probability 0.942 between residues 19 and 20
529507001344	HMMPfam hit to PF01497, Periplasmic binding protein, score 3.9e-05
529507001345	Stage 0 sporulation protein J (antagonist of Soj) containing ParB-like nuclease domain [Transcription]; Region: Spo0J; COG1475
529507001346	ParB-like nuclease domain; Region: ParBc; cl02129
529507001347	transketolase; Reviewed; Region: PRK12753
529507001348	Thiamine pyrophosphate (TPP) family, Transketolase (TK) subfamily, TPP-binding module; TK catalyzes the transfer of a two-carbon unit from ketose phosphates to aldose phosphates. In heterotrophic organisms, TK provides a link between glycolysis and the...; Region: TPP_TK; cd02012
529507001349	TPP-binding site [chemical binding]; other site
529507001350	dimer interface [polypeptide binding]; other site
529507001351	Pyrimidine (PYR) binding domain of 1-deoxy-D-xylulose-5-phosphate synthase (DXS), transketolase (TK), and related proteins; Region: TPP_PYR_DXS_TK_like; cd07033
529507001352	PYR/PP interface [polypeptide binding]; other site
529507001353	dimer interface [polypeptide binding]; other site
529507001354	TPP binding site [chemical binding]; other site
529507001355	Transketolase, C-terminal domain; Region: Transketolase_C; pfam02780
529507001356	HMMPfam hit to PF00456, Transketolase, thiamine diphosphate b, score 9.9e-244
529507001357	PS00801 Transketolase signature 1.
529507001358	HMMPfam hit to PF02779, Transketolase, pyridine binding domai, score 1.7e-66
529507001359	PS00802 Transketolase signature 2.
529507001360	HMMPfam hit to PF02780, Transketolase, C-terminal domain, score 1.3e-13
529507001361	erythrose 4-phosphate dehydrogenase; Provisional; Region: PRK13535
529507001362	Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; Region: Gp_dh_N; smart00846
529507001363	Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain; Region: Gp_dh_C; pfam02800
529507001364	HMMPfam hit to PF00044, Glyceraldehyde 3-phosphate dehydrogenase, NA, score 2e-74
529507001365	PS00071 Glyceraldehyde 3-phosphate dehydrogenase active site.
529507001366	HMMPfam hit to PF02800, Glyceraldehyde 3-phosphate dehydrogenase, C-, score 9.3e-73
529507001367	HMMPfam hit to PF00162, Phosphoglycerate kinase, score 1.1e-212
529507001368	Phosphoglycerate kinase (PGK) is a monomeric enzyme which catalyzes the transfer of the high-energy phosphate group of 1,3-bisphosphoglycerate to ADP, forming ATP and 3-phosphoglycerate. This reaction represents the first of the two substrate-level...; Region: Phosphoglycerate_kinase; cd00318
529507001369	Phosphoglycerate kinase; Region: PGK; pfam00162
529507001370	substrate binding site [chemical binding]; other site
529507001371	hinge regions; other site
529507001372	ADP binding site [chemical binding]; other site
529507001373	catalytic site [active]
529507001374	PS00111 Phosphoglycerate kinase signature.
529507001375	fructose-bisphosphate aldolase; Provisional; Region: PRK09197
529507001376	Class II Type A, Fructose-1,6-bisphosphate (FBP) aldolases. The enzyme catalyses the zinc-dependent, reversible aldol condensation of dihydroxyacetone phosphate with glyceraldehyde-3-phosphate to form fructose-1,6-bisphosphate. FBP aldolase is...; Region: FBP_aldolase_IIA; cd00946
529507001377	active site
529507001378	intersubunit interface [polypeptide binding]; other site
529507001379	zinc binding site [ion binding]; other site
529507001380	Na+ binding site [ion binding]; other site
529507001381	HMMPfam hit to PF01116, Fructose-bisphosphate aldolase class-II, score 3.4e-204
529507001382	PS00602 Fructose-bisphosphate aldolase class-II signature 1.
529507001383	PS00806 Fructose-bisphosphate aldolase class-II signature 2.
529507001384	Predicted membrane protein [Function unknown]; Region: XynA; COG2314
529507001385	2 probable transmembrane helices predicted for PMI0244 by TMHMM2.0 at aa 7-26 and 36-58
529507001386	HMMPfam hit to PF05154, TM2 domain, score 1.8e-16
529507001387	dipeptide/tripeptide permease B; Provisional; Region: PRK10207
529507001388	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507001389	putative substrate translocation pore; other site
529507001390	POT family; Region: PTR2; pfam00854
529507001391	14 probable transmembrane helices predicted for PMI0245 by TMHMM2.0 at aa 20-42, 52-74, 83-105, 109-131, 144-166, 171-193, 214-231, 235-257, 270-287, 315-337, 350-372, 387-409, 416-438 and 458-480
529507001392	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 3.3e-05
529507001393	HMMPfam hit to PF00854, POT family, score 5.2e-99
529507001394	PS01023 PTR2 family proton/oligopeptide symporters signature 2.
529507001395	PS01022 PTR2 family proton/oligopeptide symporters signature 1.
529507001396	Flavin Reductases; Region: FlaRed; cl00801
529507001397	HMMPfam hit to PF01613, Flavin reductase like domain, score 1.6e-54
529507001398	homoprotocatechuate degradation operon regulator, HpaR; Region: HpaR; TIGR02337
529507001399	helix_turn_helix multiple antibiotic resistance protein; Region: HTH_MARR; smart00347
529507001400	HMMPfam hit to PF01047, MarR family, score 4.2e-23
529507001401	BCCT family transporter; Region: BCCT; cl00569
529507001402	HMMPfam hit to PF02028, BCCT family transporter, score 2.1e-232
529507001403	12 probable transmembrane helices predicted for PMI0249 by TMHMM2.0 at aa 37-59, 74-93, 113-135, 168-190, 210-232, 252-271, 283-305, 336-358, 371-390, 422-444, 471-493 and 497-516
529507001404	PS01303 BCCT family of transporters signature.
529507001405	HMMPfam hit to PF05115, Cytochrome B6-F complex subunit VI (PetL), score 0.15
529507001406	Signal peptide predicted for PMI0249 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.975 between residues 59 and 60
529507001407	ATP synthase B/B' CF(0); Region: ATP-synt_B; cl17192
529507001408	Apolipoprotein A1/A4/E domain; Region: Apolipoprotein; pfam01442
529507001409	HMMPfam hit to PF02987, Late embryogenesis abundant protein, score 2.6e-05
529507001410	HMMPfam hit to PF02987, Late embryogenesis abundant protein, score 0.0004
529507001411	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507001412	Signal peptide predicted for PMI0250 by SignalP 2.0 HMM (Signal peptide probability 0.671) with cleavage site probability 0.639 between residues 36 and 37
529507001413	Predicted membrane protein [Function unknown]; Region: COG2323
529507001414	3 probable transmembrane helices predicted for PMI0251 by TMHMM2.0 at aa 4-26, 33-52 and 57-79
529507001415	HMMPfam hit to PF04239, Protein of unknown function (DUF421), score 6.4e-21
529507001416	ribonuclease Z; Region: RNase_Z; TIGR02651
529507001417	HMMPfam hit to PF00753, Metallo-beta-lactamase superfamily, score 1e-09
529507001418	1 probable transmembrane helix predicted for PMI0253 by TMHMM2.0 at aa 10-27
529507001419	fimbrial operon 1
529507001420	P pilus assembly protein, pilin FimA [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimA; COG3539
529507001421	Signal peptide predicted for PMI0254 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 1.000 between residues 23 and 24
529507001422	HMMPfam hit to PF00419, Fimbrial protein, score 3.5e-50
529507001423	putative fimbrial outer membrane usher protein StfC; Provisional; Region: PRK15284
529507001424	PapC N-terminal domain; Region: PapC_N; pfam13954
529507001425	Type VII secretion system (T7SS), usher protein; Region: Usher; pfam00577
529507001426	PapC C-terminal domain; Region: PapC_C; pfam13953
529507001427	Signal peptide predicted for PMI0255 by SignalP 2.0 HMM (Signal peptide probability 0.901) with cleavage site probability 0.595 between residues 44 and 45
529507001428	1 probable transmembrane helix predicted for PMI0255 by TMHMM2.0 at aa 23-45
529507001429	HMMPfam hit to PF00577, Fimbrial Usher protein, score 0
529507001430	fimbrial chaperone (pseudogene);This CDS appears to have an in-frame stop codon.
529507001431	Signal peptide predicted for PMI0256 by SignalP 2.0 HMM (Signal peptide probability 0.988) with cleavage site probability 0.538 between residues 26 and 27
529507001432	1 probable transmembrane helix predicted for PMI0256 by TMHMM2.0 at aa 7-29
529507001433	HMMPfam hit to PF00345, Gram-negative pili assembly chaperone, score 8.6e-47
529507001434	PS00635 Gram-negative pili assembly chaperone signature.
529507001435	Fimbrial protein; Region: Fimbrial; pfam00419
529507001436	Signal peptide predicted for PMI0257 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.973 between residues 27 and 28
529507001437	1 probable transmembrane helix predicted for PMI0257 by TMHMM2.0 at aa 9-31
529507001438	Fimbrial protein; Region: Fimbrial; cl01416
529507001439	Signal peptide predicted for PMI0258 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.986 between residues 21 and 22
529507001440	Signal peptide predicted for PMI0259 by SignalP 2.0 HMM (Signal peptide probability 0.997) with cleavage site probability 0.512 between residues 38 and 39
529507001441	P pilus assembly protein, pilin FimA [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimA; COG3539
529507001442	HMMPfam hit to PF00419, Fimbrial protein, score 1.1e-21
529507001443	PapG chaperone-binding domain; Region: PapG_C; pfam03628
529507001444	Signal peptide predicted for PMI0260 by SignalP 2.0 HMM (Signal peptide probability 0.980) with cleavage site probability 0.977 between residues 25 and 26
529507001445	1 probable transmembrane helix predicted for PMI0260 by TMHMM2.0 at aa 9-31
529507001446	Predicted transcriptional regulators [Transcription]; Region: HipB; COG1396
529507001447	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
529507001448	non-specific DNA binding site [nucleotide binding]; other site
529507001449	salt bridge; other site
529507001450	sequence-specific DNA binding site [nucleotide binding]; other site
529507001451	HMMPfam hit to PF01381, Helix-turn-helix, score 2.9e-16
529507001452	Predicted helix-turn-helix motif with score 1977.000, SD 5.92 at aa 28-49, sequence YTGSQLAAKLGVSQQQFSRYER
529507001453	FimB and FimE and related proteins, DNA breaking-rejoining enzymes, integrase/recombinases, catalytic domain. This CD includes those proteins similar to E.coli FimE and FimB regulatory proteins and Proteus mirabilis MrpI; Region: INT_FimBE_C; cd01197
529507001454	Int/Topo IB signature motif; other site
529507001455	HMMPfam hit to PF00589, Phage integrase family, score 6.8e-44
529507001456	fimbrial operon 2 (MR/P fimbrial operon)
529507001457	Fimbrial protein; Region: Fimbrial; cl01416
529507001458	Signal peptide predicted for PMI0263 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 1.000 between residues 23 and 24
529507001459	1 probable transmembrane helix predicted for PMI0263 by TMHMM2.0 at aa 35-53
529507001460	HMMPfam hit to PF00419, Fimbrial protein, score 1.2e-59
529507001461	P pilus assembly protein, pilin FimA [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimA; COG3539
529507001462	Signal peptide predicted for PMI0264 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.968 between residues 23 and 24
529507001463	HMMPfam hit to PF00419, Fimbrial protein, score 1.7e-13
529507001464	putative fimbrial outer membrane usher protein StfC; Provisional; Region: PRK15284
529507001465	PapC N-terminal domain; Region: PapC_N; pfam13954
529507001466	Type VII secretion system (T7SS), usher protein; Region: Usher; pfam00577
529507001467	PapC C-terminal domain; Region: PapC_C; pfam13953
529507001468	Signal peptide predicted for PMI0265 by SignalP 2.0 HMM (Signal peptide probability 0.998) with cleavage site probability 0.943 between residues 44 and 45
529507001469	1 probable transmembrane helix predicted for PMI0265 by TMHMM2.0 at aa 21-43
529507001470	HMMPfam hit to PF00577, Fimbrial Usher protein, score 0
529507001471	PS01151 Fimbrial biogenesis outer membrane usher protein signature.
529507001472	putative fimbrial chaperone protein StfD; Provisional; Region: PRK15285
529507001473	Gram-negative pili assembly chaperone, N-terminal domain; Region: Pili_assembly_N; pfam00345
529507001474	Gram-negative pili assembly chaperone, C-terminal domain; Region: Pili_assembly_C; pfam02753
529507001475	Signal peptide predicted for PMI0266 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.987 between residues 26 and 27
529507001476	1 probable transmembrane helix predicted for PMI0266 by TMHMM2.0 at aa 7-29
529507001477	HMMPfam hit to PF00345, Gram-negative pili assembly chaperone, score 3.8e-46
529507001478	PS00635 Gram-negative pili assembly chaperone signature.
529507001479	HMMPfam hit to PF02753, Gram-negative pili assembly chaperone, score 1.2e-09
529507001480	Fimbrial protein; Region: Fimbrial; pfam00419
529507001481	Signal peptide predicted for PMI0267 by SignalP 2.0 HMM (Signal peptide probability 0.991) with cleavage site probability 0.859 between residues 31 and 32
529507001482	1 probable transmembrane helix predicted for PMI0267 by TMHMM2.0 at aa 13-35
529507001483	HMMPfam hit to PF00419, Fimbrial protein, score 0.00019
529507001484	Fimbrial protein; Region: Fimbrial; cl01416
529507001485	Signal peptide predicted for PMI0268 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 1.000 between residues 20 and 21
529507001486	P pilus assembly protein, pilin FimA [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimA; COG3539
529507001487	Signal peptide predicted for PMI0269 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.993 between residues 26 and 27
529507001488	1 probable transmembrane helix predicted for PMI0269 by TMHMM2.0 at aa 7-29
529507001489	HMMPfam hit to PF00419, Fimbrial protein, score 1e-17
529507001490	Signal peptide predicted for PMI0270 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.999 between residues 24 and 25
529507001491	1 probable transmembrane helix predicted for PMI0270 by TMHMM2.0 at aa 13-35
529507001492	Predicted transcriptional regulators [Transcription]; Region: HipB; COG1396
529507001493	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
529507001494	non-specific DNA binding site [nucleotide binding]; other site
529507001495	salt bridge; other site
529507001496	sequence-specific DNA binding site [nucleotide binding]; other site
529507001497	HMMPfam hit to PF01381, Helix-turn-helix, score 3.4e-14
529507001498	Predicted helix-turn-helix motif with score 1835.000, SD 5.44 at aa 32-53, sequence YTGMQLAKKIGVSQQQFSRYER
529507001499	p-Aminobenzoyl-glutamate transporter family; Region: ydaH; TIGR00819
529507001500	AbgT putative transporter family; Region: ABG_transport; pfam03806
529507001501	HMMPfam hit to PF03806, AbgT transporter family, score 0
529507001502	11 probable transmembrane helices predicted for PMI0272 by TMHMM2.0 at aa 21-43, 92-114, 131-153, 218-235, 272-291, 311-333, 354-376, 391-413, 420-437, 447-469 and 490-512
529507001503	PS00019 Actinin-type actin-binding domain signature 1.
529507001504	hypothetical protein; Provisional; Region: PRK10203
529507001505	Uncharacterized homolog of gamma-carboxymuconolactone decarboxylase subunit [Function unknown]; Region: COG0599
529507001506	HMMPfam hit to PF02627, Carboxymuconolactone decarboxylase family, score 1.3e-24
529507001507	4-amino-4-deoxy-L-arabinose transferase; Provisional; Region: arnT; PRK13279
529507001508	4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family [Cell envelope biogenesis, outer membrane]; Region: ArnT; COG1807
529507001509	HMMPfam hit to PF02366, Dolichyl-phosphate-mannose-protein mannosylt, score 3.2e-28
529507001510	12 probable transmembrane helices predicted for PMI0275 by TMHMM2.0 at aa 12-31, 84-103, 115-137, 141-158, 171-193, 208-230, 260-282, 292-309, 314-333, 348-370, 383-402 and 407-424
529507001511	type I secretion outer membrane protein, TolC family; Region: type_I_sec_TolC; TIGR01844
529507001512	HMMPfam hit to PF02321, Outer membrane efflux protein, score 1.9e-58
529507001513	HMMPfam hit to PF02321, Outer membrane efflux protein, score 2.9e-44
529507001514	1 probable transmembrane helix predicted for PMI0276 by TMHMM2.0 at aa 7-29
529507001515	Signal peptide predicted for PMI0276 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.994 between residues 22 and 23
529507001516	type I secretion membrane fusion protein, HlyD family; Region: type_I_hlyD; TIGR01843
529507001517	Biotin-lipoyl like; Region: Biotin_lipoyl_2; pfam13533
529507001518	HlyD family secretion protein; Region: HlyD_3; pfam13437
529507001519	PS00543 HlyD family secretion proteins signature.
529507001520	HMMPfam hit to PF00529, HlyD family secretion protein, score 2.3e-84
529507001521	1 probable transmembrane helix predicted for PMI0277 by TMHMM2.0 at aa 23-45
529507001522	ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only]; Region: ArpD; COG4618
529507001523	ATP-binding cassette domain of PrtD, subfamily C; Region: ABCC_Protease_Secretion; cd03246
529507001524	Walker A/P-loop; other site
529507001525	ATP binding site [chemical binding]; other site
529507001526	Q-loop/lid; other site
529507001527	ABC transporter signature motif; other site
529507001528	Walker B; other site
529507001529	D-loop; other site
529507001530	H-loop/switch region; other site
529507001531	HMMPfam hit to PF00005, ABC transporter, score 6.2e-54
529507001532	PS00211 ABC transporters family signature.
529507001533	PS00017 ATP/GTP-binding site motif A (P-loop).
529507001534	HMMPfam hit to PF00664, ABC transporter transmembrane region, score 0.015
529507001535	4 probable transmembrane helices predicted for PMI0278 by TMHMM2.0 at aa 22-44, 94-116, 122-144 and 221-243
529507001536	Zinc-dependent metalloprotease, serralysin_like subfamily. Serralysins and related proteases are important virulence factors in pathogenic bacteria. They may be secreted into the medium via a mechanism found in gram-negative bacteria, that does not...; Region: ZnMc_serralysin_like; cd04277
529507001537	active site
529507001538	Peptidase M10 serralysin C terminal; Region: Peptidase_M10_C; pfam08548
529507001539	HMMPfam hit to PF00353, Hemolysin-type calcium-binding repeat, score 0.0034
529507001540	HMMPfam hit to PF00353, Hemolysin-type calcium-binding repeat, score 6.5e-05
529507001541	HMMPfam hit to PF00353, Hemolysin-type calcium-binding repeat, score 0.0043
529507001542	HMMPfam hit to PF00413, Matrixin, score 0.00032
529507001543	PS00142 Neutral zinc metallopeptidases, zinc-binding region signature.
529507001544	Zinc-dependent metalloprotease, serralysin_like subfamily. Serralysins and related proteases are important virulence factors in pathogenic bacteria. They may be secreted into the medium via a mechanism found in gram-negative bacteria, that does not...; Region: ZnMc_serralysin_like; cd04277
529507001545	active site
529507001546	Peptidase M10 serralysin C terminal; Region: Peptidase_M10_C; pfam08548
529507001547	RTX toxins and related Ca2+-binding proteins [Secondary metabolites biosynthesis, transport, and catabolism]; Region: COG2931
529507001548	HMMPfam hit to PF00353, Hemolysin-type calcium-binding repeat, score 0.019
529507001549	HMMPfam hit to PF00353, Hemolysin-type calcium-binding repeat, score 0.059
529507001550	HMMPfam hit to PF00353, Hemolysin-type calcium-binding repeat, score 0.07
529507001551	PS00330 Hemolysin-type calcium-binding region signature.
529507001552	HMMPfam hit to PF00353, Hemolysin-type calcium-binding repeat, score 8.1e-05
529507001553	HMMPfam hit to PF00353, Hemolysin-type calcium-binding repeat, score 0.0012
529507001554	PS00330 Hemolysin-type calcium-binding region signature.
529507001555	HMMPfam hit to PF00353, Hemolysin-type calcium-binding repeat, score 0.0011
529507001556	PS00330 Hemolysin-type calcium-binding region signature.
529507001557	HMMPfam hit to PF00353, Hemolysin-type calcium-binding repeat, score 0.00056
529507001558	HMMPfam hit to PF00353, Hemolysin-type calcium-binding repeat, score 0.0087
529507001559	PS00142 Neutral zinc metallopeptidases, zinc-binding region signature.
529507001560	Zinc-dependent metalloprotease, serralysin_like subfamily. Serralysins and related proteases are important virulence factors in pathogenic bacteria. They may be secreted into the medium via a mechanism found in gram-negative bacteria, that does not...; Region: ZnMc_serralysin_like; cd04277
529507001561	active site
529507001562	Peptidase M10 serralysin C terminal; Region: Peptidase_M10_C; pfam08548
529507001563	HMMPfam hit to PF00353, Hemolysin-type calcium-binding repeat, score 4.2
529507001564	HMMPfam hit to PF00353, Hemolysin-type calcium-binding repeat, score 0.049
529507001565	HMMPfam hit to PF00353, Hemolysin-type calcium-binding repeat, score 4.7
529507001566	HMMPfam hit to PF00353, Hemolysin-type calcium-binding repeat, score 7.7e-06
529507001567	HMMPfam hit to PF00353, Hemolysin-type calcium-binding repeat, score 0.0016
529507001568	HMMPfam hit to PF00353, Hemolysin-type calcium-binding repeat, score 0.21
529507001569	PS00142 Neutral zinc metallopeptidases, zinc-binding region signature.
529507001570	Zinc-dependent metalloprotease, serralysin_like subfamily. Serralysins and related proteases are important virulence factors in pathogenic bacteria. They may be secreted into the medium via a mechanism found in gram-negative bacteria, that does not...; Region: ZnMc_serralysin_like; cd04277
529507001571	active site
529507001572	Peptidase M10 serralysin C terminal; Region: Peptidase_M10_C; pfam08548
529507001573	HMMPfam hit to PF00353, Hemolysin-type calcium-binding repeat, score 1.4
529507001574	HMMPfam hit to PF00353, Hemolysin-type calcium-binding repeat, score 0.049
529507001575	HMMPfam hit to PF00353, Hemolysin-type calcium-binding repeat, score 4.7
529507001576	HMMPfam hit to PF00353, Hemolysin-type calcium-binding repeat, score 7.7e-06
529507001577	HMMPfam hit to PF00353, Hemolysin-type calcium-binding repeat, score 0.0016
529507001578	HMMPfam hit to PF00353, Hemolysin-type calcium-binding repeat, score 0.21
529507001579	4 probable transmembrane helices predicted for PMI0284 by TMHMM2.0 at aa 20-42, 49-68, 72-94 and 115-137
529507001580	Domain of unknown function (DUF4200); Region: DUF4200; pfam13863
529507001581	Zinc-dependent metalloprotease. This super-family of metalloproteases contains two major branches, the astacin-like proteases and the adamalysin/reprolysin-like proteases. Both branches have wide phylogenetic distribution, and contain sub-families, which...; Region: ZnMc; cl00064
529507001582	Zinc-dependent metalloprotease. This super-family of metalloproteases contains two major branches, the astacin-like proteases and the adamalysin/reprolysin-like proteases. Both branches have wide phylogenetic distribution, and contain sub-families, which...; Region: ZnMc; cl00064
529507001583	Peptidase M10 serralysin C terminal; Region: Peptidase_M10_C; pfam08548
529507001584	RTX toxins and related Ca2+-binding proteins [Secondary metabolites biosynthesis, transport, and catabolism]; Region: COG2931
529507001585	HMMPfam hit to PF00353, Hemolysin-type calcium-binding repeat, score 1.4
529507001586	HMMPfam hit to PF00353, Hemolysin-type calcium-binding repeat, score 0.026
529507001587	HMMPfam hit to PF00353, Hemolysin-type calcium-binding repeat, score 4.7
529507001588	HMMPfam hit to PF00353, Hemolysin-type calcium-binding repeat, score 5.8e-06
529507001589	HMMPfam hit to PF00353, Hemolysin-type calcium-binding repeat, score 0.0016
529507001590	HMMPfam hit to PF00353, Hemolysin-type calcium-binding repeat, score 0.21
529507001591	PS00142 Neutral zinc metallopeptidases, zinc-binding region signature.
529507001592	Predicted transcriptional regulators [Transcription]; Region: HipB; COG1396
529507001593	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
529507001594	non-specific DNA binding site [nucleotide binding]; other site
529507001595	salt bridge; other site
529507001596	sequence-specific DNA binding site [nucleotide binding]; other site
529507001597	HMMPfam hit to PF01381, Helix-turn-helix, score 1.3e-11
529507001598	Predicted helix-turn-helix motif with score 1911.000, SD 5.70 at aa 27-48, sequence LKAEDVAESLGISRAAVYRLEK
529507001599	M20 Peptidase beta-alanine synthase, an amidohydrolase; Region: M20_bAS; cd03884
529507001600	allantoate amidohydrolase; Reviewed; Region: PRK09290
529507001601	active site
529507001602	metal binding site [ion binding]; metal-binding site
529507001603	dimer interface [polypeptide binding]; other site
529507001604	HMMPfam hit to PF01546, Peptidase family M20/M25/M40, score 4.7e-29
529507001605	HMMPfam hit to PF07687, Peptidase dimerisation domain, score 0.0036
529507001606	Maltoporin periplasmic N-terminal extension; Region: Sugarporin_N; pfam11471
529507001607	Signal peptide predicted for PMI0288 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.990 between residues 22 and 23
529507001608	beta-phosphoglucomutase; Region: bPGM; TIGR01990
529507001609	Haloacid dehalogenase-like hydrolases. The haloacid dehalogenase-like (HAD) superfamily includes L-2-haloacid dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, and many others; Region: HAD_like; cd01427
529507001610	motif II; other site
529507001611	HMMPfam hit to PF00702, haloacid dehalogenase-like hydrolase, score 4.3e-27
529507001612	Trehalose and maltose hydrolases (possible phosphorylases) [Carbohydrate transport and metabolism]; Region: ATH1; COG1554
529507001613	Glycosyl hydrolase family 65, N-terminal domain; Region: Glyco_hydro_65N; pfam03636
529507001614	Glycosyl hydrolase family 65 central catalytic domain; Region: Glyco_hydro_65m; pfam03632
529507001615	Glycosyl hydrolase family 65, C-terminal domain; Region: Glyco_hydro_65C; pfam03633
529507001616	HMMPfam hit to PF03632, Glycosyl hydrolase family, score 2.6e-140
529507001617	HMMPfam hit to PF03636, Glycosyl hydrolase family 65, N-termi, score 3.7e-37
529507001618	Predicted helix-turn-helix motif with score 1055.000, SD 2.78 at aa 241-262, sequence IHCTKFANMADMSHYAILYTFK
529507001619	PTS system trehalose(maltose)-specific transporter subunits IIBC; Provisional; Region: PRK11007
529507001620	PTS_IIB, PTS system, glucose/sucrose specific IIB subunit. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. This family...; Region: PTS_IIB_glc; cd00212
529507001621	active site turn [active]
529507001622	phosphorylation site [posttranslational modification]
529507001623	Phosphotransferase system IIC components, glucose/maltose/N-acetylglucosamine-specific [Carbohydrate transport and metabolism]; Region: PtsG; COG1263
529507001624	10 probable transmembrane helices predicted for PMI0291 by TMHMM2.0 at aa 107-129, 149-171, 184-206, 226-245, 257-279, 304-326, 339-361, 371-393, 400-419 and 439-461
529507001625	HMMPfam hit to PF02378, Phosphotransferase system, EIIC, score 5.9e-36
529507001626	HMMPfam hit to PF00367, phosphotransferase system, EIIB, score 1.2e-12
529507001627	PS01035 PTS EIIB domains cysteine phosphorylation site signature.
529507001628	trehalose repressor; Provisional; Region: treR; PRK09492
529507001629	Helix-turn-helix (HTH) DNA binding domain of the LacI family of transcriptional regulators; Region: HTH_LacI; cd01392
529507001630	DNA binding site [nucleotide binding]
529507001631	domain linker motif; other site
529507001632	Type 1 periplasmic binding fold superfamily; Region: Periplasmic_Binding_Protein_Type_1; cl10011
529507001633	HMMPfam hit to PF00532, Periplasmic binding proteins and sugar b, score 0.0015
529507001634	HMMPfam hit to PF00356, Bacterial regulatory proteins, lacI fami, score 9.7e-09
529507001635	Predicted helix-turn-helix motif with score 2310.000, SD 7.05 at aa 9-30, sequence LTINDIAKLCGVGKSTVSRVLN
529507001636	Signal peptide predicted for PMI0294 by SignalP 2.0 HMM (Signal peptide probability 0.977) with cleavage site probability 0.618 between residues 25 and 26
529507001637	Effector domain of response regulator. Bacteria and certain eukaryotes like protozoa and higher plants use two-component signal transduction systems to detect and respond to changes in the environment. The system consists of a sensor histidine kinase and...; Region: trans_reg_C; cl17355
529507001638	1 probable transmembrane helix predicted for PMI0295 by TMHMM2.0 at aa 164-185
529507001639	fimbrial operon 3
529507001640	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
529507001641	non-specific DNA binding site [nucleotide binding]; other site
529507001642	salt bridge; other site
529507001643	sequence-specific DNA binding site [nucleotide binding]; other site
529507001644	HMMPfam hit to PF01381, Helix-turn-helix, score 2.8e-15
529507001645	Predicted helix-turn-helix motif with score 2289.000, SD 6.98 at aa 34-55, sequence LTGEDLAKKLNVSQQQVSRYET
529507001646	P pilus assembly protein, pilin FimA [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimA; COG3539
529507001647	Signal peptide predicted for PMI0297 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.997 between residues 23 and 24
529507001648	HMMPfam hit to PF00419, Fimbrial protein, score 5.6e-23
529507001649	P pilus assembly protein, pilin FimA [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimA; COG3539
529507001650	Signal peptide predicted for PMI0298 by SignalP 2.0 HMM (Signal peptide probability 0.839) with cleavage site probability 0.799 between residues 29 and 30
529507001651	HMMPfam hit to PF00419, Fimbrial protein, score 1.2e-06
529507001652	putative fimbrial outer membrane usher protein StfC; Provisional; Region: PRK15284
529507001653	PapC N-terminal domain; Region: PapC_N; pfam13954
529507001654	Type VII secretion system (T7SS), usher protein; Region: Usher; pfam00577
529507001655	PapC C-terminal domain; Region: PapC_C; pfam13953
529507001656	Signal peptide predicted for PMI0299 by SignalP 2.0 HMM (Signal peptide probability 0.950) with cleavage site probability 0.945 between residues 31 and 32
529507001657	HMMPfam hit to PF00577, Fimbrial Usher protein, score 5.7e-244
529507001658	putative fimbrial chaperone protein StfD; Provisional; Region: PRK15285
529507001659	Gram-negative pili assembly chaperone, N-terminal domain; Region: Pili_assembly_N; pfam00345
529507001660	Gram-negative pili assembly chaperone, C-terminal domain; Region: Pili_assembly_C; pfam02753
529507001661	Signal peptide predicted for PMI0300 by SignalP 2.0 HMM (Signal peptide probability 0.988) with cleavage site probability 0.965 between residues 33 and 34
529507001662	1 probable transmembrane helix predicted for PMI0300 by TMHMM2.0 at aa 13-35
529507001663	HMMPfam hit to PF00345, Gram-negative pili assembly chaperone, score 6e-44
529507001664	PS00635 Gram-negative pili assembly chaperone signature.
529507001665	Signal peptide predicted for PMI0301 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.959 between residues 30 and 31
529507001666	1 probable transmembrane helix predicted for PMI0301 by TMHMM2.0 at aa 12-30
529507001667	P pilus assembly protein, pilin FimA [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimA; COG3539
529507001668	Signal peptide predicted for PMI0302 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.876 between residues 24 and 25
529507001669	HMMPfam hit to PF00419, Fimbrial protein, score 3.5e-06
529507001670	Fimbrial protein; Region: Fimbrial; pfam00419
529507001671	Signal peptide predicted for PMI0303 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.990 between residues 25 and 26
529507001672	1 probable transmembrane helix predicted for PMI0303 by TMHMM2.0 at aa 12-34
529507001673	HMMPfam hit to PF00419, Fimbrial protein, score 0.0028
529507001674	Signal peptide predicted for PMI0304 by SignalP 2.0 HMM (Signal peptide probability 0.884) with cleavage site probability 0.865 between residues 50 and 51
529507001675	1 probable transmembrane helix predicted for PMI0304 by TMHMM2.0 at aa 28-50
529507001676	Bacterial regulatory proteins, tetR family; Region: TetR_N; pfam00440
529507001677	Transcriptional regulator [Transcription]; Region: AcrR; COG1309
529507001678	HMMPfam hit to PF00440, Bacterial regulatory proteins, tetR family, score 1.6e-07
529507001679	HMMPfam hit to PF02178, AT hook motif, score 0.025
529507001680	putrescine transporter; Provisional; Region: potE; PRK10655
529507001681	HMMPfam hit to PF00324, Amino acid permease, score 7.9e-07
529507001682	12 probable transmembrane helices predicted for PMI0306 by TMHMM2.0 at aa 2-24, 29-51, 80-102, 112-134, 141-163, 178-197, 218-240, 260-282, 317-334, 344-366, 379-397 and 402-421
529507001683	PS00017 ATP/GTP-binding site motif A (P-loop).
529507001684	ornithine decarboxylase; Provisional; Region: PRK13578
529507001685	Orn/Lys/Arg decarboxylase, N-terminal domain; Region: OKR_DC_1_N; pfam03709
529507001686	Ornithine decarboxylase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD corresponds to ornithine decarboxylase (ODC), arginine decarboxylase (ADC) and lysine...; Region: Orn_deC_like; cd00615
529507001687	homodimer interface [polypeptide binding]; other site
529507001688	pyridoxal 5'-phosphate binding site [chemical binding]; other site
529507001689	catalytic residue [active]
529507001690	Orn/Lys/Arg decarboxylase, C-terminal domain; Region: OKR_DC_1_C; pfam03711
529507001691	HMMPfam hit to PF03711, Orn/Lys/Arg decarboxylase, C-terminal doma, score 5.4e-82
529507001692	HMMPfam hit to PF01276, Orn/Lys/Arg decarboxylase, major domain, score 0
529507001693	PS00703 Orn/Lys/Arg decarboxylases family 1 pyridoxal-P attachment site.
529507001694	HMMPfam hit to PF03709, Orn/Lys/Arg decarboxylase, N-terminal doma, score 1.6e-19
529507001695	Phosphoribosyl transferase (PRT)-type I domain; Region: PRTases_typeI; cd06223
529507001696	active site
529507001697	PS00103 Purine/pyrimidine phosphoribosyl transferases signature.
529507001698	resolvase/recombinase (pseudogene);This CDS appears to have a frameshift mutation following codon 126.
529507001699	HMMPfam hit to PF00239, Resolvase, N terminal domain, score 8.5e-49
529507001700	PS00397 Site-specific recombinases active site.
529507001701	PS00398 Site-specific recombinases signature 2.
529507001702	HMMPfam hit to PF02796, Helix-turn-helix domain of resolvase, score 1.9e-10
529507001703	Predicted helix-turn-helix motif with score 1736.000, SD 5.10 at aa 26-47, sequence WGGTAIAKEMKVARSTVYKILN
529507001704	2 probable transmembrane helices predicted for PMI0311 by TMHMM2.0 at aa 10-32 and 52-74
529507001705	Restriction endonuclease [Defense mechanisms]; Region: McrA; COG1403
529507001706	HNH nucleases; HNH endonuclease signature which is found in viral, prokaryotic, and eukaryotic proteins. The alignment includes members of the large group of homing endonucleases, yeast intron 1 protein, MutS, as well as bacterial colicins, pyocins, and...; Region: HNHc; cd00085
529507001707	active site
529507001708	phage-related protein (fragment)
529507001709	PS00017 ATP/GTP-binding site motif A (P-loop).
529507001710	conjugative transfer region protein, TIGR03748 family; Region: conj_PilL
529507001711	Signal peptide predicted for PMI0317 by SignalP 2.0 HMM (Signal peptide probability 0.673) with cleavage site probability 0.620 between residues 18 and 19
529507001712	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507001713	integrating conjugative element protein, PFL_4693 family; Region: conj_TIGR03759
529507001714	Signal peptide predicted for PMI0318 by SignalP 2.0 HMM (Signal peptide probability 0.993) with cleavage site probability 0.973 between residues 28 and 29
529507001715	Domain of unknown function (DUF4400); Region: DUF4400; cl14023
529507001716	2 probable transmembrane helices predicted for PMI0319 by TMHMM2.0 at aa 41-58 and 62-81
529507001717	transcriptional regulator CysB; Reviewed; Region: cysB; PRK12681
529507001718	Transposase and inactivated derivatives [DNA replication, recombination, and repair]; Region: COG2963
529507001719	Transposase; Region: HTH_Tnp_1; pfam01527
529507001720	HMMPfam hit to PF01527, Transposase, score 6e-18
529507001721	Predicted helix-turn-helix motif with score 1043.000, SD 2.74 at aa 26-47, sequence YSVSKAAASLGITDKLLYNWKA
529507001722	integrase (fragment)
529507001723	murein transglycosylase C; Provisional; Region: mltC; PRK11671
529507001724	Domain of unknown function (DUF3393); Region: DUF3393; pfam11873
529507001725	Lytic Transglycosylase (LT)  and Goose Egg White Lysozyme (GEWL) domain. Members include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as, the eukaryotic "goose-type" lysozymes (GEWL).  LTs...; Region: LT_GEWL; cd00254
529507001726	N-acetyl-D-glucosamine binding site [chemical binding]; other site
529507001727	catalytic residue [active]
529507001728	HMMPfam hit to PF01464, Transglycosylase SLT domain, score 1.2e-45
529507001729	PS00922 Prokaryotic transglycosylases signature.
529507001730	oxidative damage protection protein; Provisional; Region: PRK05408
529507001731	HMMPfam hit to PF04362, Protein of unknown function (DUF495), score 3.4e-66
529507001732	adenine DNA glycosylase; Provisional; Region: PRK10880
529507001733	endonuclease III; includes endonuclease III (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA glycosidases (Alka-family) and other DNA glycosidases; Region: ENDO3c; cd00056
529507001734	minor groove reading motif; other site
529507001735	helix-hairpin-helix signature motif; other site
529507001736	substrate binding pocket [chemical binding]; other site
529507001737	active site
529507001738	iron-sulpphur binding domain in DNA-(apurinic or apyrimidinic site) lyase (subfamily of ENDO3); Region: FES; smart00525
529507001739	DNA glycosylase (MutY in bacteria and hMYH in humans) is responsible for repairing misread  A*oxoG residues to C*G by removing the inappropriately paired adenine base from the DNA backbone. It belongs to the Nudix hydrolase superfamily and is important...; Region: DNA_Glycosylase_C; cd03431
529507001740	DNA binding and oxoG recognition site [nucleotide binding]
529507001741	PS00764 Endonuclease III iron-sulfur binding region signature.
529507001742	HMMPfam hit to PF00730, HhH-GPD superfamily base excision DNA repair, score 2.8e-23
529507001743	PS01155 Endonuclease III family signature.
529507001744	HMMPfam hit to PF00633, Helix-hairpin-helix motif, score 1.8e-05
529507001745	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
529507001746	S-adenosylmethionine binding site [chemical binding]; other site
529507001747	HMMPfam hit to PF02390, methyltransferase, score 3.4e-96
529507001748	hypothetical protein; Provisional; Region: PRK11702
529507001749	HMMPfam hit to PF04320, Protein with unknown function (DUF469), score 3.6e-71
529507001750	Glutaminase [Amino acid transport and metabolism]; Region: GlsA; COG2066
529507001751	glutaminase; Provisional; Region: PRK00971
529507001752	HMMPfam hit to PF04960, Glutaminase, score 3.4e-174
529507001753	hypothetical protein; Provisional; Region: PRK10626
529507001754	Protein of unknown function (DUF2884); Region: DUF2884; pfam11101
529507001755	Signal peptide predicted for PMI0330 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.945 between residues 19 and 20
529507001756	Siderophore binding protein FatB.  These proteins have been shown to function as ABC-type initial receptors in the siderophore-mediated iron uptake in some eubacterial species.  They belong to the TroA superfamily of periplasmic metal binding proteins...; Region: FatB; cd01140
529507001757	putative ligand binding residues [chemical binding]; other site
529507001758	Periplasmic binding protein; Region: Peripla_BP_2; pfam01497
529507001759	Signal peptide predicted for PMI0331 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.909 between residues 22 and 23
529507001760	HMMPfam hit to PF01497, Periplasmic binding protein, score 1.7e-39
529507001761	HemN family oxidoreductase; Provisional; Region: PRK05660
529507001762	Radical SAM superfamily. Enzymes of this family generate radicals by combining a 4Fe-4S cluster and S-adenosylmethionine (SAM) in close proximity. They are characterized by a conserved CxxxCxxC motif, which coordinates the conserved iron-sulfur cluster; Region: Radical_SAM; cd01335
529507001763	FeS/SAM binding site; other site
529507001764	HemN C-terminal domain; Region: HemN_C; pfam06969
529507001765	HMMPfam hit to PF06969, HemN C-terminal region, score 5.7e-20
529507001766	Predicted helix-turn-helix motif with score 1576.000, SD 4.55 at aa 326-347, sequence FPRQDFSDYTGLAQETIRRQID
529507001767	HMMPfam hit to PF04055, Radical SAM superfamily, score 8.4e-25
529507001768	NTPase/HAM1.  This family consists of the HAM1 protein and pyrophosphate-releasing xanthosine/ inosine triphosphatase. HAM1 protects the cell against mutagenesis by the base analog 6-N-hydroxylaminopurine (HAP) in E. Coli and S. cerevisiae. A...; Region: HAM1; cd00515
529507001769	active site
529507001770	dimerization interface [polypeptide binding]; other site
529507001771	HMMPfam hit to PF01725, Ham1 family, score 1.8e-99
529507001772	YGGT family; Region: YGGT; pfam02325
529507001773	YGGT family; Region: YGGT; pfam02325
529507001774	HMMPfam hit to PF02325, YGGT family, score 9.3e-23
529507001775	4 probable transmembrane helices predicted for PMI0334 by TMHMM2.0 at aa 3-25, 66-88, 95-117 and 149-171
529507001776	HMMPfam hit to PF02325, YGGT family, score 1.2e-18
529507001777	pyrroline-5-carboxylate reductase; Reviewed; Region: PRK11880
529507001778	NADP oxidoreductase coenzyme F420-dependent; Region: F420_oxidored; cl17232
529507001779	HMMPfam hit to PF01089, Delta 1-pyrroline-5-carboxylate reductase, score 2.8e-93
529507001780	PS00107 Protein kinases ATP-binding region signature.
529507001781	Pyridoxal 5-phosphate (PLP)-binding TIM barrel domain of Type III PLP-Dependent Enzymes, Yggs-like proteins; Region: PLPDE_III_Yggs_like; cd06824
529507001782	pyridoxal 5'-phosphate (PLP) binding site [chemical binding]; other site
529507001783	catalytic residue [active]
529507001784	HMMPfam hit to PF01168, Alanine racemase, N-terminal domain, score 4.5e-41
529507001785	PS01211 Uncharacterized protein family UPF0001 signature.
529507001786	Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion]; Region: PilT; COG2805
529507001787	RecA-like NTPases. This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and...; Region: RecA-like_NTPases; cl17233
529507001788	Walker A motif; other site
529507001789	ATP binding site [chemical binding]; other site
529507001790	Walker B motif; other site
529507001791	HMMPfam hit to PF00437, Type II/IV secretion system protein, score 7e-12
529507001792	PS00017 ATP/GTP-binding site motif A (P-loop).
529507001793	PS00662 Bacterial type II secretion system protein E signature.
529507001794	Predicted helix-turn-helix motif with score 1060.000, SD 2.80 at aa 302-323, sequence TTLMQTGFEYGMQTFTLSRQQR
529507001795	Holliday junction resolvase-like protein; Reviewed; Region: PRK00109
529507001796	HMMPfam hit to PF03652, Uncharacterised protein family (UPF0081), score 8.4e-66
529507001797	hypothetical protein; Validated; Region: PRK00228
529507001798	HMMPfam hit to PF02622, Uncharacterized ACR, COG1678, score 7.6e-92
529507001799	glutathione synthetase; Provisional; Region: PRK05246
529507001800	Prokaryotic glutathione synthetase, N-terminal domain; Region: GSH-S_N; pfam02951
529507001801	Prokaryotic glutathione synthetase, ATP-grasp domain; Region: GSH-S_ATP; pfam02955
529507001802	HMMPfam hit to PF02955, Prokaryotic glutathione synthetase, ATP-gra, score 1.7e-127
529507001803	PS00030 Eukaryotic RNA-binding region RNP-1 signature.
529507001804	HMMPfam hit to PF02951, Prokaryotic glutathione synthetase, N-termi, score 9e-66
529507001805	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG1385
529507001806	RNA methyltransferase, RsmE family; Region: TIGR00046
529507001807	HMMPfam hit to PF04452, Protein of unknown function (DUF558), score 4.5e-41
529507001808	Type II secretory pathway, prepilin signal peptidase PulO and related peptidases [Cell motility and secretion / Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion]; Region: PulO; COG1989
529507001809	Type IV leader peptidase family; Region: Peptidase_A24; pfam01478
529507001810	Signal peptide predicted for PMI0342 by SignalP 2.0 HMM (Signal peptide probability 0.741) with cleavage site probability 0.739 between residues 30 and 31
529507001811	5 probable transmembrane helices predicted for PMI0342 by TMHMM2.0 at aa 45-67, 87-109, 116-138, 158-180 and 187-209
529507001812	HMMPfam hit to PF01478, Type IV leader peptidase family, score 4.1e-17
529507001813	DsbA family, FrnE-like subfamily; composed of uncharacterized proteins containing a CXXC motif with similarity to DsbA and FrnE. FrnE is presumed to be a thiol oxidoreductase involved in polyketide biosynthesis, specifically in the production of the...; Region: DsbA_FrnE_like; cd03025
529507001814	Predicted protein-disulfide isomerase [Posttranslational modification, protein turnover, chaperones]; Region: COG3531
529507001815	catalytic residues [active]
529507001816	Zn-dependent hydrolases, including glyoxylases [General function prediction only]; Region: GloB; COG0491
529507001817	HMMPfam hit to PF00753, Metallo-beta-lactamase superfamily, score 1.1e-12
529507001818	1 probable transmembrane helix predicted for PMI0344 by TMHMM2.0 at aa 19-41
529507001819	Signal peptide predicted for PMI0344 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.998 between residues 36 and 37
529507001820	Transcriptional regulator [Transcription]; Region: LysR; COG0583
529507001821	Bacterial regulatory helix-turn-helix protein, lysR family; Region: HTH_1; pfam00126
529507001822	The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain; Region: PBP2_CrgA_like; cd08422
529507001823	putative effector binding pocket; other site
529507001824	dimerization interface [polypeptide binding]; other site
529507001825	HMMPfam hit to PF00126, Bacterial regulatory helix-turn-helix, score 1.1e-10
529507001826	Predicted helix-turn-helix motif with score 1757.000, SD 5.17 at aa 17-38, sequence GSMIKAADYLGMSRAMVTRYLN
529507001827	PS00044 Bacterial regulatory proteins, lysR family signature.
529507001828	HMMPfam hit to PF03466, LysR substrate binding domain, score 7e-45
529507001829	DNA-binding transcriptional regulator LysR; Provisional; Region: PRK11013
529507001830	Bacterial regulatory helix-turn-helix protein, lysR family; Region: HTH_1; pfam00126
529507001831	The substrate binding domain of LysR-type transcriptional regulators (LTTRs), a member of the type 2 periplasmic binding fold protein superfamily; Region: PBP2_LTTR_substrate; cl11398
529507001832	dimerization interface [polypeptide binding]; other site
529507001833	HMMPfam hit to PF03466, LysR substrate binding domain, score 8.6e-39
529507001834	HMMPfam hit to PF00126, Bacterial regulatory helix-turn-helix, score 1.1e-16
529507001835	PS00044 Bacterial regulatory proteins, lysR family signature.
529507001836	Predicted helix-turn-helix motif with score 1850.000, SD 5.49 at aa 20-41, sequence QNLTEAADLLKTSQPTVSRELS
529507001837	diaminopimelate decarboxylase; Provisional; Region: PRK11165
529507001838	Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Diaminopimelate Decarboxylase; Region: PLPDE_III_DapDC; cd06828
529507001839	active site
529507001840	pyridoxal 5'-phosphate (PLP) binding site [chemical binding]; other site
529507001841	substrate binding site [chemical binding]; other site
529507001842	catalytic residues [active]
529507001843	dimer interface [polypeptide binding]; other site
529507001844	HMMPfam hit to PF02784, Pyridoxal-dependent decarboxylase, py, score 1.1e-64
529507001845	PS00878 Orn/DAP/Arg decarboxylases family 2 pyridoxal-P attachment site.
529507001846	PS00879 Orn/DAP/Arg decarboxylases family 2 signature 2.
529507001847	HMMPfam hit to PF00278, Pyridoxal-dependent decarboxylase, C-, score 1.5e-50
529507001848	acyl-CoA dehydrogenase; Reviewed; Region: fadE; PRK09463
529507001849	Acyl-CoA dehydrogenase; Region: ACAD; cl09933
529507001850	active site
529507001851	Domain of unknown function (DUF1974); Region: DUF1974; pfam09317
529507001852	HMMPfam hit to PF00441, Acyl-CoA dehydrogenase, C-terminal doma, score 1.1e-26
529507001853	HMMPfam hit to PF02771, Acyl-CoA dehydrogenase, N-terminal doma, score 2.4e-05
529507001854	2 probable transmembrane helices predicted for PMI0348 by TMHMM2.0 at aa 4-18 and 25-47
529507001855	Phosphoheptose isomerase is a member of the SIS (Sugar ISomerase) superfamily. Phosphoheptose isomerase catalyzes the isomerization of sedoheptulose 7-phosphate into D-glycero-D-mannoheptose 7-phosphate. This is the first step of the biosynthesis of...; Region: SIS_GmhA; cd05006
529507001856	dimer interface [polypeptide binding]; other site
529507001857	active site
529507001858	HMMPfam hit to PF01380, SIS domain, score 1.7e-23
529507001859	Predicted glutamine amidotransferase [General function prediction only]; Region: COG0121
529507001860	Glutamine amidotransferases class-II (Gn-AT)_YafJ-type.  YafJ is a glutamine amidotransferase-like protein of unknown function found in prokaryotes, eukaryotes and archaea.  YafJ has a conserved structural fold similar to those of other class II...; Region: YafJ; cd01908
529507001861	putative active site [active]
529507001862	putative dimer interface [polypeptide binding]; other site
529507001863	HMMPfam hit to PF00310, Glutamine amidotransferases class-II, score 8.6e-23
529507001864	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG3034
529507001865	HMMPfam hit to PF06104, Bacterial protein of unknown function (DUF94, score 2.2e-107
529507001866	Signal peptide predicted for PMI0351 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.996 between residues 23 and 24
529507001867	Na(+)-translocating NADH-quinone reductase subunit A; Provisional; Region: PRK05352
529507001868	NQRA C-terminal domain; Region: NQRA_SLBB; pfam11973
529507001869	HMMPfam hit to PF05896, Na(+)-translocating NADH-quinone reductase s, score 5.8e-286
529507001870	PS00191 Cytochrome b5 family, heme-binding domain signature.
529507001871	Na(+)-translocating NADH-quinone reductase subunit B; Provisional; Region: PRK05349
529507001872	HMMPfam hit to PF03116, NQR2, RnfD, RnfE family, score 1.7e-204
529507001873	8 probable transmembrane helices predicted for PMI0353 by TMHMM2.0 at aa 58-80, 125-147, 159-181, 268-290, 297-316, 326-345, 358-375 and 379-401
529507001874	Na(+)-translocating NADH-quinone reductase subunit C; Provisional; Region: PRK05346
529507001875	NADH:ubiquinone oxidoreductase, Na(+)-translocating, C subunit; Region: nqrC; TIGR01938
529507001876	Signal peptide predicted for PMI0354 by SignalP 2.0 HMM (Signal peptide probability 0.994) with cleavage site probability 0.871 between residues 29 and 30
529507001877	1 probable transmembrane helix predicted for PMI0354 by TMHMM2.0 at aa 13-35
529507001878	HMMPfam hit to PF04205, FMN-binding domain, score 6.8e-17
529507001879	Na(+)-translocating NADH-quinone reductase subunit D; Validated; Region: PRK09292
529507001880	HMMPfam hit to PF02508, Rnf-Nqr subunit, membrane protein, score 1.4e-94
529507001881	5 probable transmembrane helices predicted for PMI0355 by TMHMM2.0 at aa 40-62, 72-94, 101-123, 138-156 and 177-199
529507001882	Na(+)-translocating NADH-quinone reductase subunit E; Provisional; Region: PRK02830
529507001883	HMMPfam hit to PF02508, Rnf-Nqr subunit, membrane protein, score 6.6e-115
529507001884	6 probable transmembrane helices predicted for PMI0356 by TMHMM2.0 at aa 12-31, 41-63, 76-98, 108-130, 139-161 and 176-196
529507001885	Na(+)-translocating NADH-quinone reductase subunit F; Provisional; Region: PRK05464
529507001886	2Fe-2S iron-sulfur cluster binding domain. Iron-sulfur proteins play an important role in electron transfer processes and in various enzymatic reactions. The family includes plant and algal ferredoxins, which act as electron carriers in photosynthesis...; Region: fer2; cd00207
529507001887	catalytic loop [active]
529507001888	iron binding site [ion binding]; other site
529507001889	Na+-translocating NADH:quinone oxidoreductase (Na+-NQR) FAD/NADH binding domain. (Na+-NQR) provides a means of storing redox reaction energy via the transmembrane translocation of Na2+ ions. The C-terminal domain resembles ferredoxin:NADP+ oxidoreductase; Region: NADH_quinone_reductase; cd06188
529507001890	FAD binding pocket [chemical binding]; other site
529507001891	FAD binding motif [chemical binding]; other site
529507001892	phosphate binding motif [ion binding]; other site
529507001893	beta-alpha-beta structure motif; other site
529507001894	NAD binding pocket [chemical binding]; other site
529507001895	Signal peptide predicted for PMI0357 by SignalP 2.0 HMM (Signal peptide probability 0.980) with cleavage site probability 0.946 between residues 25 and 26
529507001896	1 probable transmembrane helix predicted for PMI0357 by TMHMM2.0 at aa 3-25
529507001897	HMMPfam hit to PF00111, 2Fe-2S iron-sulfur cluster binding doma, score 2.2e-13
529507001898	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507001899	HMMPfam hit to PF00175, Oxidoreductase NAD-binding domain, score 3.5e-23
529507001900	Membrane-associated lipoprotein involved in thiamine biosynthesis [Coenzyme metabolism]; Region: ApbE; COG1477
529507001901	ApbE family; Region: ApbE; pfam02424
529507001902	Signal peptide predicted for PMI0358 by SignalP 2.0 HMM (Signal peptide probability 0.995) with cleavage site probability 0.700 between residues 23 and 24
529507001903	HMMPfam hit to PF02424, ApbE family, score 4.9e-113
529507001904	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507001905	Protein of unknown function (DUF539); Region: DUF539; cl01129
529507001906	Signal peptide predicted for PMI0359 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.819 between residues 22 and 23
529507001907	HMMPfam hit to PF04400, Protein of unknown function (DUF539), score 8.3e-24
529507001908	CsbD-like; Region: CsbD; cl17424
529507001909	HMMPfam hit to PF05532, CsbD-like, score 3.4e-14
529507001910	Glycerophosphoryl diester phosphodiesterase [Energy production and conversion]; Region: UgpQ; COG0584
529507001911	Glycerophosphodiester phosphodiesterase domain of uncharacterized bacterial protein Rv2277c and similar proteins; Region: GDPD_Rv2277c_like; cd08580
529507001912	putative active site [active]
529507001913	catalytic site [active]
529507001914	putative metal binding site [ion binding]; other site
529507001915	HMMPfam hit to PF03009, Glycerophosphoryl diester phosphodiesterase, score 3e-20
529507001916	Signal peptide predicted for PMI0361 by SignalP 2.0 HMM (Signal peptide probability 0.917) with cleavage site probability 0.813 between residues 19 and 20
529507001917	DNA Polymerase IV/Kappa; Region: PolY_Pol_IV_kappa; cd03586
529507001918	active site
529507001919	DNA polymerase IV; Validated; Region: PRK02406
529507001920	DNA binding site [nucleotide binding]
529507001921	HMMPfam hit to PF00817, impB/mucB/samB family, score 3.8e-114
529507001922	ferrichrome outer membrane transporter; Provisional; Region: PRK10044
529507001923	TonB dependent/Ligand-Gated channels are created by a monomeric 22 strand (22,24) anti-parallel beta-barrel. Ligands apparently bind to the large extracellular loops. The N-terminal 150-200 residues form a plug from the periplasmic end of barrel; Region: ligand_gated_channel; cd01347
529507001924	N-terminal plug; other site
529507001925	ligand-binding site [chemical binding]; other site
529507001926	HMMPfam hit to PF00593, TonB dependent receptor, score 1.3e-21
529507001927	HMMPfam hit to PF07715, TonB-dependent Receptor Plug Domain, score 1.4e-26
529507001928	Signal peptide predicted for PMI0363 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.792 between residues 25 and 26
529507001929	Xaa-His dipeptidase; Region: aa-his-dipept; TIGR01893
529507001930	M20 Peptidase D has specificity for beta-alanyl-L-histidine dipeptide; Region: M20_pepD; cd03890
529507001931	metal binding site [ion binding]; metal-binding site
529507001932	dimer interface [polypeptide binding]; other site
529507001933	HMMPfam hit to PF07687, Peptidase dimerisation domain, score 1.9e-15
529507001934	Phosphoribosyl transferase (PRT)-type I domain; Region: PRTases_typeI; cd06223
529507001935	active site
529507001936	HMMPfam hit to PF00156, Phosphoribosyl transferase domain, score 1.6e-19
529507001937	PS00103 Purine/pyrimidine phosphoribosyl transferases signature.
529507001938	fermentation/respiration switch protein; Reviewed; Region: frsA; PRK05077
529507001939	HMMPfam hit to PF06500, Protein of unknown function (DUF1100), score 6.5e-207
529507001940	DNA-binding transcriptional regulator Crl; Provisional; Region: PRK10984
529507001941	HMMPfam hit to PF07417, Transcriptional regulator Crl, score 2.7e-52
529507001942	gamma-glutamyl kinase; Provisional; Region: PRK05429
529507001943	AAK_G5K_ProB: Glutamate-5-kinase (G5K) catalyzes glutamate-dependent ATP cleavage; G5K transfers the terminal phosphoryl group of ATP to the gamma-carboxyl group of glutamate, in the first and controlling step of proline (and, in mammals, ornithine)...; Region: AAK_G5K_ProB; cd04242
529507001944	nucleotide binding site [chemical binding]; other site
529507001945	homotetrameric interface [polypeptide binding]; other site
529507001946	putative phosphate binding site [ion binding]; other site
529507001947	putative allosteric binding site; other site
529507001948	PUA domain; Region: PUA; pfam01472
529507001949	HMMPfam hit to PF00696, Amino acid kinase family, score 3.4e-59
529507001950	PS00902 Glutamate 5-kinase signature.
529507001951	HMMPfam hit to PF01472, PUA domain, score 5.7e-26
529507001952	Gamma-glutamyl phosphate reductase (GPR), aldehyde dehydrogenase families 18 and 19; Region: ALDH_F18-19_ProA-GPR; cd07079
529507001953	gamma-glutamyl phosphate reductase; Region: proA; TIGR00407
529507001954	putative catalytic cysteine [active]
529507001955	PS01223 Gamma-glutamyl phosphate reductase signature.
529507001956	Shikimate kinase [Amino acid transport and metabolism]; Region: AroK; COG0703
529507001957	Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants. Chorismic acid is a important intermediate in the synthesis...; Region: SK; cd00464
529507001958	ADP binding site [chemical binding]; other site
529507001959	magnesium binding site [ion binding]; other site
529507001960	putative shikimate binding site; other site
529507001961	PS00017 ATP/GTP-binding site motif A (P-loop).
529507001962	HMMPfam hit to PF01202, Shikimate kinase, score 1.6e-59
529507001963	PS01128 Shikimate kinase signature.
529507001964	bifunctional acyl-[acyl carrier protein] synthetase/2-acylglycerophosphoethanolamine acyltransferase; Validated; Region: PRK08043
529507001965	Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: AGPAT-like; Region: LPLAT_AGPAT-like; cd07989
529507001966	putative acyl-acceptor binding pocket; other site
529507001967	C-terminal domain of the acyl-acyl carrier protein synthetase (also called 2-acylglycerophosphoethanolamine acyltransferase, Aas); Region: AAS_C; cd05909
529507001968	acyl-activating enzyme (AAE) consensus motif; other site
529507001969	putative AMP binding site [chemical binding]; other site
529507001970	HMMPfam hit to PF01553, Acyltransferase, score 7.2e-27
529507001971	HMMPfam hit to PF00501, AMP-binding enzyme, score 1.5e-67
529507001972	PS00455 AMP-binding domain signature.
529507001973	PS00215 Mitochondrial energy transfer proteins signature.
529507001974	lysophospholipid transporter LplT; Provisional; Region: PRK11195
529507001975	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507001976	putative substrate translocation pore; other site
529507001977	10 probable transmembrane helices predicted for PMI0373 by TMHMM2.0 at aa 17-39, 52-71, 92-114, 161-183, 219-241, 256-278, 285-302, 307-329, 342-364 and 369-391
529507001978	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 3.7e-18
529507001979	hypothetical protein; Validated; Region: PRK03661
529507001980	HMMPfam hit to PF02464, Competence-damaged protein, score 1.1e-78
529507001981	recombinase A; Provisional; Region: recA; PRK09354
529507001982	RecA is a  bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response.  RecA couples ATP hydrolysis to DNA strand exchange; Region: recA; cd00983
529507001983	hexamer interface [polypeptide binding]; other site
529507001984	Walker A motif; other site
529507001985	ATP binding site [chemical binding]; other site
529507001986	Walker B motif; other site
529507001987	HMMPfam hit to PF00154, recA bacterial DNA recombination protein, score 5.9e-243
529507001988	PS00017 ATP/GTP-binding site motif A (P-loop).
529507001989	PS00321 recA signature.
529507001990	alanyl-tRNA synthetase; Reviewed; Region: alaS; PRK00252
529507001991	Alanyl-tRNA synthetase (AlaRS) class II core catalytic domain. AlaRS is a homodimer. It is responsible for the attachment of alanine to the 3' OH group of ribose of the appropriate tRNA. This domain is primarily responsible for ATP-dependent...; Region: AlaRS_core; cd00673
529507001992	motif 1; other site
529507001993	active site
529507001994	motif 2; other site
529507001995	motif 3; other site
529507001996	Threonyl and Alanyl tRNA synthetase second additional domain; Region: tRNA_SAD; smart00863
529507001997	DHHA1 domain; Region: DHHA1; pfam02272
529507001998	HMMPfam hit to PF01411, tRNA synthetases class II (A), score 0
529507001999	PS00339 Aminoacyl-transfer RNA synthetases class-II signature 2.
529507002000	HMMPfam hit to PF02272, DHHA1 domain, score 8e-22
529507002001	carbon storage regulator; Provisional; Region: PRK01712
529507002002	HMMPfam hit to PF02599, Global regulator protein family, score 1.5e-34
529507002003	glutamate--cysteine ligase; Provisional; Region: PRK02107
529507002004	HMMPfam hit to PF04262, Glutamate-cysteine ligase, score 1.1e-247
529507002005	S-ribosylhomocysteinase; Provisional; Region: PRK02260
529507002006	HMMPfam hit to PF02664, S-Ribosylhomocysteinase (LuxS), score 2.5e-105
529507002007	hypothetical protein; Provisional; Region: PRK11573
529507002008	Domain of unknown function DUF21; Region: DUF21; pfam01595
529507002009	This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain. CorC_HlyC is a transporter associated domain. This small domain is found in Na+/H+ antiporters, in proteins involved in...; Region: CBS_pair_CorC_HlyC_assoc; cd04590
529507002010	Transporter associated domain; Region: CorC_HlyC; smart01091
529507002011	HMMPfam hit to PF03471, Transporter associated domain, score 4e-23
529507002012	HMMPfam hit to PF00571, CBS domain, score 1.4e-06
529507002013	HMMPfam hit to PF00571, CBS domain, score 0.071
529507002014	HMMPfam hit to PF01595, Domain of unknown function DUF21, score 3.9e-68
529507002015	4 probable transmembrane helices predicted for PMI0380 by TMHMM2.0 at aa 4-26, 62-84, 94-112 and 124-146
529507002016	Signal peptide predicted for PMI0380 by SignalP 2.0 HMM (Signal peptide probability 0.893) with cleavage site probability 0.652 between residues 24 and 25
529507002017	ABC-type uncharacterized transport system, permease component [General function prediction only]; Region: COG4137
529507002018	HMMPfam hit to PF01578, Cytochrome C assembly protein, score 1.7e-61
529507002019	8 probable transmembrane helices predicted for PMI0381 by TMHMM2.0 at aa 24-46, 56-78, 85-107, 112-134, 147-169, 199-221, 233-250 and 260-282
529507002020	signal recognition particle protein; Provisional; Region: PRK10867
529507002021	SRP54-type protein, helical bundle domain; Region: SRP54_N; smart00963
529507002022	The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes. SRP recognizes N-terminal sighnal sequences of newly synthesized polypeptides at the ribosome. The...; Region: SRP; cd03115
529507002023	P loop; other site
529507002024	GTP binding site [chemical binding]; other site
529507002025	Signal peptide binding domain; Region: SRP_SPB; pfam02978
529507002026	HMMPfam hit to PF02881, SRP54-type protein, helical bundle domain, score 1.4e-32
529507002027	HMMPfam hit to PF00448, SRP54-type protein, GTPase domain, score 4.5e-119
529507002028	PS00017 ATP/GTP-binding site motif A (P-loop).
529507002029	PS00343 Gram-positive cocci surface proteins 'anchoring' hexapeptide.
529507002030	PS00300 SRP54-type proteins GTP-binding domain signature.
529507002031	HMMPfam hit to PF02978, Signal peptide binding domain, score 2.1e-48
529507002032	30S ribosomal protein S16; Reviewed; Region: rpsP; PRK00040
529507002033	PS00732 Ribosomal protein S16 signature.
529507002034	HMMPfam hit to PF00886, Ribosomal protein S16, score 2.6e-33
529507002035	16S rRNA-processing protein RimM; Provisional; Region: rimM; PRK00122
529507002036	RimM N-terminal domain; Region: RimM; pfam01782
529507002037	PRC-barrel domain; Region: PRC; pfam05239
529507002038	HMMPfam hit to PF01782, RimM N-terminal domain, score 1.5e-30
529507002039	HMMPfam hit to PF05239, PRC-barrel domain, score 4.2e-19
529507002040	tRNA (guanine-N(1)-)-methyltransferase; Reviewed; Region: trmD; PRK00026
529507002041	HMMPfam hit to PF01746, tRNA (Guanine-1)-methyltransferase, score 4.1e-136
529507002042	50S ribosomal protein L19; Provisional; Region: rplS; PRK05338
529507002043	HMMPfam hit to PF01245, Ribosomal protein L19, score 3.1e-78
529507002044	PS01015 Ribosomal protein L19 signature.
529507002045	phospho-2-dehydro-3-deoxyheptonate aldolase; Provisional; Region: PRK12755
529507002046	DAHP synthetase I family; Region: DAHP_synth_1; pfam00793
529507002047	HMMPfam hit to PF00793, DAHP synthetase I family, score 5.7e-150
529507002048	bifunctional chorismate mutase/prephenate dehydrogenase; Provisional; Region: tyrA; PRK11199
529507002049	chorismate mutase domain of T-protein; Region: CM_T; TIGR01799
529507002050	NADP oxidoreductase coenzyme F420-dependent; Region: F420_oxidored; cl17232
529507002051	prephenate dehydrogenase; Validated; Region: PRK08507
529507002052	HMMPfam hit to PF01817, Chorismate mutase type II, score 1.6e-33
529507002053	HMMPfam hit to PF02153, Prephenate dehydrogenase, score 5.1e-17
529507002054	Anaerobic C4-dicarboxylate transporter [General function prediction only]; Region: DcuB; COG2704
529507002055	anaerobic C4-dicarboxylate transporter; Reviewed; Region: PRK12489
529507002056	10 probable transmembrane helices predicted for PMI0389 by TMHMM2.0 at aa 4-19, 24-43, 90-112, 143-165, 175-197, 237-256, 271-288, 301-318, 360-382 and 422-444
529507002057	HMMPfam hit to PF03605, Anaerobic c4-dicarboxylate membrane transpo, score 7.6e-243
529507002058	bifunctional chorismate mutase/prephenate dehydratase; Provisional; Region: pheA; PRK10622
529507002059	chorismate mutase domain of proteobacterial P-protein, clade 1; Region: CM_P_1; TIGR01797
529507002060	Prephenate dehydratase; Region: PDT; pfam00800
529507002061	C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme; Region: ACT_CM-PDT; cd04905
529507002062	putative L-Phe binding site [chemical binding]; other site
529507002063	PS00858 Prephenate dehydratase signature 2.
529507002064	HMMPfam hit to PF00800, Prephenate dehydratase, score 4.7e-85
529507002065	PS00857 Prephenate dehydratase signature 1.
529507002066	HMMPfam hit to PF01817, Chorismate mutase type II, score 2.1e-23
529507002067	RaiA ("ribosome-associated inhibitor A", also known as Protein Y (PY), YfiA, and SpotY,  is a stress-response protein that binds the ribosomal subunit interface and arrests translation by interfering with aminoacyl-tRNA binding to the ribosomal...; Region: RaiA; cd00552
529507002068	30S subunit binding site; other site
529507002069	HMMPfam hit to PF02482, Sigma 54 modulation protein / S30EA r, score 9.9e-42
529507002070	outer membrane biogenesis protein BamD; Provisional; Region: PRK10866
529507002071	Signal peptide predicted for PMI0392 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.464 between residues 23 and 24
529507002072	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507002073	23S rRNA pseudouridine synthase D; Provisional; Region: rluD; PRK11180
529507002074	S4/Hsp/ tRNA synthetase RNA-binding domain; The domain surface is populated by conserved, charged residues that define a likely RNA-binding site;  Found in stress proteins, ribosomal proteins and tRNA synthetases; This may imply a hitherto unrecognized...; Region: S4; cd00165
529507002075	RNA binding surface [nucleotide binding]; other site
529507002076	Pseudouridine synthase, RsuA/RluD family; Region: PseudoU_synth_RluCD_like; cd02869
529507002077	active site
529507002078	HMMPfam hit to PF01479, S4 domain, score 1.1e-10
529507002079	HMMPfam hit to PF00849, RNA pseudouridylate synthase, score 3.8e-68
529507002080	PS01129 Rlu family of pseudouridine synthase signature.
529507002081	Multi-copper polyphenol oxidoreductase laccase; Region: Cu-oxidase_4; cl00650
529507002082	Multicopper polyphenol oxidase (laccase) [Secondary metabolites biosynthesis, transport and catabolism]; Region: yfiH; COG1496
529507002083	HMMPfam hit to PF02578, Uncharacterised ACR, YfiH family COG1496, score 1e-76
529507002084	protein disaggregation chaperone; Provisional; Region: PRK10865
529507002085	Clp amino terminal domain; Region: Clp_N; pfam02861
529507002086	Clp amino terminal domain; Region: Clp_N; pfam02861
529507002087	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
529507002088	Walker A motif; other site
529507002089	ATP binding site [chemical binding]; other site
529507002090	Walker B motif; other site
529507002091	arginine finger; other site
529507002092	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
529507002093	Walker A motif; other site
529507002094	ATP binding site [chemical binding]; other site
529507002095	Walker B motif; other site
529507002096	arginine finger; other site
529507002097	C-terminal, D2-small domain, of ClpB protein; Region: ClpB_D2-small; pfam10431
529507002098	HMMPfam hit to PF02861, Clp amino terminal domain, score 5.6e-14
529507002099	HMMPfam hit to PF02861, Clp amino terminal domain, score 2.1e-13
529507002100	HMMPfam hit to PF00004, ATPase family associated with various cellul, score 5.5e-15
529507002101	PS00017 ATP/GTP-binding site motif A (P-loop).
529507002102	PS00870 Chaperonins clpA/B signature 1.
529507002103	HMMPfam hit to PF07724, ATPase family associated with various cellul, score 7.1e-111
529507002104	PS00017 ATP/GTP-binding site motif A (P-loop).
529507002105	PS00871 Chaperonins clpA/B signature 2.
529507002106	lipoprotein; Provisional; Region: PRK10759
529507002107	Signal peptide predicted for PMI0396 by SignalP 2.0 HMM (Signal peptide probability 0.990) with cleavage site probability 0.773 between residues 27 and 28
529507002108	phosphatidylserine synthase; Provisional; Region: pssA; PRK09428
529507002109	Catalytic domain, repeat 1, of phosphatidylserine synthases from gram-negative bacteria; Region: PLDc_PSS_G_neg_1; cd09134
529507002110	domain interface [polypeptide binding]; other site
529507002111	putative active site [active]
529507002112	catalytic site [active]
529507002113	Catalytic domain, repeat 2, of phosphatidylserine synthases from gram-negative bacteria; Region: PLDc_PSS_G_neg_2; cd09136
529507002114	domain interface [polypeptide binding]; other site
529507002115	putative active site [active]
529507002116	catalytic site [active]
529507002117	HMMPfam hit to PF00614, Phospholipase D Active site motif, score 1e-07
529507002118	HMMPfam hit to PF00614, Phospholipase D Active site motif, score 5.2e-05
529507002119	Acyl-CoA synthetase (NDP forming) [Energy production and conversion]; Region: COG1042
529507002120	CoA binding domain; Region: CoA_binding_2; pfam13380
529507002121	Succinyl-CoA ligase like flavodoxin domain; Region: Succ_CoA_lig; pfam13607
529507002122	ATP-grasp domain; Region: ATP-grasp_5; pfam13549
529507002123	Acetyltransferase (GNAT) domain; Region: Acetyltransf_3; pfam13302
529507002124	Acetyltransferase (GNAT) family; Region: Acetyltransf_1; pfam00583
529507002125	HMMPfam hit to PF00583, Acetyltransferase (GNAT) family, score 4.6e-12
529507002126	HMMPfam hit to PF02629, CoA binding domain, score 3.2e-07
529507002127	Uncharacterized conserved protein [Function unknown]; Region: COG3148
529507002128	HMMPfam hit to PF03942, DTW domain, score 1.5e-54
529507002129	deubiquitinase; Provisional; Region: PRK11836; cl08202
529507002130	putative methyltransferase; Provisional; Region: PRK10864
529507002131	RNA 2'-O ribose methyltransferase substrate binding; Region: SpoU_sub_bind; pfam08032
529507002132	SpoU rRNA Methylase family; Region: SpoU_methylase; pfam00588
529507002133	HMMPfam hit to PF00588, SpoU rRNA Methylase family, score 4.2e-47
529507002134	drug resistance transporter, EmrB/QacA subfamily; Region: efflux_EmrB; TIGR00711
529507002135	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507002136	putative substrate translocation pore; other site
529507002137	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507002138	13 probable transmembrane helices predicted for PMI0402 by TMHMM2.0 at aa 20-42, 57-79, 86-108, 112-134, 146-168, 173-195, 207-225, 240-259, 280-302, 312-334, 341-360, 375-397 and 481-503
529507002139	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 2.4e-57
529507002140	Signal peptide predicted for PMI0402 by SignalP 2.0 HMM (Signal peptide probability 0.864) with cleavage site probability 0.718 between residues 41 and 42
529507002141	multidrug efflux system protein EmrA; Provisional; Region: PRK15136
529507002142	HlyD family secretion protein; Region: HlyD_3; pfam13437
529507002143	HMMPfam hit to PF00529, HlyD family secretion protein, score 3.4e-72
529507002144	1 probable transmembrane helix predicted for PMI0403 by TMHMM2.0 at aa 24-46
529507002145	Signal peptide predicted for PMI0403 by SignalP 2.0 HMM (Signal peptide probability 0.988) with cleavage site probability 0.617 between residues 38 and 39
529507002146	Transcriptional regulators [Transcription]; Region: GntR; COG1802
529507002147	Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators; Region: WHTH_GntR; cd07377
529507002148	DNA-binding site [nucleotide binding]; DNA binding site
529507002149	This entry represents the C-terminal ligand binding domain of many members of the GntR family; Region: FCD; smart00895
529507002150	HMMPfam hit to PF07729, FCD domain, score 2.6e-16
529507002151	HMMPfam hit to PF00392, Bacterial regulatory proteins, gntR family, score 1.3e-12
529507002152	drug efflux system protein MdtG; Provisional; Region: PRK09874
529507002153	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507002154	putative substrate translocation pore; other site
529507002155	12 probable transmembrane helices predicted for PMI0405 by TMHMM2.0 at aa 25-47, 62-84, 96-115, 120-142, 149-171, 181-203, 224-245, 265-287, 294-313, 323-345, 357-379 and 384-406
529507002156	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 1.6e-47
529507002157	Isochorismatase family; Region: Isochorismatase; pfam00857
529507002158	Cysteine hydrolases; This family contains amidohydrolases, like CSHase (N-carbamoylsarcosine amidohydrolase), involved in creatine metabolism and nicotinamidase, converting nicotinamide to nicotinic acid and ammonia in the pyridine nucleotide cycle. It...; Region: cysteine_hydrolases; cd00431
529507002159	catalytic triad [active]
529507002160	conserved cis-peptide bond; other site
529507002161	HMMPfam hit to PF00857, Isochorismatase family, score 4.3e-17
529507002162	transcriptional repressor MprA; Provisional; Region: PRK10870
529507002163	helix_turn_helix multiple antibiotic resistance protein; Region: HTH_MARR; smart00347
529507002164	HMMPfam hit to PF01047, MarR family, score 2.3e-34
529507002165	PS01117 Bacterial regulatory proteins, marR family signature.
529507002166	Arabinose efflux permease [Carbohydrate transport and metabolism]; Region: AraJ; COG2814
529507002167	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507002168	11 probable transmembrane helices predicted for PMI0408 by TMHMM2.0 at aa 17-39, 54-76, 83-102, 106-128, 141-160, 170-192, 223-245, 255-277, 290-312, 348-370 and 375-397
529507002169	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 3.4e-44
529507002170	Signal peptide predicted for PMI0408 by SignalP 2.0 HMM (Signal peptide probability 0.991) with cleavage site probability 0.634 between residues 36 and 37
529507002171	TonB-dependent heme/hemoglobin receptor family protein; Region: TonB-hemin; TIGR01785
529507002172	TonB dependent/Ligand-Gated channels are created by a monomeric 22 strand (22,24) anti-parallel beta-barrel. Ligands apparently bind to the large extracellular loops. The N-terminal 150-200 residues form a plug from the periplasmic end of barrel; Region: ligand_gated_channel; cd01347
529507002173	N-terminal plug; other site
529507002174	ligand-binding site [chemical binding]; other site
529507002175	1 probable transmembrane helix predicted for PMI0409 by TMHMM2.0 at aa 2-24
529507002176	HMMPfam hit to PF07715, TonB-dependent Receptor Plug Domain, score 2.8e-15
529507002177	HMMPfam hit to PF00593, TonB dependent receptor, score 2.3e-19
529507002178	glycine betaine transporter periplasmic subunit; Provisional; Region: proX; PRK11119
529507002179	Substrate binding domain of ABC-type glycine betaine transport system; Region: OpuAC; pfam04069
529507002180	HMMPfam hit to PF04069, Substrate binding domain of ABC-type glycine, score 1.4e-76
529507002181	Signal peptide predicted for PMI0410 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.993 between residues 22 and 23
529507002182	glycine betaine transporter membrane protein; Provisional; Region: PRK10952
529507002183	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
529507002184	dimer interface [polypeptide binding]; other site
529507002185	conserved gate region; other site
529507002186	putative PBP binding loops; other site
529507002187	ABC-ATPase subunit interface; other site
529507002188	HMMPfam hit to PF00528, Binding-protein-dependent transport syst, score 2.9e-33
529507002189	6 probable transmembrane helices predicted for PMI0411 by TMHMM2.0 at aa 144-166, 176-194, 201-223, 249-271, 324-346 and 350-372
529507002190	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
529507002191	glycine betaine transporter ATP-binding subunit; Provisional; Region: PRK10070
529507002192	ATP-binding cassette domain of the osmoprotectant proline/glycine betaine uptake system; Region: ABC_Pro_Gly_Betaine; cd03294
529507002193	Walker A/P-loop; other site
529507002194	ATP binding site [chemical binding]; other site
529507002195	Q-loop/lid; other site
529507002196	ABC transporter signature motif; other site
529507002197	Walker B; other site
529507002198	D-loop; other site
529507002199	H-loop/switch region; other site
529507002200	This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA. OpuCA is the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing...; Region: CBS_pair_ABC_OpuCA_assoc2; cd04583
529507002201	HMMPfam hit to PF00571, CBS domain, score 4e-05
529507002202	HMMPfam hit to PF00005, ABC transporter, score 3.5e-68
529507002203	PS00211 ABC transporters family signature.
529507002204	PS00017 ATP/GTP-binding site motif A (P-loop).
529507002205	ribonucleotide-diphosphate reductase subunit beta; Provisional; Region: nrdF2; PRK13966
529507002206	Ribonucleotide Reductase, R2/beta subunit, ferritin-like diiron-binding domain; Region: RNRR2; cd01049
529507002207	dimer interface [polypeptide binding]; other site
529507002208	putative radical transfer pathway; other site
529507002209	diiron center [ion binding]; other site
529507002210	tyrosyl radical; other site
529507002211	HMMPfam hit to PF00268, Ribonucleotide reductase, small chain, score 3.3e-93
529507002212	PS00368 Ribonucleotide reductase small subunit signature.
529507002213	ribonucleotide-diphosphate reductase subunit alpha; Validated; Region: PRK08188
529507002214	Ribonucleotide reductase N-terminal; Region: RNR_N; pfam08343
529507002215	Class I ribonucleotide reductase; Region: RNR_I; cd01679
529507002216	active site
529507002217	dimer interface [polypeptide binding]; other site
529507002218	catalytic residues [active]
529507002219	effector binding site; other site
529507002220	Ribonucleotide reductase and Pyruvate formate lyase; Region: RNR_PFL; cl09939
529507002221	HMMPfam hit to PF02867, Ribonucleotide reductase, barrel doma, score 1e-217
529507002222	PS00089 Ribonucleotide reductase large subunit signature.
529507002223	HMMPfam hit to PF00317, Ribonucleotide reductase, all-alpha d, score 5.5e-27
529507002224	ribonucleotide reductase stimulatory protein; Reviewed; Region: nrdI; PRK03600
529507002225	NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile. In vitro, it displays protein disulfide reductase...; Region: NrdH; cd02976
529507002226	catalytic residues [active]
529507002227	methylated-DNA--protein-cysteine methyltransferase; Provisional; Region: PRK00901
529507002228	The DNA repair protein O6-alkylguanine-DNA alkyltransferase (ATase; also known as AGT, AGAT and MGMT) reverses O6-alkylation DNA damage by transferring O6-alkyl adducts to an active site cysteine irreversibly, without inducing DNA strand breaks. ATases...; Region: ATase; cd06445
529507002229	DNA binding site [nucleotide binding]
529507002230	active site
529507002231	HMMPfam hit to PF01035, 6-O-methylguanine DNA methyltransferas, score 4e-38
529507002232	PS00374 Methylated-DNA--protein-cysteine methyltransferase active site.
529507002233	Cold-Shock Protein (CSP) contains an S1-like cold-shock domain (CSD) that is found in eukaryotes, prokaryotes, and archaea.  CSP's include the major cold-shock proteins CspA and CspB in bacteria and the eukaryotic gene regulatory factor Y-box...; Region: CSP_CDS; cd04458
529507002234	DNA-binding site [nucleotide binding]; DNA binding site
529507002235	RNA-binding motif; other site
529507002236	HMMPfam hit to PF00313, 'Cold-shock' DNA-binding domain, score 3.5e-42
529507002237	PS00352 'Cold-shock' DNA-binding domain signature.
529507002238	chromosome condensation membrane protein; Provisional; Region: PRK14196
529507002239	4 probable transmembrane helices predicted for PMI0419 by TMHMM2.0 at aa 5-23, 33-55, 67-89 and 99-121
529507002240	HMMPfam hit to PF02537, CrcB-like protein, score 2.9e-39
529507002241	lipoyl synthase; Provisional; Region: PRK05481
529507002242	Radical SAM superfamily. Enzymes of this family generate radicals by combining a 4Fe-4S cluster and S-adenosylmethionine (SAM) in close proximity. They are characterized by a conserved CxxxCxxC motif, which coordinates the conserved iron-sulfur cluster; Region: Radical_SAM; cd01335
529507002243	FeS/SAM binding site; other site
529507002244	HMMPfam hit to PF04055, Radical SAM superfamily, score 5.2e-26
529507002245	lipoate-protein ligase B; Provisional; Region: PRK14342
529507002246	HMMPfam hit to PF03099, Biotin/lipoate A/B protein ligase famil, score 8.3e-30
529507002247	PS01313 Lipoate-protein ligase B signature.
529507002248	hypothetical protein; Provisional; Region: PRK04998
529507002249	HMMPfam hit to PF04359, Protein of unknown function (DUF493), score 6.2e-55
529507002250	D-alanyl-D-alanine carboxypeptidase fraction A; Provisional; Region: PRK10793
529507002251	Beta-lactamase enzyme family; Region: Beta-lactamase2; cl17872
529507002252	Penicillin-binding protein 5, C-terminal domain; Region: PBP5_C; pfam07943
529507002253	HMMPfam hit to PF07943, Penicillin-binding protein 5, C-termina, score 8.2e-38
529507002254	HMMPfam hit to PF00768, D-alanyl-D-alanine carboxypeptidase, score 2.1e-141
529507002255	Signal peptide predicted for PMI0423 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 1.000 between residues 30 and 31
529507002256	1 probable transmembrane helix predicted for PMI0423 by TMHMM2.0 at aa 13-30
529507002257	rare lipoprotein A; Provisional; Region: PRK10672
529507002258	Rare lipoprotein A (RlpA)-like double-psi beta-barrel; Region: DPBB_1; cl04011
529507002259	Sporulation related domain; Region: SPOR; pfam05036
529507002260	HMMPfam hit to PF05036, Sporulation related repeat, score 6.6e-08
529507002261	HMMPfam hit to PF05036, Sporulation related repeat, score 0.0014
529507002262	HMMPfam hit to PF03330, Rare lipoprotein A (RlpA)-like double-psi be, score 4.2e-09
529507002263	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507002264	cell wall shape-determining protein; Provisional; Region: PRK10794
529507002265	HMMPfam hit to PF01098, Cell cycle protein, score 1.6e-165
529507002266	9 probable transmembrane helices predicted for PMI0425 by TMHMM2.0 at aa 15-37, 50-67, 77-99, 137-156, 160-179, 181-203, 272-294, 306-328 and 338-360
529507002267	PS00428 Cell cycle proteins ftsW / rodA / spoVE signature.
529507002268	Signal peptide predicted for PMI0425 by SignalP 2.0 HMM (Signal peptide probability 0.994) with cleavage site probability 0.976 between residues 40 and 41
529507002269	penicillin-binding protein 2; Provisional; Region: PRK10795
529507002270	Penicillin-binding Protein dimerisation domain; Region: PBP_dimer; pfam03717
529507002271	Penicillin binding protein transpeptidase domain; Region: Transpeptidase; pfam00905
529507002272	HMMPfam hit to PF00905, Penicillin binding protein transpeptid, score 2.9e-94
529507002273	HMMPfam hit to PF03717, Penicillin-binding Protein dimerisatio, score 2.6e-65
529507002274	1 probable transmembrane helix predicted for PMI0426 by TMHMM2.0 at aa 29-51
529507002275	rRNA large subunit m3Psi methyltransferase RlmH; Region: tRNA_RlmH_YbeA; TIGR00246
529507002276	HMMPfam hit to PF02590, Uncharacterized ACR, COG1576, score 4.4e-81
529507002277	ribosome-associated protein; Provisional; Region: PRK11538
529507002278	HMMPfam hit to PF02410, Domain of unknown function DUF143, score 1.9e-48
529507002279	PS00017 ATP/GTP-binding site motif A (P-loop).
529507002280	Uncharacterized conserved protein [Function unknown]; Region: COG3272
529507002281	Protein of unknown function (DUF1722); Region: DUF1722; pfam08349
529507002282	nicotinic acid mononucleotide adenylyltransferase; Provisional; Region: nadD; PRK00071
529507002283	Nicotinamide/nicotinate mononucleotide adenylyltransferase; Region: NMNAT; cd02165
529507002284	active site
529507002285	(T/H)XGH motif; other site
529507002286	HMMPfam hit to PF01467, Cytidylyltransferase, score 2.4e-55
529507002287	DNA polymerase III subunit delta; Reviewed; Region: holA; PRK05574
529507002288	DNA polymerase III, delta subunit; Region: DNA_pol3_delta; pfam06144
529507002289	HMMPfam hit to PF06144, DNA polymerase III, delta subunit, score 2e-115
529507002290	LPS-assembly lipoprotein RlpB; Provisional; Region: PRK10796
529507002291	HMMPfam hit to PF04390, Rare lipoprotein B family, score 1.3e-57
529507002292	PS00017 ATP/GTP-binding site motif A (P-loop).
529507002293	Signal peptide predicted for PMI0432 by SignalP 2.0 HMM (Signal peptide probability 0.991) with cleavage site probability 0.889 between residues 25 and 26
529507002294	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507002295	leucyl-tRNA synthetase; Validated; Region: leuS; PRK00390
529507002296	catalytic core domain of leucyl-tRNA synthetases; Region: LeuRS_core; cd00812
529507002297	HIGH motif; other site
529507002298	Leucyl-tRNA synthetase, Domain 2; Region: tRNA-synt_1_2; pfam13603
529507002299	nucleotidyl transferase superfamily; Region: nt_trans; cl00015
529507002300	active site
529507002301	KMSKS motif; other site
529507002302	Anticodon-binding domain of bacterial and eukaryotic mitochondrial leucyl tRNA synthetases; Region: Anticodon_Ia_Leu_BEm; cd07958
529507002303	tRNA binding surface [nucleotide binding]; other site
529507002304	Anticodon-binding domain of class Ia aminoacyl tRNA synthetases and similar domains; Region: Anticodon_Ia_like; cl12020
529507002305	PS00216 Sugar transport proteins signature 1.
529507002306	HMMPfam hit to PF00133, tRNA synthetases class I (I, L, M and V), score 1.7e-271
529507002307	PS00178 Aminoacyl-transfer RNA synthetases class-I signature.
529507002308	ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]; Region: GlnQ; COG1126
529507002309	ATP-binding cassette domain of the histidine and glutamine transporters; Region: ABC_HisP_GlnQ; cd03262
529507002310	Walker A/P-loop; other site
529507002311	ATP binding site [chemical binding]; other site
529507002312	Q-loop/lid; other site
529507002313	ABC transporter signature motif; other site
529507002314	Walker B; other site
529507002315	D-loop; other site
529507002316	H-loop/switch region; other site
529507002317	HMMPfam hit to PF00005, ABC transporter, score 1.3e-63
529507002318	PS00211 ABC transporters family signature.
529507002319	PS00017 ATP/GTP-binding site motif A (P-loop).
529507002320	ABC-type arginine transport system, permease component [Amino acid transport and metabolism]; Region: ArtQ; COG4215
529507002321	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
529507002322	dimer interface [polypeptide binding]; other site
529507002323	conserved gate region; other site
529507002324	putative PBP binding loops; other site
529507002325	ABC-ATPase subunit interface; other site
529507002326	HMMPfam hit to PF00528, Binding-protein-dependent transport syst, score 9.8e-26
529507002327	5 probable transmembrane helices predicted for PMI0435 by TMHMM2.0 at aa 20-42, 55-77, 97-116, 144-166 and 197-219
529507002328	ABC-type arginine transport system, permease component [Amino acid transport and metabolism]; Region: ArtQ; COG4215
529507002329	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
529507002330	dimer interface [polypeptide binding]; other site
529507002331	conserved gate region; other site
529507002332	putative PBP binding loops; other site
529507002333	ABC-ATPase subunit interface; other site
529507002334	HMMPfam hit to PF00528, Binding-protein-dependent transport syst, score 1.3e-32
529507002335	4 probable transmembrane helices predicted for PMI0436 by TMHMM2.0 at aa 49-71, 84-106, 126-145 and 229-251
529507002336	glutamate and aspartate transporter subunit; Provisional; Region: PRK10797
529507002337	Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of  substrates, such as, amino acids, peptides, sugars, vitamins and inorganic...; Region: PBPb; cd00134
529507002338	substrate binding pocket [chemical binding]; other site
529507002339	membrane-bound complex binding site; other site
529507002340	hinge residues; other site
529507002341	HMMPfam hit to PF00497, Bacterial extracellular solute-binding prot, score 7.7e-54
529507002342	Signal peptide predicted for PMI0437 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.997 between residues 21 and 22
529507002343	Signal peptide predicted for PMI0438 by SignalP 2.0 HMM (Signal peptide probability 0.988) with cleavage site probability 0.342 between residues 32 and 33
529507002344	2 probable transmembrane helices predicted for PMI0438 by TMHMM2.0 at aa 13-32 and 84-106
529507002345	Disulphide bond corrector protein DsbC; Region: DsbC; cl15830
529507002346	Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion]; Region: COG4232
529507002347	Cytochrome C biogenesis protein transmembrane region; Region: DsbD; cl15788
529507002348	DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD. It contains a CXXC motif in a TRX fold and shuttles the reducing potential from the membrane domain (DsbD beta) to the N-terminal periplasmic domain (DsbD...; Region: DsbDgamma; cd02953
529507002349	DsbD alpha interface [polypeptide binding]; other site
529507002350	catalytic residues [active]
529507002351	Signal peptide predicted for PMI0439 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.998 between residues 20 and 21
529507002352	8 probable transmembrane helices predicted for PMI0439 by TMHMM2.0 at aa 282-304, 325-347, 362-384, 411-433, 443-465, 478-496, 500-522 and 529-548
529507002353	HMMPfam hit to PF02683, Cytochrome C biogenesis protein transmembran, score 2.2e-05
529507002354	PS00194 Thioredoxin family active site.
529507002355	Protein-disulfide isomerase [Posttranslational modification, protein turnover, chaperones]; Region: DsbG; COG1651
529507002356	DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti. It contains a CXXC...; Region: DsbA_Com1_like; cd03023
529507002357	catalytic residues [active]
529507002358	Signal peptide predicted for PMI0440 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.953 between residues 21 and 22
529507002359	HMMPfam hit to PF01323, DSBA-like thioredoxin domain, score 1.1e-21
529507002360	PS00194 Thioredoxin family active site.
529507002361	TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif; Region: TlpA_like_ScsD_MtbDsbE; cd03011
529507002362	Thioredoxin-like; Region: Thioredoxin_8; pfam13905
529507002363	catalytic residues [active]
529507002364	Signal peptide predicted for PMI0441 by SignalP 2.0 HMM (Signal peptide probability 0.987) with cleavage site probability 0.981 between residues 25 and 26
529507002365	1 probable transmembrane helix predicted for PMI0441 by TMHMM2.0 at aa 12-29
529507002366	1 probable transmembrane helix predicted for PMI0442 by TMHMM2.0 at aa 206-225
529507002367	apolipoprotein N-acyltransferase; Reviewed; Region: lnt; PRK00302
529507002368	Apolipoprotein N-acyl transferase (class 9 nitrilases); Region: ALP_N-acyl_transferase; cd07571
529507002369	putative active site [active]
529507002370	catalytic triad [active]
529507002371	putative dimer interface [polypeptide binding]; other site
529507002372	8 probable transmembrane helices predicted for PMI0443 by TMHMM2.0 at aa 17-34, 39-56, 63-85, 95-117, 130-149, 169-191, 198-220 and 492-509
529507002373	HMMPfam hit to PF00795, Carbon-nitrogen hydrolase, score 1e-34
529507002374	Signal peptide predicted for PMI0443 by SignalP 2.0 HMM (Signal peptide probability 0.897) with cleavage site probability 0.421 between residues 33 and 34
529507002375	magnesium/cobalt efflux protein CorC; Provisional; Region: PRK15094
529507002376	This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain. CorC_HlyC is a transporter associated domain. This small domain is found in Na+/H+ antiporters, in proteins involved in...; Region: CBS_pair_CorC_HlyC_assoc; cd04590
529507002377	Transporter associated domain; Region: CorC_HlyC; smart01091
529507002378	HMMPfam hit to PF03471, Transporter associated domain, score 1.3e-26
529507002379	HMMPfam hit to PF00571, CBS domain, score 9.9e-10
529507002380	HMMPfam hit to PF00571, CBS domain, score 6.9e-10
529507002381	metal-binding heat shock protein; Provisional; Region: PRK00016
529507002382	HMMPfam hit to PF02130, Uncharacterized protein family UPF0054, score 1.6e-53
529507002383	PS01306 Uncharacterized protein family UPF0054 signature.
529507002384	Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms]; Region: PhoH; COG1702
529507002385	PhoH-like protein; Region: PhoH; pfam02562
529507002386	HMMPfam hit to PF02562, PhoH-like protein, score 4.3e-152
529507002387	PS00017 ATP/GTP-binding site motif A (P-loop).
529507002388	(dimethylallyl)adenosine tRNA methylthiotransferase; Provisional; Region: PRK14325
529507002389	Uncharacterized protein family UPF0004; Region: UPF0004; pfam00919
529507002390	Radical SAM superfamily. Enzymes of this family generate radicals by combining a 4Fe-4S cluster and S-adenosylmethionine (SAM) in close proximity. They are characterized by a conserved CxxxCxxC motif, which coordinates the conserved iron-sulfur cluster; Region: Radical_SAM; cd01335
529507002391	FeS/SAM binding site; other site
529507002392	TRAM domain; Region: TRAM; pfam01938
529507002393	HMMPfam hit to PF01938, TRAM domain, score 6.8e-22
529507002394	HMMPfam hit to PF04055, Radical SAM superfamily, score 1.3e-31
529507002395	PS01278 Uncharacterized protein family UPF0004 signature.
529507002396	HMMPfam hit to PF00919, Uncharacterized protein family UPF0004, score 3e-47
529507002397	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed; Region: ubiF; PRK08020
529507002398	ubiquinone biosynthesis hydroxylase family protein; Provisional; Region: PRK07608; cl17314
529507002399	HMMPfam hit to PF01360, Monooxygenase, score 1.8e-36
529507002400	S-formylglutathione hydrolase; Region: PLN02442
529507002401	S-formylglutathione hydrolase; Region: fghA_ester_D; TIGR02821
529507002402	HMMPfam hit to PF00756, esterase, score 1.8e-100
529507002403	class III alcohol dehydrogenases; Region: alcohol_DH_class_III; cd08300
529507002404	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase; Region: adh_III_F_hyde; TIGR02818
529507002405	substrate binding site [chemical binding]; other site
529507002406	catalytic Zn binding site [ion binding]; other site
529507002407	NAD binding site [chemical binding]; other site
529507002408	structural Zn binding site [ion binding]; other site
529507002409	dimer interface [polypeptide binding]; other site
529507002410	HMMPfam hit to PF00107, Zinc-binding dehydrogenase, score 7.4e-145
529507002411	PS00059 Zinc-containing alcohol dehydrogenases signature.
529507002412	Transcriptional regulators RcnR and FrmR, and related domains; this domain family was previously known as part of DUF156; Region: RcnR-FrmR-like_DUF156; cd10153
529507002413	putative metal binding site [ion binding]; other site
529507002414	putative homodimer interface [polypeptide binding]; other site
529507002415	putative homotetramer interface [polypeptide binding]; other site
529507002416	putative homodimer-homodimer interface [polypeptide binding]; other site
529507002417	putative allosteric switch controlling residues; other site
529507002418	HMMPfam hit to PF02583, Uncharacterised BCR, COG1937, score 4.4e-16
529507002419	MarR family; Region: MarR; pfam01047
529507002420	Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism]; Region: NagC; COG1940
529507002421	ROK family; Region: ROK; pfam00480
529507002422	HMMPfam hit to PF00480, ROK family, score 1.1e-73
529507002423	Predicted helix-turn-helix motif with score 1021.000, SD 2.66 at aa 36-57, sequence ISRIQIAEQSQLAPASVTKITR
529507002424	N-acetylglucosamine-6-phosphate deacetylase; Region: nagA; TIGR00221
529507002425	N-acetylglucosamine-6-phosphate deacetylase, NagA, catalyzes the hydrolysis of the N-acetyl group of N-acetyl-glucosamine-6-phosphate (GlcNAc-6-P) to glucosamine 6-phosphate and acetate. This is the first committed step in the biosynthetic pathway to...; Region: NagA; cd00854
529507002426	active site
529507002427	dimer interface [polypeptide binding]; other site
529507002428	HMMPfam hit to PF01979, Amidohydrolase family, score 3.9e-30
529507002429	6-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminase [Carbohydrate transport and metabolism]; Region: NagB; COG0363
529507002430	GlcN6P_deaminase: Glucosamine-6-phosphate (GlcN6P) deaminase subfamily; GlcN6P deaminase catalyzes the reversible conversion of GlcN6P to D-fructose-6-phosphate (Fru6P) and ammonium. The reaction is an aldo-keto isomerization coupled with an amination or...; Region: GlcN6P_deaminase; cd01399
529507002431	active site
529507002432	trimer interface [polypeptide binding]; other site
529507002433	allosteric site; other site
529507002434	active site lid [active]
529507002435	hexamer (dimer of trimers) interface [polypeptide binding]; other site
529507002436	HMMPfam hit to PF01182, Glucosamine-6-phosphate isomerases/6-, score 6.6e-172
529507002437	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507002438	PS01161 Glucosamine/galactosamine-6-phosphate isomerases signature.
529507002439	PTS system N-acetyl glucosamine specific transporter subunits IIABC; Provisional; Region: PRK10255
529507002440	Phosphotransferase system IIC components, glucose/maltose/N-acetylglucosamine-specific [Carbohydrate transport and metabolism]; Region: PtsG; COG1263
529507002441	PTS_IIB, PTS system, glucose/sucrose specific IIB subunit. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. This family...; Region: PTS_IIB_glc; cd00212
529507002442	active site turn [active]
529507002443	phosphorylation site [posttranslational modification]
529507002444	PTS_IIA, PTS system, glucose/sucrose specific IIA subunit. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. This family...; Region: PTS_IIA_glc; cd00210
529507002445	HPr interaction site; other site
529507002446	glycerol kinase (GK) interaction site [polypeptide binding]; other site
529507002447	active site
529507002448	phosphorylation site [posttranslational modification]
529507002449	HMMPfam hit to PF02378, Phosphotransferase system, EIIC, score 5.2e-79
529507002450	9 probable transmembrane helices predicted for PMI0455 by TMHMM2.0 at aa 2-21, 31-53, 65-87, 145-167, 180-202, 242-264, 271-293, 308-330 and 343-365
529507002451	HMMPfam hit to PF00367, phosphotransferase system, EIIB, score 3.6e-16
529507002452	PS01035 PTS EIIB domains cysteine phosphorylation site signature.
529507002453	HMMPfam hit to PF00358, phosphoenolpyruvate-dependent sugar phosph, score 1.3e-62
529507002454	PS00371 PTS EIIA domains phosphorylation site signature 1.
529507002455	prophage??
529507002456	Bacteriophage lambda integrase, N-terminal domain; Region: Phage_integ_N; pfam09003
529507002457	Integrase [DNA replication, recombination, and repair]; Region: XerC; COG0582
529507002458	DNA breaking-rejoining enzymes, C-terminal catalytic domain. The DNA breaking-rejoining enzyme superfamily includes type IB topoisomerases and tyrosine recombinases that share the same fold in their catalytic domain containing six conserved active site...; Region: DNA_BRE_C; cl00213
529507002459	DNA breaking-rejoining enzymes, C-terminal catalytic domain. The DNA breaking-rejoining enzyme superfamily includes type IB topoisomerases and tyrosine recombinases that share the same fold in their catalytic domain containing six conserved active site...; Region: DNA_BRE_C; cl00213
529507002460	active site
529507002461	DNA binding site [nucleotide binding]
529507002462	Int/Topo IB signature motif; other site
529507002463	HMMPfam hit to PF00589, Phage integrase family, score 9.6e-09
529507002464	This hit extended beyond the end of the feature by 1 aa and was clipped.; PS00030 Eukaryotic RNA-binding region RNP-1 signature.
529507002465	HMMPfam hit to PF02899, Phage integrase, N-terminal SAM-like, score 0.14
529507002466	Excisionase-like protein; Region: Exc; pfam07825
529507002467	Protein of unknown function (DUF2591); Region: DUF2591; cl11584
529507002468	2 probable transmembrane helices predicted for PMI0460 by TMHMM2.0 at aa 26-48 and 63-85
529507002469	single-strand DNA-binding protein (pseudogene);This CDS contains an in-frame stop codon.
529507002470	recombination and repair protein RecT; Reviewed; Region: recT; PRK09846
529507002471	HMMPfam hit to PF03837, RecT family, score 1.4e-66
529507002472	exonuclease VIII; Reviewed; Region: PRK09709
529507002473	1 probable transmembrane helix predicted for PMI0471 by TMHMM2.0 at aa 31-50
529507002474	Signal peptide predicted for PMI0478 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.970 between residues 18 and 19
529507002475	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
529507002476	non-specific DNA binding site [nucleotide binding]; other site
529507002477	salt bridge; other site
529507002478	Predicted transcriptional regulator [Transcription]; Region: COG2932
529507002479	sequence-specific DNA binding site [nucleotide binding]; other site
529507002480	Peptidase S24 LexA-like proteins are involved in the SOS response leading to the repair of single-stranded DNA within the bacterial cell. This family includes: the lambda repressor CI/C2 family and related bacterial prophage repressor proteins; LexA (EC...; Region: S24_LexA-like; cd06529
529507002481	Catalytic site [active]
529507002482	HMMPfam hit to PF00717, Peptidase S24-like, score 2.1e-16
529507002483	HMMPfam hit to PF01381, Helix-turn-helix, score 2.7e-16
529507002484	Predicted helix-turn-helix motif with score 2462.000, SD 7.57 at aa 22-43, sequence MTQAELAELVGVSPQSVQQWET
529507002485	MerR family regulatory protein; Region: MerR; pfam00376
529507002486	Predicted helix-turn-helix motif with score 1865.000, SD 5.54 at aa 12-33, sequence GGIPALAKKLKISDQAIRQWEQ
529507002487	Predicted helix-turn-helix motif with score 1523.000, SD 4.37 at aa 29-50, sequence KTQSAVARTLGVHDSTILRRTE
529507002488	Helix-turn-helix domain; Region: HTH_36; pfam13730
529507002489	Predicted helix-turn-helix motif with score 1053.000, SD 2.77 at aa 38-59, sequence PSYETIARHCEISRQSAINHIK
529507002490	DnaB-like helicase N terminal domain; Region: DnaB; pfam00772
529507002491	phage replicative helicase, DnaB family, HK022 subfamily; Region: phage_DnaB; TIGR03600
529507002492	RecA-like NTPases. This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and...; Region: RecA-like_NTPases; cl17233
529507002493	Walker A motif; other site
529507002494	ATP binding site [chemical binding]; other site
529507002495	Walker B motif; other site
529507002496	HMMPfam hit to PF00772, DnaB-like helicase N terminal domain, score 9.1e-35
529507002497	HMMPfam hit to PF03796, DnaB-like helicase C terminal domain, score 1.7e-75
529507002498	PS00017 ATP/GTP-binding site motif A (P-loop).
529507002499	hypothetical protein; Provisional; Region: PRK09741
529507002500	Protein of unknown function (DUF1364); Region: DUF1364; pfam07102
529507002501	HMMPfam hit to PF07102, Protein of unknown function (DUF1364), score 8.6e-63
529507002502	PS00190 Cytochrome c family heme-binding site signature.
529507002503	Endodeoxyribonuclease RusA; Region: RusA; pfam05866
529507002504	HMMPfam hit to PF05866, Endodeoxyribonuclease RusA, score 1.5e-09
529507002505	Phage antitermination protein Q; Region: Phage_antiter_Q; pfam06323
529507002506	HMMPfam hit to PF06323, Phage antitermination protein Q, score 2.9e-25
529507002507	Protein of unknown function (DUF1440); Region: DUF1440; pfam07274
529507002508	4 probable transmembrane helices predicted for PMI0488 by TMHMM2.0 at aa 13-32, 78-100, 105-127 and 132-154
529507002509	HMMPfam hit to PF07274, Protein of unknown function (DUF1440), score 2e-33
529507002510	Oligosaccharyl transferase STT3 subunit; Region: STT3; pfam02516
529507002511	1 probable transmembrane helix predicted for PMI0490 by TMHMM2.0 at aa 27-49
529507002512	Endolysins and autolysins are found in viruses and bacteria, respectively. The ds DNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell...; Region: endolysin_autolysin; cd00737
529507002513	catalytic residues [active]
529507002514	Signal peptide predicted for PMI0491 by SignalP 2.0 HMM (Signal peptide probability 0.991) with cleavage site probability 0.736 between residues 24 and 25
529507002515	1 probable transmembrane helix predicted for PMI0491 by TMHMM2.0 at aa 7-29
529507002516	HMMPfam hit to PF00959, Phage lysozyme, score 6.1e-34
529507002517	Bacteriophage lysis protein; Region: Phage_lysis; pfam03245
529507002518	HMMPfam hit to PF03245, Bacteriophage lysis protein, score 2.7e-13
529507002519	1 probable transmembrane helix predicted for PMI0492 by TMHMM2.0 at aa 6-25
529507002520	BRO family, N-terminal domain; Region: Bro-N; smart01040
529507002521	Predicted helix-turn-helix motif with score 1349.000, SD 3.78 at aa 21-42, sequence MSIREIASQYEITHQAISKRAK
529507002522	large terminase protein; Provisional; Region: 17; PHA02533
529507002523	Domain of unknown function (DUF4055); Region: DUF4055; pfam13264
529507002524	Phage Mu protein F like protein; Region: Phage_Mu_F; cl10072
529507002525	Bacterial surface proteins containing Ig-like domains [Cell motility and secretion]; Region: COG5492
529507002526	Bacteriophage related domain of unknown function; Region: DUF4128; pfam13554
529507002527	Phage tail protein; Region: Phage_tail_3; pfam08813
529507002528	Domain of unknown function (DUF1789); Region: DUF1789; pfam08748
529507002529	Phage related hypothetical protein (DUF1799); Region: DUF1799; pfam08809
529507002530	2 probable transmembrane helices predicted for PMI0511 by TMHMM2.0 at aa 46-68 and 90-112
529507002531	P22_AR N-terminal domain; Region: P22_AR_N; pfam10547
529507002532	HicB family; Region: HicB; pfam05534
529507002533	Arc-like DNA binding domain; Region: Arc; pfam03869
529507002534	ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the...; Region: ParA; cd02042
529507002535	CobQ/CobB/MinD/ParA nucleotide binding domain; Region: CbiA; pfam01656
529507002536	P-loop; other site
529507002537	Magnesium ion binding site [ion binding]; other site
529507002538	ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the...; Region: ParA; cd02042
529507002539	Magnesium ion binding site [ion binding]; other site
529507002540	HMMPfam hit to PF01656, CobQ/CobB/MinD/ParA nucleotide binding domai, score 2.7e-20
529507002541	Signal peptide predicted for PMI0518 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.997 between residues 26 and 27
529507002542	1 probable transmembrane helix predicted for PMI0518 by TMHMM2.0 at aa 5-27
529507002543	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507002544	Prophage tail length tape measure protein; Region: TMP_2; pfam06791
529507002545	phage tail tape measure protein, lambda family; Region: tape_meas_lam_C; TIGR01541
529507002546	Lambda phage tail tape-measure protein (Tape_meas_lam_C); Region: Tape_meas_lam_C; pfam09718
529507002547	HMMPfam hit to PF06791, Prophage tail length tape measure protein, score 3.8e-81
529507002548	Phage minor tail protein; Region: Phage_min_tail; pfam05939
529507002549	HMMPfam hit to PF05939, Phage minor tail protein, score 7.5e-41
529507002550	Phage-related protein [Function unknown]; Region: gp18; COG4672
529507002551	HMMPfam hit to PF05100, Phage minor tail protein L, score 1.4e-101
529507002552	Mpr1p, Pad1p N-terminal (MPN) domains with catalytic isopeptidase activity (metal-binding) found in proteins also containing NlpC/P60 domains; Region: MPN_NLPC_P60; cd08073
529507002553	MPN+ (JAMM) motif; other site
529507002554	Zinc-binding site [ion binding]; other site
529507002555	Cell wall-associated hydrolases (invasion-associated proteins) [Cell envelope biogenesis, outer membrane]; Region: Spr; COG0791
529507002556	NlpC/P60 family; Region: NLPC_P60; cl17555
529507002557	HMMPfam hit to PF00877, NlpC/P60 family, score 2e-31
529507002558	Phage-related protein, tail component [Function unknown]; Region: COG4723
529507002559	HMMPfam hit to PF06805, Bacteriophage lambda tail assembly prot, score 3.1e-91
529507002560	2 probable transmembrane helices predicted for PMI0526 by TMHMM2.0 at aa 89-108 and 113-135
529507002561	Phage-related protein, tail component [Function unknown]; Region: COG4733
529507002562	Putative phage tail protein; Region: Phage-tail_3; pfam13550
529507002563	Fibronectin type 3 domain; Region: FN3; smart00060
529507002564	Methyl-accepting chemotaxis protein (MCP), signaling domain; Region: MCP_signal; cd11386
529507002565	Domain of unknown function (DUF1983); Region: DUF1983; pfam09327
529507002566	HMMPfam hit to PF00041, Fibronectin type III domain, score 0.037
529507002567	HMMPfam hit to PF00041, Fibronectin type III domain, score 0.034
529507002568	1 probable transmembrane helix predicted for PMI0530 by TMHMM2.0 at aa 4-26
529507002569	fimbrial operon 4
529507002570	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
529507002571	non-specific DNA binding site [nucleotide binding]; other site
529507002572	salt bridge; other site
529507002573	sequence-specific DNA binding site [nucleotide binding]; other site
529507002574	HMMPfam hit to PF01381, Helix-turn-helix, score 1.7e-13
529507002575	Predicted helix-turn-helix motif with score 1573.000, SD 4.54 at aa 24-45, sequence MTGREIAHSLEISQQHYSRIEN
529507002576	P pilus assembly protein, pilin FimA [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimA; COG3539
529507002577	HMMPfam hit to PF00419, Fimbrial protein, score 5.4e-05
529507002578	Signal peptide predicted for PMI0533 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.914 between residues 20 and 21
529507002579	P pilus assembly protein, porin PapC [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimD; COG3188
529507002580	PapC N-terminal domain; Region: PapC_N; pfam13954
529507002581	Type VII secretion system (T7SS), usher protein; Region: Usher; pfam00577
529507002582	PapC C-terminal domain; Region: PapC_C; pfam13953
529507002583	HMMPfam hit to PF00577, Fimbrial Usher protein, score 0
529507002584	PS01151 Fimbrial biogenesis outer membrane usher protein signature.
529507002585	1 probable transmembrane helix predicted for PMI0534 by TMHMM2.0 at aa 12-34
529507002586	Signal peptide predicted for PMI0534 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.936 between residues 33 and 34
529507002587	putative chaperone protein EcpD; Provisional; Region: PRK09926
529507002588	Gram-negative pili assembly chaperone, N-terminal domain; Region: Pili_assembly_N; pfam00345
529507002589	Gram-negative pili assembly chaperone, C-terminal domain; Region: Pili_assembly_C; pfam02753
529507002590	HMMPfam hit to PF02753, Gram-negative pili assembly chaperone, score 9.4e-18
529507002591	HMMPfam hit to PF00345, Gram-negative pili assembly chaperone, score 2.7e-65
529507002592	PS00635 Gram-negative pili assembly chaperone signature.
529507002593	1 probable transmembrane helix predicted for PMI0535 by TMHMM2.0 at aa 20-42
529507002594	Signal peptide predicted for PMI0535 by SignalP 2.0 HMM (Signal peptide probability 0.960) with cleavage site probability 0.953 between residues 37 and 38
529507002595	P pilus assembly protein, pilin FimA [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimA; COG3539
529507002596	HMMPfam hit to PF00419, Fimbrial protein, score 1.6e-42
529507002597	PS00453 FKBP-type peptidyl-prolyl cis-trans isomerase signature 1.
529507002598	1 probable transmembrane helix predicted for PMI0536 by TMHMM2.0 at aa 5-27
529507002599	Signal peptide predicted for PMI0536 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 1.000 between residues 22 and 23
529507002600	1 probable transmembrane helix predicted for PMI0537 by TMHMM2.0 at aa 15-37
529507002601	DNA polymerase III, theta subunit; Region: DNA_pol3_theta; cl11635
529507002602	HMMPfam hit to PF06440, DNA polymerase III, theta subunit, score 3.9e-11
529507002603	glutaminyl-tRNA synthetase; Provisional; Region: PRK05347
529507002604	nucleotidyl transferase superfamily; Region: nt_trans; cl00015
529507002605	active site
529507002606	HIGH motif; other site
529507002607	nucleotide binding site [chemical binding]; other site
529507002608	catalytic core domain of glutaminyl-tRNA synthetase; Region: GlnRS_core; cd00807
529507002609	KMSKS motif; other site
529507002610	tRNA synthetases class I (E and Q), anti-codon binding domain; Region: tRNA-synt_1c_C; pfam03950
529507002611	HMMPfam hit to PF00749, tRNA synthetases class I (E and Q), ca, score 4.1e-184
529507002612	PS00178 Aminoacyl-transfer RNA synthetases class-I signature.
529507002613	HMMPfam hit to PF03950, tRNA synthetases class I (E and Q), an, score 6.1e-104
529507002614	outer membrane porin, OprD family; Region: OprD; pfam03573
529507002615	Uncharacterized integral membrane protein [Function unknown]; Region: COG3739
529507002616	HMMPfam hit to PF05675, Protein of unknown function (DUF817), score 1.2e-156
529507002617	8 probable transmembrane helices predicted for PMI0542 by TMHMM2.0 at aa 27-49, 59-78, 90-112, 122-141, 154-176, 180-202, 209-231 and 251-268
529507002618	PS00340 Growth factor and cytokines receptors family signature 2.
529507002619	ferric uptake regulator; Provisional; Region: fur; PRK09462
529507002620	Ferric uptake regulator(Fur) and related metalloregulatory proteins; typically iron-dependent, DNA-binding repressors and activators; Region: Fur_like; cd07153
529507002621	metal binding site 2 [ion binding]; metal-binding site
529507002622	putative DNA binding helix; other site
529507002623	metal binding site 1 [ion binding]; metal-binding site
529507002624	dimer interface [polypeptide binding]; other site
529507002625	structural Zn2+ binding site [ion binding]; other site
529507002626	HMMPfam hit to PF01475, Ferric uptake regulator family, score 2.2e-68
529507002627	flavodoxin FldA; Validated; Region: PRK09267
529507002628	HMMPfam hit to PF00258, Flavodoxin, score 4.6e-53
529507002629	PS00201 Flavodoxin signature.
529507002630	LexA regulated protein; Provisional; Region: PRK11675
529507002631	HMMPfam hit to PF01402, Ribbon-helix-helix protein, copG family, score 8.9e-07
529507002632	acyl-CoA esterase; Provisional; Region: PRK10673
529507002633	PGAP1-like protein; Region: PGAP1; pfam07819
529507002634	HMMPfam hit to PF00561, alpha/beta hydrolase fold, score 4.7e-16
529507002635	replication initiation regulator SeqA; Provisional; Region: PRK11187
529507002636	HMMPfam hit to PF03925, SeqA protein, score 6.3e-95
529507002637	phosphoglucomutase; Validated; Region: PRK07564
529507002638	This bacterial PGM-like (phosphoglucomutase-like) protein of unknown function belongs to the alpha-D-phosphohexomutase superfamily. The alpha-D-phosphohexomutases include several related enzymes that catalyze a reversible intramolecular phosphoryl...; Region: PGM_like3; cd05801
529507002639	active site
529507002640	substrate binding site [chemical binding]; other site
529507002641	metal binding site [ion binding]; metal-binding site
529507002642	HMMPfam hit to PF02878, Phosphoglucomutase/phosphomannomutase, al, score 1.4e-42
529507002643	PS00710 Phosphoglucomutase and phosphomannomutase phosphoserine signature.
529507002644	HMMPfam hit to PF02879, Phosphoglucomutase/phosphomannomutase, al, score 1.6e-17
529507002645	HMMPfam hit to PF02880, Phosphoglucomutase/phosphomannomutase, al, score 3.3e-24
529507002646	HMMPfam hit to PF00408, Phosphoglucomutase/phosphomannomutase, C-, score 5.8e-14
529507002647	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG4807
529507002648	Protein of unknown function (DUF1456); Region: DUF1456; pfam07308
529507002649	Protein of unknown function (DUF1456); Region: DUF1456; pfam07308
529507002650	HMMPfam hit to PF07308, Protein of unknown function (DUF1456), score 2.3e-32
529507002651	HMMPfam hit to PF07308, Protein of unknown function (DUF1456), score 1.2e-33
529507002652	putative addiction module antidote protein, CC2985 family; Region: antidote_CC2985; TIGR02606
529507002653	HMMPfam hit to PF03693, Uncharacterised protein family (UPF0156), score 9.3e-21
529507002654	Plasmid stabilization system protein [General function prediction only]; Region: ParE; COG3668
529507002655	HMMPfam hit to PF05016, Plasmid stabilisation system protein, score 9.8e-20
529507002656	Protein of unknown function (DUF1456); Region: DUF1456; pfam07308
529507002657	HMMPfam hit to PF07308, Protein of unknown function (DUF1456), score 1.8e-06
529507002658	PS00017 ATP/GTP-binding site motif A (P-loop).
529507002659	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
529507002660	non-specific DNA binding site [nucleotide binding]; other site
529507002661	salt bridge; other site
529507002662	sequence-specific DNA binding site [nucleotide binding]; other site
529507002663	HMMPfam hit to PF01381, Helix-turn-helix, score 2e-05
529507002664	Predicted helix-turn-helix motif with score 1565.000, SD 4.52 at aa 48-69, sequence VSQSEFAHALGTSIDTVKSWEL
529507002665	Protein of unknown function (DUF2517); Region: DUF2517; pfam10725
529507002666	1 probable transmembrane helix predicted for PMI0555 by TMHMM2.0 at aa 17-39
529507002667	Uncharacterized conserved protein [Function unknown]; Region: COG0327
529507002668	NIF3 (NGG1p interacting factor 3); Region: NIF3; cl15371
529507002669	HMMPfam hit to PF01784, NIF3 (NGG1p interacting factor 3), score 1.4e-101
529507002670	SWIM zinc finger; Region: SWIM; pfam04434
529507002671	HMMPfam hit to PF04434, SWIM zinc finger, score 0.031
529507002672	VWA domain containing CoxE-like protein; Region: VWA_CoxE; pfam05762
529507002673	Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF). Typically, the vWA domain is made up of approximately 200 amino acid residues folded into a classic a/b para-rossmann type of...; Region: vWFA; cl00057
529507002674	metal ion-dependent adhesion site (MIDAS); other site
529507002675	HMMPfam hit to PF05762, VWA domain containing CoxE-like protein, score 5.1e-57
529507002676	ATPases associated with a variety of cellular activities; Region: AAA; smart00382
529507002677	AAA domain (dynein-related subfamily); Region: AAA_5; pfam07728
529507002678	HMMPfam hit to PF07728, ATPase family associated with various cellul, score 1.1e-64
529507002679	HEAT repeats; Region: HEAT_2; pfam13646
529507002680	Domain of unknown function (DUF4132); Region: DUF4132; pfam13569
529507002681	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507002682	Major Facilitator Superfamily; Region: MFS_1; pfam07690
529507002683	putative substrate translocation pore; other site
529507002684	12 probable transmembrane helices predicted for PMI0562 by TMHMM2.0 at aa 5-27, 42-64, 71-90, 95-117, 130-152, 157-179, 209-231, 241-263, 272-290, 294-316, 328-350 and 354-371
529507002685	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 3.1e-48
529507002686	Signal peptide predicted for PMI0562 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.985 between residues 20 and 21
529507002687	helix_turn_helix, arabinose operon control protein; Region: HTH_ARAC; smart00342
529507002688	Bacterial regulatory helix-turn-helix proteins, AraC family; Region: HTH_AraC; pfam00165
529507002689	HMMPfam hit to PF00165, Bacterial regulatory helix-turn-helix protei, score 0.22
529507002690	Predicted helix-turn-helix motif with score 1422.000, SD 4.03 at aa 171-192, sequence PPLQELAQYIGASEKTITRLFY
529507002691	HMMPfam hit to PF00165, Bacterial regulatory helix-turn-helix protei, score 2.1e-05
529507002692	Escherichia coli (Ec) citrate synthase (CS) GltA_like. CS catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the citric acid cycle (TCA or Krebs cycle). The overall CS...; Region: EcCS_like; cd06114
529507002693	Citrate synthase [Energy production and conversion]; Region: GltA; COG0372
529507002694	dimer interface [polypeptide binding]; other site
529507002695	active site
529507002696	citrylCoA binding site [chemical binding]; other site
529507002697	NADH binding [chemical binding]; other site
529507002698	cationic pore residues; other site
529507002699	oxalacetate/citrate binding site [chemical binding]; other site
529507002700	coenzyme A binding site [chemical binding]; other site
529507002701	catalytic triad [active]
529507002702	HMMPfam hit to PF00285, Citrate synthase, score 1.7e-232
529507002703	PS00480 Citrate synthase signature.
529507002704	Succinate:quinone oxidoreductase (SQR) Type C subfamily, Succinate dehydrogenase C (SdhC) subunit; composed of bacterial SdhC and eukaryotic large cytochrome b binding (CybL) proteins. SQR catalyzes the oxidation of succinate to fumarate coupled to the...; Region: SQR_TypeC_SdhC; cd03499
529507002705	Iron-sulfur protein interface; other site
529507002706	proximal quinone binding site [chemical binding]; other site
529507002707	SdhD (CybS) interface [polypeptide binding]; other site
529507002708	proximal heme binding site [chemical binding]; other site
529507002709	HMMPfam hit to PF01127, Succinate dehydrogenase cytochrome b subunit, score 3.5e-35
529507002710	PS01000 Succinate dehydrogenase cytochrome b subunit signature 1.
529507002711	3 probable transmembrane helices predicted for PMI0565 by TMHMM2.0 at aa 23-45, 60-82 and 102-124
529507002712	PS01001 Succinate dehydrogenase cytochrome b subunit signature 2.
529507002713	Succinate:quinone oxidoreductase (SQR) Type C subfamily, Succinate dehydrogenase D (SdhD) subunit; SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol. E. coli SQR, a member of this subfamily, reduces the...; Region: SQR_TypeC_SdhD; cd03494
529507002714	SdhC subunit interface [polypeptide binding]; other site
529507002715	proximal heme binding site [chemical binding]; other site
529507002716	cardiolipin binding site; other site
529507002717	Iron-sulfur protein interface; other site
529507002718	proximal quinone binding site [chemical binding]; other site
529507002719	3 probable transmembrane helices predicted for PMI0566 by TMHMM2.0 at aa 15-37, 58-80 and 90-112
529507002720	succinate dehydrogenase flavoprotein subunit; Reviewed; Region: sdhA; PRK08958
529507002721	L-aspartate oxidase; Provisional; Region: PRK06175
529507002722	Fumarate reductase flavoprotein C-term; Region: Succ_DH_flav_C; pfam02910
529507002723	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507002724	PS00504 Fumarate reductase / succinate dehydrogenase FAD-binding site.
529507002725	HMMPfam hit to PF00890, FAD binding domain, score 1.3e-216
529507002726	HMMPfam hit to PF02910, Fumarate reductase/succinate dehydroge, score 1.5e-67
529507002727	succinate dehydrogenase iron-sulfur subunit; Reviewed; Region: sdhB; PRK05950
529507002728	2Fe-2S iron-sulfur cluster binding domain; Region: Fer2_3; pfam13085
529507002729	HMMPfam hit to PF00111, 2Fe-2S iron-sulfur cluster binding domain, score 0.022
529507002730	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
529507002731	2-oxoglutarate dehydrogenase E1 component; Reviewed; Region: sucA; PRK09404
529507002732	Thiamine pyrophosphate (TPP) family, E1 of OGDC-like subfamily, TPP-binding module; composed of proteins similar to the E1 component of the 2-oxoglutarate dehydrogenase multienzyme complex (OGDC). OGDC catalyzes the oxidative decarboxylation of...; Region: TPP_E1_OGDC_like; cd02016
529507002733	TPP-binding site [chemical binding]; other site
529507002734	Transketolase, pyrimidine binding domain; Region: Transket_pyr; pfam02779
529507002735	dimer interface [polypeptide binding]; other site
529507002736	PYR/PP interface [polypeptide binding]; other site
529507002737	TPP binding site [chemical binding]; other site
529507002738	HMMPfam hit to PF00676, Dehydrogenase E1 component, score 1.3e-26
529507002739	HMMPfam hit to PF02779, Transketolase, pyridine binding domain, score 3.7e-70
529507002740	dihydrolipoamide succinyltransferase; Validated; Region: PRK05704
529507002741	Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases. 2-oxo acid dehydrogenase multienzyme complexes, like pyruvate dehydrogenase (PDH), 2-oxoglutarate dehydrogenase (OGDH) and branched-chain 2-oxo acid...; Region: lipoyl_domain; cd06849
529507002742	E3 interaction surface; other site
529507002743	lipoyl attachment site [posttranslational modification]; other site
529507002744	e3 binding domain; Region: E3_binding; pfam02817
529507002745	2-oxoacid dehydrogenases acyltransferase (catalytic domain); Region: 2-oxoacid_dh; pfam00198
529507002746	HMMPfam hit to PF00364, Biotin-requiring enzyme, score 3.8e-24
529507002747	PS00189 2-oxo acid dehydrogenases acyltransferase component lipoyl binding site.
529507002748	HMMPfam hit to PF02817, e3 binding domain, score 1.9e-14
529507002749	HMMPfam hit to PF00198, 2-oxoacid dehydrogenases acyltransferas, score 7.9e-141
529507002750	succinyl-CoA synthetase subunit beta; Provisional; Region: sucC; PRK00696
529507002751	ATP-grasp domain; Region: ATP-grasp_2; pfam08442
529507002752	CoA-ligase; Region: Ligase_CoA; pfam00549
529507002753	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507002754	HMMPfam hit to PF02222, ATP-grasp domain, score 2.7e-27
529507002755	HMMPfam hit to PF00549, CoA-ligase, score 9.2e-82
529507002756	PS01217 ATP-citrate lyase / succinyl-CoA ligases family signature 3.
529507002757	succinyl-CoA synthetase subunit alpha; Validated; Region: PRK05678
529507002758	CoA binding domain; Region: CoA_binding; smart00881
529507002759	CoA-ligase; Region: Ligase_CoA; pfam00549
529507002760	HMMPfam hit to PF02629, CoA binding domain, score 1.7e-67
529507002761	HMMPfam hit to PF00549, CoA-ligase, score 4.2e-65
529507002762	PS01216 ATP-citrate lyase / succinyl-CoA ligases family signature 1.
529507002763	PS00399 ATP-citrate lyase / succinyl-CoA ligases family active site.
529507002764	cytochrome d terminal oxidase subunit 1; Provisional; Region: PRK15097
529507002765	Bacterial Cytochrome Ubiquinol Oxidase; Region: Bac_Ubq_Cox; cl00562
529507002766	HMMPfam hit to PF01654, Bacterial Cytochrome Ubiquinol Oxidase, score 0
529507002767	9 probable transmembrane helices predicted for PMI0573 by TMHMM2.0 at aa 20-42, 54-76, 96-118, 131-150, 185-207, 219-238, 387-409, 421-443 and 466-488
529507002768	cytochrome d ubiquinol oxidase subunit 2; Provisional; Region: PRK15003; cl12219
529507002769	Cytochrome oxidase subunit II; Region: Cyto_ox_2; pfam02322
529507002770	HMMPfam hit to PF02322, Cytochrome oxidase subunit II, score 2.2e-192
529507002771	8 probable transmembrane helices predicted for PMI0574 by TMHMM2.0 at aa 7-24, 77-99, 123-145, 165-187, 215-237, 269-288, 295-317 and 344-366
529507002772	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507002773	Membrane bound YbgT-like protein; Region: YbgT_YccB; cl02039
529507002774	Signal peptide predicted for PMI0575 by SignalP 2.0 HMM (Signal peptide probability 0.988) with cleavage site probability 0.351 between residues 20 and 21
529507002775	1 probable transmembrane helix predicted for PMI0575 by TMHMM2.0 at aa 2-24
529507002776	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507002777	hypothetical protein; Provisional; Region: PRK10588
529507002778	Signal peptide predicted for PMI0576 by SignalP 2.0 HMM (Signal peptide probability 0.997) with cleavage site probability 0.754 between residues 37 and 38
529507002779	3 probable transmembrane helices predicted for PMI0576 by TMHMM2.0 at aa 13-33, 43-65 and 70-92
529507002780	Transcriptional regulator [Transcription]; Region: LysR; COG0583
529507002781	Bacterial regulatory helix-turn-helix protein, lysR family; Region: HTH_1; pfam00126
529507002782	The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain; Region: PBP2_CrgA_like; cd08422
529507002783	putative effector binding pocket; other site
529507002784	dimerization interface [polypeptide binding]; other site
529507002785	HMMPfam hit to PF03466, LysR substrate binding domain, score 2.6e-32
529507002786	HMMPfam hit to PF00126, Bacterial regulatory helix-turn-helix, score 1.5e-19
529507002787	PS00044 Bacterial regulatory proteins, lysR family signature.
529507002788	Predicted helix-turn-helix motif with score 1665.000, SD 4.86 at aa 18-39, sequence GSFTQAAKYLRLSKSMVSIHIK
529507002789	drug resistance transporter, Bcr/CflA subfamily; Region: efflux_Bcr_CflA; TIGR00710
529507002790	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507002791	putative substrate translocation pore; other site
529507002792	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507002793	putative substrate translocation pore; other site
529507002794	Signal peptide predicted for PMI0578 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.997 between residues 33 and 34
529507002795	14 probable transmembrane helices predicted for PMI0578 by TMHMM2.0 at aa 7-29, 39-61, 68-87, 97-119, 132-154, 159-181, 194-216, 221-238, 259-281, 296-318, 325-343, 353-375, 396-416 and 421-443
529507002796	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 9.8e-57
529507002797	PS00217 Sugar transport proteins signature 2.
529507002798	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG4460
529507002799	4-hydroxybenzoyl-CoA thioesterase (4HBT). Catalyzes the final step in the 4-chlorobenzoate degradation pathway in which 4-chlorobenzoate is converted to 4-hydroxybenzoate in certain soil-dwelling bacteria. 4HBT forms a homotetramer with four active sites; Region: 4HBT; cd00586
529507002800	active site
529507002801	PS01328 4-hydroxybenzoyl-CoA thioesterase family active site.
529507002802	HMMPfam hit to PF03061, Thioesterase superfamily, score 4.5e-19
529507002803	colicin uptake protein TolQ; Provisional; Region: PRK10801
529507002804	3 probable transmembrane helices predicted for PMI0581 by TMHMM2.0 at aa 13-35, 133-155 and 170-192
529507002805	HMMPfam hit to PF01618, MotA/TolQ/ExbB proton channel family, score 2.3e-62
529507002806	colicin uptake protein TolR; Provisional; Region: PRK11024
529507002807	Biopolymer transport protein [Intracellular trafficking and secretion]; Region: ExbD; COG0848
529507002808	Signal peptide predicted for PMI0582 by SignalP 2.0 HMM (Signal peptide probability 0.709) with cleavage site probability 0.264 between residues 41 and 42
529507002809	HMMPfam hit to PF02472, Biopolymer transport protein ExbD/TolR, score 2.3e-15
529507002810	1 probable transmembrane helix predicted for PMI0582 by TMHMM2.0 at aa 17-39
529507002811	cell envelope integrity inner membrane protein TolA; Provisional; Region: tolA; PRK09510
529507002812	TolA C-terminal; Region: TolA; pfam06519
529507002813	HMMPfam hit to PF06519, TolA protein, score 1.3e-108
529507002814	1 probable transmembrane helix predicted for PMI0583 by TMHMM2.0 at aa 16-38
529507002815	translocation protein TolB; Provisional; Region: tolB; PRK03629
529507002816	TolB amino-terminal domain; Region: TolB_N; pfam04052
529507002817	WD40-like Beta Propeller Repeat; Region: PD40; pfam07676
529507002818	WD40-like Beta Propeller Repeat; Region: PD40; pfam07676
529507002819	Signal peptide predicted for PMI0584 by SignalP 2.0 HMM (Signal peptide probability 0.998) with cleavage site probability 0.916 between residues 23 and 24
529507002820	HMMPfam hit to PF04052, TolB amino-terminal domain, score 5.5e-70
529507002821	HMMPfam hit to PF07676, WD40-like Beta Propeller Repeat, score 0.65
529507002822	HMMPfam hit to PF07676, WD40-like Beta Propeller Repeat, score 1.5e-06
529507002823	HMMPfam hit to PF07676, WD40-like Beta Propeller Repeat, score 5.1e-09
529507002824	HMMPfam hit to PF07676, WD40-like Beta Propeller Repeat, score 0.83
529507002825	HMMPfam hit to PF07676, WD40-like Beta Propeller Repeat, score 0.12
529507002826	peptidoglycan-associated outer membrane lipoprotein; Provisional; Region: PRK10802
529507002827	Peptidoglycan binding domains similar to the C-terminal domain of outer-membrane protein OmpA; Region: OmpA_C-like; cd07185
529507002828	ligand binding site [chemical binding]; other site
529507002829	Signal peptide predicted for PMI0585 by SignalP 2.0 HMM (Signal peptide probability 0.805) with cleavage site probability 0.487 between residues 26 and 27
529507002830	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507002831	HMMPfam hit to PF00691, OmpA family, score 7.4e-50
529507002832	PS01068 OmpA-like domain.
529507002833	tol-pal system protein YbgF; Provisional; Region: PRK10803
529507002834	Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi; Region: TPR; cd00189
529507002835	TPR motif; other site
529507002836	Signal peptide predicted for PMI0586 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.856 between residues 27 and 28
529507002837	HMMPfam hit to PF07719, Tetratricopeptide repeat, score 0.026; HMMPfam hit to PF00515, Tetratricopeptide repeat, score 0.35
529507002838	HMMPfam hit to PF00515, Tetratricopeptide repeat, score 0.03; HMMPfam hit to PF07719, Tetratricopeptide repeat, score 0.00068
529507002839	Streptomycin adenylyltransferase; Region: Adenyl_transf; pfam04439
529507002840	nicotinamide riboside transporter PnuC; Provisional; Region: PRK15397
529507002841	HMMPfam hit to PF04973, Nicotinamide mononucleotide transport, score 4.8e-58
529507002842	7 probable transmembrane helices predicted for PMI0588 by TMHMM2.0 at aa 23-42, 49-71, 75-92, 113-142, 162-179, 184-203 and 207-229
529507002843	phospho-2-dehydro-3-deoxyheptonate aldolase; Validated; Region: PRK09261
529507002844	DAHP synthetase I family; Region: DAHP_synth_1; pfam00793
529507002845	HMMPfam hit to PF00793, DAHP synthetase I family, score 3e-172
529507002846	Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction; Region: HP_PGM_like; cd07067
529507002847	catalytic core [active]
529507002848	Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction; Region: HP_PGM_like; cd07067
529507002849	HMMPfam hit to PF00300, Phosphoglycerate mutase family, score 1.4e-129
529507002850	PS00175 Phosphoglycerate mutase family phosphohistidine signature.
529507002851	putative molybdenum transport ATP-binding protein ModF; Provisional; Region: PRK10938
529507002852	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
529507002853	Walker A/P-loop; other site
529507002854	ATP binding site [chemical binding]; other site
529507002855	Q-loop/lid; other site
529507002856	ABC transporter signature motif; other site
529507002857	Walker B; other site
529507002858	D-loop; other site
529507002859	H-loop/switch region; other site
529507002860	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
529507002861	Walker A/P-loop; other site
529507002862	ATP binding site [chemical binding]; other site
529507002863	Q-loop/lid; other site
529507002864	ABC transporter signature motif; other site
529507002865	Walker B; other site
529507002866	D-loop; other site
529507002867	H-loop/switch region; other site
529507002868	HMMPfam hit to PF00005, ABC transporter, score 7e-43
529507002869	PS00017 ATP/GTP-binding site motif A (P-loop).
529507002870	HMMPfam hit to PF00005, ABC transporter, score 2.6e-16
529507002871	PS00017 ATP/GTP-binding site motif A (P-loop).
529507002872	Hemolysin activation/secretion protein [Intracellular trafficking and secretion]; Region: FhaC; COG2831
529507002873	POTRA domain, ShlB-type; Region: POTRA_2; pfam08479
529507002874	Haemolysin secretion/activation protein ShlB/FhaC/HecB; Region: ShlB; pfam03865
529507002875	Signal peptide predicted for PMI0592 by SignalP 2.0 HMM (Signal peptide probability 0.924) with cleavage site probability 0.919 between residues 29 and 30
529507002876	HMMPfam hit to PF03865, Haemolysin secretion/activation protein ShlB, score 2.5e-12
529507002877	1 probable transmembrane helix predicted for PMI0592 by TMHMM2.0 at aa 9-31
529507002878	haemagglutination activity domain; Region: Haemagg_act; pfam05860
529507002879	Possible hemagglutinin (DUF637); Region: DUF637; pfam04830
529507002880	1 probable transmembrane helix predicted for PMI0593 by TMHMM2.0 at aa 12-34
529507002881	HMMPfam hit to PF05860, haemagglutination activity domain, score 2e-46
529507002882	HMMPfam hit to PF05594, Haemagluttinin repeat, score 0.0017
529507002883	HMMPfam hit to PF05594, Haemagluttinin repeat, score 5.1
529507002884	HMMPfam hit to PF05594, Haemagluttinin repeat, score 1.1
529507002885	HMMPfam hit to PF04830, Possible hemagglutinin (DUF637), score 1.9e-11
529507002886	DNA-binding transcriptional regulator ModE; Provisional; Region: PRK10676
529507002887	N-terminal domain of molybdenum-binding protein [General function prediction only]; Region: ModE; COG2005
529507002888	molybdenum-pterin binding domain; Region: Mop; TIGR00638
529507002889	Molybdopterin-binding protein [Coenzyme metabolism]; Region: MopI; COG3585
529507002890	HMMPfam hit to PF03459, TOBE domain, score 9.2e-06
529507002891	HMMPfam hit to PF03459, TOBE domain, score 6.4e-16
529507002892	HMMPfam hit to PF00126, Bacterial regulatory helix-turn-helix protei, score 5.9e-14
529507002893	Predicted helix-turn-helix motif with score 986.000, SD 2.55 at aa 32-53, sequence GSISQGAKMAGISYKSAWDAIN
529507002894	Protein of unknown function (DUF2592); Region: DUF2592; pfam10766
529507002895	1 probable transmembrane helix predicted for PMI0596 by TMHMM2.0 at aa 23-45
529507002896	molybdate transporter periplasmic protein; Provisional; Region: modA; PRK10677
529507002897	Bacterial extracellular solute-binding protein; Region: SBP_bac_1; cl17199
529507002898	Signal peptide predicted for PMI0597 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.970 between residues 24 and 25
529507002899	HMMPfam hit to PF01547, Bacterial extracellular solute-binding prot, score 0.00026
529507002900	ABC-type sulfate transport system, permease component [Posttranslational modification, protein turnover, chaperones]; Region: CysU; COG0555
529507002901	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
529507002902	dimer interface [polypeptide binding]; other site
529507002903	conserved gate region; other site
529507002904	putative PBP binding loops; other site
529507002905	ABC-ATPase subunit interface; other site
529507002906	HMMPfam hit to PF00528, Binding-protein-dependent transport syst, score 2.9e-26
529507002907	5 probable transmembrane helices predicted for PMI0598 by TMHMM2.0 at aa 20-38, 50-72, 92-114, 135-157 and 199-221
529507002908	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
529507002909	molybdate transporter ATP-binding protein; Provisional; Region: modC; PRK11144
529507002910	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
529507002911	Walker A/P-loop; other site
529507002912	ATP binding site [chemical binding]; other site
529507002913	Q-loop/lid; other site
529507002914	ABC transporter signature motif; other site
529507002915	Walker B; other site
529507002916	D-loop; other site
529507002917	H-loop/switch region; other site
529507002918	TOBE domain; Region: TOBE; cl01440
529507002919	HMMPfam hit to PF00005, ABC transporter, score 3.1e-59
529507002920	PS00017 ATP/GTP-binding site motif A (P-loop).
529507002921	PS00211 ABC transporters family signature.
529507002922	pyridoxal phosphate (PLP) phosphatase; Provisional; Region: PRK10530
529507002923	Haloacid dehalogenase-like hydrolases. The haloacid dehalogenase-like (HAD) superfamily includes L-2-haloacid dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, and many others; Region: HAD_like; cd01427
529507002924	active site
529507002925	motif I; other site
529507002926	motif II; other site
529507002927	Haloacid dehalogenase-like hydrolases. The haloacid dehalogenase-like (HAD) superfamily includes L-2-haloacid dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, and many others; Region: HAD_like; cd01427
529507002928	HMMPfam hit to PF00702, haloacid dehalogenase-like hydrolase, score 4.2e-11
529507002929	PS01229 Hypothetical cof family signature 2.
529507002930	6-phosphogluconolactonase; Provisional; Region: PRK11028
529507002931	adenosylmethionine--8-amino-7-oxononanoate transaminase; Validated; Region: PRK07986
529507002932	Acetyl ornithine aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD correspond to ornithine aminotransferase, acetylornithine aminotransferase; Region: OAT_like; cd00610
529507002933	inhibitor-cofactor binding pocket; inhibition site
529507002934	pyridoxal 5'-phosphate binding site [chemical binding]; other site
529507002935	catalytic residue [active]
529507002936	HMMPfam hit to PF00202, Aminotransferase class-III, score 5.1e-170
529507002937	PS00600 Aminotransferases class-III pyridoxal-phosphate attachment site.
529507002938	biotin synthase; Provisional; Region: PRK15108
529507002939	Radical SAM superfamily. Enzymes of this family generate radicals by combining a 4Fe-4S cluster and S-adenosylmethionine (SAM) in close proximity. They are characterized by a conserved CxxxCxxC motif, which coordinates the conserved iron-sulfur cluster; Region: Radical_SAM; cd01335
529507002940	FeS/SAM binding site; other site
529507002941	Biotin and Thiamin Synthesis associated domain; Region: BATS; smart00876
529507002942	HMMPfam hit to PF04055, Radical SAM superfamily, score 2.2e-25
529507002943	HMMPfam hit to PF06968, Biotin and Thiamin Synthesis associated d, score 3.5e-53
529507002944	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507002945	8-amino-7-oxononanoate synthase; Reviewed; Region: PRK05958
529507002946	pyridoxal phosphate-dependent acyltransferase, putative; Region: gly_Cac_T_rel; TIGR01825
529507002947	pyridoxal 5'-phosphate binding pocket [chemical binding]; other site
529507002948	catalytic residue [active]
529507002949	PS00414 Profilin signature.
529507002950	HMMPfam hit to PF00155, Aminotransferase class I and II, score 1.1e-34
529507002951	PS00599 Aminotransferases class-II pyridoxal-phosphate attachment site.
529507002952	biotin biosynthesis protein BioC; Region: BioC; TIGR02072
529507002953	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
529507002954	S-adenosylmethionine binding site [chemical binding]; other site
529507002955	AAA domain; Region: AAA_26; pfam13500
529507002956	dithiobiotin synthetase; Reviewed; Region: bioD; PRK00090
529507002957	HMMPfam hit to PF01656, CobQ/CobB/MinD/ParA nucleotide binding domai, score 7.7e-16
529507002958	excinuclease ABC subunit B; Provisional; Region: PRK05298
529507002959	DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region; Region: DEXDc; cd00046
529507002960	ATP binding site [chemical binding]; other site
529507002961	Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may...; Region: HELICc; cd00079
529507002962	nucleotide binding region [chemical binding]; other site
529507002963	ATP-binding site [chemical binding]; other site
529507002964	Ultra-violet resistance protein B; Region: UvrB; pfam12344
529507002965	UvrB/uvrC motif; Region: UVR; pfam02151
529507002966	HMMPfam hit to PF04851, Type III restriction enzyme, res subunit, score 1.1e-05
529507002967	PS00017 ATP/GTP-binding site motif A (P-loop).
529507002968	HMMPfam hit to PF00271, Helicase conserved C-terminal domain, score 4.3e-19
529507002969	HMMPfam hit to PF02151, UvrB/uvrC motif, score 5.1e-11
529507002970	Protein of unknown function (DUF1266); Region: DUF1266; pfam06889
529507002971	1 probable transmembrane helix predicted for PMI0608 by TMHMM2.0 at aa 4-26
529507002972	conserved hypothetical protein, cofD-related; Region: CofD_related; TIGR01826
529507002973	family of mostly uncharacterized proteins similar to B.subtilis YvcK; Region: YvcK_like; cd07187
529507002974	phosphate binding site [ion binding]; other site
529507002975	putative substrate binding pocket [chemical binding]; other site
529507002976	dimer interface [polypeptide binding]; other site
529507002977	HMMPfam hit to PF01933, Uncharacterised protein family UPF0052, score 9.6e-113
529507002978	molybdenum cofactor biosynthesis protein A; Reviewed; Region: moaA; PRK00164
529507002979	Radical SAM superfamily. Enzymes of this family generate radicals by combining a 4Fe-4S cluster and S-adenosylmethionine (SAM) in close proximity. They are characterized by a conserved CxxxCxxC motif, which coordinates the conserved iron-sulfur cluster; Region: Radical_SAM; cd01335
529507002980	FeS/SAM binding site; other site
529507002981	Molybdenum Cofactor Synthesis C; Region: Mob_synth_C; pfam06463
529507002982	HMMPfam hit to PF04055, Radical SAM superfamily, score 4.4e-39
529507002983	PS01305 moaA / nifB / pqqE family signature.
529507002984	HMMPfam hit to PF06463, Molybdenum Cofactor Synthesis C, score 4.6e-43
529507002985	MoaC family, prokaryotic and eukaryotic. Members of this family are involved in molybdenum cofactor (Moco) biosynthesis, an essential cofactor of a diverse group of redox enzymes. MoaC, a small hexameric protein, converts, together with MoaA, a guanosine...; Region: MoaC_PE; cd01420
529507002986	trimer interface [polypeptide binding]; other site
529507002987	dimer interface [polypeptide binding]; other site
529507002988	putative active site [active]
529507002989	HMMPfam hit to PF01967, MoaC family, score 3.1e-92
529507002990	Ubiquitin domain of MoaD-like proteins; Region: MoaD; cd00754
529507002991	MoaE interaction surface [polypeptide binding]; other site
529507002992	MoeB interaction surface [polypeptide binding]; other site
529507002993	thiocarboxylated glycine; other site
529507002994	HMMPfam hit to PF02597, ThiS family, score 5.3e-24
529507002995	MoaE family. Members of this family are involved in biosynthesis of the molybdenum cofactor (Moco), an essential cofactor for a diverse group of redox enzymes. Moco biosynthesis is an evolutionarily conserved pathway present in eubacteria, archaea and...; Region: MoaE; cd00756
529507002996	MoaE homodimer interface [polypeptide binding]; other site
529507002997	MoaD interaction [polypeptide binding]; other site
529507002998	active site residues [active]
529507002999	HMMPfam hit to PF02391, MoaE protein, score 1.5e-55
529507003000	Integral membrane protein, interacts with FtsH [General function prediction only]; Region: COG0670
529507003001	Bacterial BAX inhibitor (BI)-1/YccA-like proteins; Region: BI-1-like_bacterial; cd10432
529507003002	HMMPfam hit to PF01027, Uncharacterised protein family UPF0005, score 1.4e-43
529507003003	7 probable transmembrane helices predicted for PMI0614 by TMHMM2.0 at aa 25-47, 54-76, 86-108, 113-135, 140-162, 169-186 and 211-233
529507003004	YhgE/Pip N-terminal domain; Region: pip_yhgE_Nterm; TIGR03061
529507003005	ABC-type multidrug transport system, permease component [Defense mechanisms]; Region: COG0842
529507003006	ABC-2 type transporter; Region: ABC2_membrane; pfam01061
529507003007	6 probable transmembrane helices predicted for PMI0615 by TMHMM2.0 at aa 24-43, 174-196, 224-246, 256-278, 285-304 and 343-365
529507003008	HMMPfam hit to PF01061, ABC-2 type transporter, score 1.9e-40
529507003009	ABC-2 family transporter protein; Region: ABC2_membrane_2; pfam12679
529507003010	ABC-type multidrug transport system, permease component [Defense mechanisms]; Region: COG0842
529507003011	6 probable transmembrane helices predicted for PMI0616 by TMHMM2.0 at aa 33-55, 189-211, 237-259, 269-291, 298-320 and 355-377
529507003012	HMMPfam hit to PF01061, ABC-2 type transporter, score 8.9e-18
529507003013	ABC-type multidrug transport system, ATPase component [Defense mechanisms]; Region: CcmA; COG1131
529507003014	ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A; Region: ABC_DR_subfamily_A; cd03230
529507003015	Walker A/P-loop; other site
529507003016	ATP binding site [chemical binding]; other site
529507003017	Q-loop/lid; other site
529507003018	ABC transporter signature motif; other site
529507003019	Walker B; other site
529507003020	D-loop; other site
529507003021	H-loop/switch region; other site
529507003022	ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism]; Region: NatA; COG4555
529507003023	ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A; Region: ABC_DR_subfamily_A; cd03230
529507003024	Walker A/P-loop; other site
529507003025	ATP binding site [chemical binding]; other site
529507003026	Q-loop/lid; other site
529507003027	ABC transporter signature motif; other site
529507003028	Walker B; other site
529507003029	D-loop; other site
529507003030	H-loop/switch region; other site
529507003031	HMMPfam hit to PF00005, ABC transporter, score 5.2e-52
529507003032	PS00017 ATP/GTP-binding site motif A (P-loop).
529507003033	HMMPfam hit to PF00005, ABC transporter, score 5.3e-48
529507003034	PS00211 ABC transporters family signature.
529507003035	PS00017 ATP/GTP-binding site motif A (P-loop).
529507003036	putative efflux pump membrane fusion protein; Provisional; Region: PRK03598
529507003037	Biotin-lipoyl like; Region: Biotin_lipoyl_2; pfam13533
529507003038	HlyD family secretion protein; Region: HlyD_3; pfam13437
529507003039	HMMPfam hit to PF00529, HlyD family secretion protein, score 5e-18
529507003040	1 probable transmembrane helix predicted for PMI0618 by TMHMM2.0 at aa 7-25
529507003041	putative DNA-binding transcriptional regulator; Provisional; Region: PRK11552
529507003042	Bacterial regulatory proteins, tetR family; Region: TetR_N; pfam00440
529507003043	Domain of unknown function (DUF1956); Region: DUF1956; pfam09209
529507003044	HMMPfam hit to PF00440, Bacterial regulatory proteins, tetR family, score 6.4e-14
529507003045	ATP-dependent RNA helicase RhlE; Provisional; Region: PRK10590
529507003046	DEAD-box helicases. A diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker  B motif; Region: DEADc; cd00268
529507003047	ATP binding site [chemical binding]; other site
529507003048	Mg++ binding site [ion binding]; other site
529507003049	motif III; other site
529507003050	Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may...; Region: HELICc; cd00079
529507003051	nucleotide binding region [chemical binding]; other site
529507003052	ATP-binding site [chemical binding]; other site
529507003053	HMMPfam hit to PF04851, Type III restriction enzyme, res subunit, score 3.3e-06
529507003054	HMMPfam hit to PF00270, DEAD/DEAH box helicase, score 9.5e-68
529507003055	PS00017 ATP/GTP-binding site motif A (P-loop).
529507003056	PS00039 DEAD-box subfamily ATP-dependent helicases signature.
529507003057	HMMPfam hit to PF00271, Helicase conserved C-terminal domain, score 7.1e-31
529507003058	tRNA-dihydrouridine synthase C; Provisional; Region: PRK10550
529507003059	Dihydrouridine synthase-like (DUS-like) FMN-binding domain. Members of this family catalyze the reduction of the 5,6-double bond of a uridine residue on tRNA. Dihydrouridine modification of tRNA is widely observed in prokaryotes and eukaryotes, and also...; Region: DUS_like_FMN; cd02801
529507003060	FMN binding site [chemical binding]; other site
529507003061	active site
529507003062	catalytic residues [active]
529507003063	substrate binding site [chemical binding]; other site
529507003064	HMMPfam hit to PF01207, Dihydrouridine synthase (Dus), score 1.1e-111
529507003065	PS01136 Uncharacterized protein family UPF0034 signature.
529507003066	Transglycosylase associated protein; Region: Transgly_assoc; cl00978
529507003067	3 probable transmembrane helices predicted for PMI0622 by TMHMM2.0 at aa 21-43, 58-80 and 87-109
529507003068	HMMPfam hit to PF04226, Transglycosylase associated protein, score 3.4e-14
529507003069	3-mercaptopyruvate sulfurtransferase; Provisional; Region: sseA; PRK11493
529507003070	Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain. TST contains 2 copies of the Rhodanese Homology Domain; this is the 1st repeat, which does not contain the catalytically active Cys residue. The role of the 1st repeat is uncertain, but it...; Region: TST_Repeat_1; cd01448
529507003071	active site residue [active]
529507003072	Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain. TST contains 2 copies of the Rhodanese Homology Domain; this is the second repeat. Only the second repeat contains the catalytically active Cys residue; Region: TST_Repeat_2; cd01449
529507003073	active site residue [active]
529507003074	HMMPfam hit to PF00581, Rhodanese-like domain, score 1.6e-24
529507003075	HMMPfam hit to PF00581, Rhodanese-like domain, score 5.5e-18
529507003076	PS00380 Rhodanese signature 1.
529507003077	1 probable transmembrane helix predicted for PMI0624 by TMHMM2.0 at aa 21-43
529507003078	Signal peptide predicted for PMI0624 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.588 between residues 22 and 23
529507003079	C4-dicarboxylate transporter [Energy production and conversion]; Region: DcuC; COG3069
529507003080	HMMPfam hit to PF03606, C4-dicarboxylate anaerobic carrier, score 1e-65
529507003081	10 probable transmembrane helices predicted for PMI0625 by TMHMM2.0 at aa 36-58, 82-104, 161-183, 210-232, 242-259, 280-298, 313-335, 342-364, 374-396 and 403-422
529507003082	Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism]; Region: MetC; COG0626
529507003083	Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes. PLP combines with an alpha-amino acid to form a compound called a Schiff base or aldimine intermediate, which depending on the reaction, is the...; Region: AAT_I; cl00321
529507003084	pyridoxal 5'-phosphate binding pocket [chemical binding]; other site
529507003085	catalytic residue [active]
529507003086	HMMPfam hit to PF01053, Cys/Met metabolism PLP-dependent enzy, score 7e-103
529507003087	PS00868 Cys/Met metabolism enzymes pyridoxal-phosphate attachment site.
529507003088	prokaryotic 3-carboxy-cis,cis-muconate cycloisomerase (CMLE)_like; Region: pCLME; cd01597
529507003089	Adenylosuccinate lyase [Nucleotide transport and metabolism]; Region: PurB; COG0015
529507003090	tetramer interface [polypeptide binding]; other site
529507003091	active site
529507003092	HMMPfam hit to PF00206, Lyase, score 1.4e-23
529507003093	PS00043 Bacterial regulatory proteins, gntR family signature.
529507003094	PS00163 Fumarate lyases signature.
529507003095	MmgE/PrpD family; Region: MmgE_PrpD; cl00912
529507003096	HMMPfam hit to PF03972, MmgE/PrpD family, score 4.3e-80
529507003097	DNA-binding transcriptional repressor LrhA; Provisional; Region: PRK15092
529507003098	Bacterial regulatory helix-turn-helix protein, lysR family; Region: HTH_1; pfam00126
529507003099	The C-terminal substrate domain of LysR-like regulator LrhA (LysR homologue A) and that of closely related homologs, contains the type 2 periplasmic binding fold; Region: PBP2_LrhA_like; cd08439
529507003100	putative dimerization interface [polypeptide binding]; other site
529507003101	HMMPfam hit to PF03466, LysR substrate binding domain, score 4.5e-26
529507003102	HMMPfam hit to PF00126, Bacterial regulatory helix-turn-helix, score 4.6e-15
529507003103	PS00044 Bacterial regulatory proteins, lysR family signature.
529507003104	Predicted helix-turn-helix motif with score 1340.000, SD 3.75 at aa 26-47, sequence STFAAAAESVCRTQSAVSQQMQ
529507003105	Signal peptide predicted for PMI0629 by SignalP 2.0 HMM (Signal peptide probability 0.625) with cleavage site probability 0.405 between residues 31 and 32
529507003106	ATP-dependent DNA helicase DinG; Provisional; Region: dinG; PRK11747
529507003107	DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region; Region: DEXDc; cl17251
529507003108	DEAD_2; Region: DEAD_2; pfam06733
529507003109	Helicase C-terminal domain; Region: Helicase_C_2; pfam13307
529507003110	PS00017 ATP/GTP-binding site motif A (P-loop).
529507003111	DNA-binding ferritin-like protein (oxidative damage protectant) [Inorganic ion transport and metabolism]; Region: Dps; COG0783
529507003112	DPS protein, ferritin-like diiron-binding domain; Region: DPS; cd01043
529507003113	dimerization interface [polypeptide binding]; other site
529507003114	DPS ferroxidase diiron center [ion binding]; other site
529507003115	ion pore; other site
529507003116	HMMPfam hit to PF00210, Ferritin-like domain, score 4.7e-25
529507003117	PS00818 Dps protein family signature 1.
529507003118	threonine and homoserine efflux system; Provisional; Region: PRK10532
529507003119	EamA-like transporter family; Region: EamA; pfam00892
529507003120	10 probable transmembrane helices predicted for PMI0632 by TMHMM2.0 at aa 12-29, 39-61, 68-90, 95-117, 124-141, 151-168, 175-196, 206-228, 241-260 and 265-284
529507003121	HMMPfam hit to PF00892, Integral membrane protein DUF6, score 3.7e-20
529507003122	Signal peptide predicted for PMI0632 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.981 between residues 33 and 34
529507003123	Possible lysine decarboxylase; Region: Lysine_decarbox; cl00695
529507003124	Signal peptide predicted for PMI0633 by SignalP 2.0 HMM (Signal peptide probability 0.847) with cleavage site probability 0.747 between residues 22 and 23
529507003125	HMMPfam hit to PF03641, Possible lysine decarboxylase, score 7.6e-61
529507003126	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cd04301
529507003127	Coenzyme A binding pocket [chemical binding]; other site
529507003128	HMMPfam hit to PF00583, Acetyltransferase (GNAT) family, score 7.2e-19
529507003129	Predicted metal-dependent hydrolase with the TIM-barrel fold [General function prediction only]; Region: COG1574
529507003130	YtcJ_like metal dependent amidohydrolases. YtcJ is a Bacillus subtilis ORF of unknown function. The Arabidopsis homolog LAF3 has been identified as a factor required for photochrome A signalling; Region: YtcJ_like; cd01300
529507003131	active site
529507003132	HMMPfam hit to PF01979, Amidohydrolase family, score 0.0051
529507003133	molybdopterin biosynthesis protein MoeB; Provisional; Region: PRK05690
529507003134	ThiF_MoeB_HesA. Family of E1-like enzymes involved in molybdopterin and thiamine biosynthesis family. The common reaction mechanism catalyzed by MoeB and ThiF, like other E1 enzymes, begins with a nucleophilic attack of the C-terminal carboxylate of MoaD...; Region: ThiF_MoeB_HesA_family; cd00757
529507003135	ATP binding site [chemical binding]; other site
529507003136	substrate interface [chemical binding]; other site
529507003137	HMMPfam hit to PF05237, MoeZ/MoeB domain, score 1e-38
529507003138	HMMPfam hit to PF00899, ThiF family, score 9.7e-54
529507003139	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507003140	molybdopterin biosynthesis protein MoeA; Provisional; Region: PRK10680
529507003141	MoeA family. Members of this family are involved in biosynthesis of the molybdenum cofactor (MoCF), an essential cofactor of a diverse group of redox enzymes. MoCF biosynthesis is an evolutionarily conserved pathway present in eubacteria, archaea and...; Region: MoeA; cd00887
529507003142	dimer interface [polypeptide binding]; other site
529507003143	putative functional site; other site
529507003144	putative MPT binding site; other site
529507003145	HMMPfam hit to PF03454, MoeA C-terminal region (domain IV), score 1.2e-14
529507003146	HMMPfam hit to PF00994, Probable molybdopterin binding domain, score 6.8e-57
529507003147	PS01079 Molybdenum cofactor biosynthesis proteins signature 2.
529507003148	HMMPfam hit to PF03453, MoeA N-terminal region (domain I and II, score 2.6e-72
529507003149	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507003150	Major Facilitator Superfamily; Region: MFS_1; pfam07690
529507003151	putative substrate translocation pore; other site
529507003152	12 probable transmembrane helices predicted for PMI0638 by TMHMM2.0 at aa 13-35, 48-65, 78-100, 110-132, 139-161, 171-190, 215-237, 247-269, 276-295, 299-321, 333-355 and 365-382
529507003153	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 3.1e-17
529507003154	HMMPfam hit to PF06779, Protein of unknown function (DUF1228), score 8.3e-35
529507003155	GTP cyclohydrolase I; Provisional; Region: folE; PRK09347
529507003156	active site
529507003157	HMMPfam hit to PF01227, GTP cyclohydrolase I, score 3.6e-56
529507003158	PS00859 GTP cyclohydrolase I signature 1.
529507003159	PS00860 GTP cyclohydrolase I signature 2.
529507003160	hypothetical protein; Provisional; Region: PRK10835
529507003161	Predicted membrane protein [Function unknown]; Region: COG2311
529507003162	HMMPfam hit to PF04171, Protein of unknown function (DUF405), score 7.4e-37
529507003163	10 probable transmembrane helices predicted for PMI0640 by TMHMM2.0 at aa 17-39, 59-81, 88-107, 112-129, 136-158, 206-225, 232-254, 269-291, 304-326 and 341-363
529507003164	HMMPfam hit to PF04235, Protein of unknown function (DUF418), score 1.8e-27
529507003165	YdcF-like. YdcF-like is a large family of mainly bacterial proteins, with a few members found in fungi, plants, and archaea. Escherichia coli YdcF has been shown to bind S-adenosyl-L-methionine (AdoMet), but a biochemical function has not been...; Region: YdcF-like; cd06259
529507003166	putative active site [active]
529507003167	HMMPfam hit to PF02698, DUF218 domain, score 1.9e-37
529507003168	1 probable transmembrane helix predicted for PMI0641 by TMHMM2.0 at aa 7-29
529507003169	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507003170	Signal peptide predicted for PMI0641 by SignalP 2.0 HMM (Signal peptide probability 0.997) with cleavage site probability 0.908 between residues 22 and 23
529507003171	malate dehydrogenase; Provisional; Region: PRK13529
529507003172	Malic enzyme, N-terminal domain; Region: malic; pfam00390
529507003173	NAD(P) binding domain of malic enzyme (ME), subgroup 1; Region: NAD_bind_1_malic_enz; cd05312
529507003174	NAD(P) binding site [chemical binding]; other site
529507003175	HMMPfam hit to PF03949, Malic enzyme, NAD binding domain, score 2.3e-129
529507003176	PS00331 Malic enzymes signature.
529507003177	HMMPfam hit to PF00390, Malic enzyme, N-terminal domain, score 1.9e-123
529507003178	cytidine deaminase; Provisional; Region: PRK09027
529507003179	Cytidine deaminase zinc-binding domain. These enzymes are Zn dependent. The zinc ion in the active site plays a central role in the proposed catalytic mechanism, activating a water molecule to form a hydroxide ion that performs a nucleophilic attack on...; Region: cytidine_deaminase; cd01283
529507003180	active site
529507003181	catalytic motif [active]
529507003182	Zn binding site [ion binding]; other site
529507003183	Cytidine deaminase zinc-binding domain. These enzymes are Zn dependent. The zinc ion in the active site plays a central role in the proposed catalytic mechanism, activating a water molecule to form a hydroxide ion that performs a nucleophilic attack on...; Region: cytidine_deaminase; cd01283
529507003184	active site
529507003185	catalytic motif [active]
529507003186	Zn binding site [ion binding]; other site
529507003187	HMMPfam hit to PF00383, Cytidine and deoxycytidylate deaminase, score 8.8e-22
529507003188	PS00903 Cytidine and deoxycytidylate deaminases zinc-binding region signature.
529507003189	hypothetical protein; Provisional; Region: PRK10711
529507003190	HMMPfam hit to PF04172, LrgB-like family, score 1.3e-115
529507003191	6 probable transmembrane helices predicted for PMI0644 by TMHMM2.0 at aa 4-21, 32-54, 58-80, 93-115, 142-164 and 203-225
529507003192	hypothetical protein; Provisional; Region: PRK01821
529507003193	HMMPfam hit to PF03788, LrgA family, score 3.6e-48
529507003194	4 probable transmembrane helices predicted for PMI0645 by TMHMM2.0 at aa 20-42, 52-74, 81-103 and 107-129
529507003195	Signal peptide predicted for PMI0645 by SignalP 2.0 HMM (Signal peptide probability 0.622) with cleavage site probability 0.305 between residues 43 and 44
529507003196	methionyl-tRNA synthetase; Reviewed; Region: metG; PRK00133
529507003197	catalytic core domain of methioninyl-tRNA synthetases; Region: MetRS_core; cd00814
529507003198	active site
529507003199	HIGH motif; other site
529507003200	KMSKS motif; other site
529507003201	Anticodon-binding domain of methionyl tRNA synthetases; Region: Anticodon_Ia_Met; cd07957
529507003202	tRNA binding surface [nucleotide binding]; other site
529507003203	anticodon binding site; other site
529507003204	tRNA-binding-domain-containing Escherichia coli methionyl-tRNA synthetase (EcMetRS)-like proteins.  This family includes EcMetRS and Aquifex aeolicus Trbp111 (AaTrbp111). This domain has general tRNA binding properties.  MetRS aminoacylates methionine...; Region: tRNA_bind_EcMetRS_like; cd02800
529507003205	dimer interface [polypeptide binding]; other site
529507003206	putative tRNA-binding site [nucleotide binding]; other site
529507003207	HMMPfam hit to PF01588, tRNA binding domain, score 9.1e-40
529507003208	HMMPfam hit to PF00133, tRNA synthetases class I (I, L, M and V), score 2.9e-05
529507003209	PS00178 Aminoacyl-transfer RNA synthetases class-I signature.
529507003210	antiporter inner membrane protein; Provisional; Region: PRK11670
529507003211	MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily. Like the other members of the superfamily, MRP contains a ATP-binding domain at the N-termini. It is found in bacteria as a membrane-spanning protein and functions...; Region: MRP-like; cd02037
529507003212	PS00017 ATP/GTP-binding site motif A (P-loop).
529507003213	PS01215 Mrp family signature.
529507003214	Uridine kinase [Nucleotide transport and metabolism]; Region: Udk; COG0572
529507003215	Uridine monophosphate kinase (UMPK, EC 2.7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK), catalyzes the reversible phosphoryl transfer from ATP to uridine or cytidine to yield UMP or CMP. In the primidine nucleotide-salvage pathway; Region: UMPK; cd02023
529507003216	ATP-binding site [chemical binding]; other site
529507003217	Sugar specificity; other site
529507003218	Pyrimidine base specificity; other site
529507003219	HMMPfam hit to PF00485, Phosphoribulokinase / Uridine kinase family, score 2.8e-50
529507003220	PS00017 ATP/GTP-binding site motif A (P-loop).
529507003221	Trimeric dUTP diphosphatases; Region: trimeric_dUTPase; cd07557
529507003222	trimer interface [polypeptide binding]; other site
529507003223	active site
529507003224	HMMPfam hit to PF00692, dUTPase, score 3.6e-28
529507003225	putative assembly protein; Provisional; Region: PRK10833
529507003226	AsmA-like C-terminal region; Region: AsmA_2; pfam13502
529507003227	HMMPfam hit to PF05170, AsmA family, score 8.4e-42
529507003228	Signal peptide predicted for PMI0651 by SignalP 2.0 HMM (Signal peptide probability 0.988) with cleavage site probability 0.329 between residues 25 and 26
529507003229	1 probable transmembrane helix predicted for PMI0651 by TMHMM2.0 at aa 7-26
529507003230	C4-dicarboxylate transporter DcuC; Provisional; Region: dcuC; PRK10654
529507003231	C4-dicarboxylate anaerobic carrier; Region: DcuC; pfam03606
529507003232	11 probable transmembrane helices predicted for PMI0652 by TMHMM2.0 at aa 21-38, 48-70, 91-113, 142-164, 177-199, 219-238, 262-280, 290-312, 333-355, 360-382 and 452-471
529507003233	HMMPfam hit to PF03606, C4-dicarboxylate anaerobic carrier, score 2.4e-196
529507003234	Membrane protein TerC, possibly involved in tellurium resistance [Inorganic ion transport and metabolism]; Region: TerC; COG0861
529507003235	Hemolysins and related proteins containing CBS domains [General function prediction only]; Region: TlyC; COG1253
529507003236	This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain. CorC_HlyC is a transporter associated domain. This small domain is found in Na+/H+ antiporters, in proteins involved in...; Region: CBS_pair_CorC_HlyC_assoc; cd04590
529507003237	Transporter associated domain; Region: CorC_HlyC; smart01091
529507003238	HMMPfam hit to PF03471, Transporter associated domain, score 5.9e-23
529507003239	HMMPfam hit to PF00571, CBS domain, score 5.4e-09
529507003240	HMMPfam hit to PF00571, CBS domain, score 1.6e-06
529507003241	7 probable transmembrane helices predicted for PMI0653 by TMHMM2.0 at aa 38-60, 73-95, 110-127, 148-170, 175-197, 210-232 and 237-256
529507003242	HMMPfam hit to PF03741, Integral membrane protein TerC family, score 1.3e-74
529507003243	transposase (fragment)
529507003244	HMMPfam hit to PF07282, transposase DNA-binding domai, score 4.7e-34
529507003245	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507003246	6-phosphogluconate dehydrogenase-like protein; Reviewed; Region: PRK09599
529507003247	6-phosphogluconate dehydrogenase; Validated; Region: PRK09287
529507003248	6-phosphogluconate dehydrogenase, C-terminal domain; Region: 6PGD; pfam00393
529507003249	HMMPfam hit to PF03446, NAD binding domain of 6-phosphogluconat, score 8.3e-122
529507003250	HMMPfam hit to PF00393, 6-phosphogluconate dehydrogenase, C-ter, score 3.6e-234
529507003251	PS00461 6-phosphogluconate dehydrogenase signature.
529507003252	YeaK is an uncharacterized Echerichia coli protein with a YbaK-like domain of unknown function.  The YbaK-like domain family includes the INS amino acid-editing domain of the bacterial class II prolyl tRNA synthetase (ProRS), and it's trans-acting...; Region: YeaK; cd04336
529507003253	putative deacylase active site [active]
529507003254	HMMPfam hit to PF04073, YbaK / prolyl-tRNA synthetases associated do, score 8.6e-37
529507003255	putative alcohol dehydrogenase; Provisional; Region: PRK09860
529507003256	Lactadehyde:propanediol oxidoreductase (LPO) catalyzes the interconversion between L-lactaldehyde and L-1,2-propanediol in Escherichia coli and other enterobacteria; Region: LPO; cd08176
529507003257	dimer interface [polypeptide binding]; other site
529507003258	active site
529507003259	metal binding site [ion binding]; metal-binding site
529507003260	HMMPfam hit to PF00465, Iron-containing alcohol dehydrogenase, score 1.5e-207
529507003261	PS00913 Iron-containing alcohol dehydrogenases signature 1.
529507003262	PS00060 Iron-containing alcohol dehydrogenases signature 2.
529507003263	Phosphoribosyl-AMP cyclohydrolase [Amino acid transport and metabolism]; Region: HisI; COG0139
529507003264	bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase protein; Reviewed; Region: PRK02759
529507003265	Nucleoside Triphosphate Pyrophosphohydrolase (EC 3.6.1.8) MazG-like domain found in Escherichia coli phosphoribosyl-ATP pyrophosphohydrolase (HisIE or PRATP-PH) and its homologs; Region: NTP-PPase_HisIE_like; cd11534
529507003266	metal binding site [ion binding]; metal-binding site
529507003267	HMMPfam hit to PF01503, Phosphoribosyl-ATP pyrophosphohydrolase, score 6.6e-46
529507003268	HMMPfam hit to PF01502, Phosphoribosyl-AMP cyclohydrolase, score 8.6e-42
529507003269	The cyclase subunit of imidazoleglycerol phosphate synthase (HisF). Imidazole glycerol phosphate synthase (IGPS) catalyzes the fifth step of histidine biosynthesis, the formation of the imidazole ring. IGPS converts N1-(5'-phosphoribulosyl)...; Region: HisF; cd04731
529507003270	Histidine biosynthesis protein; Region: His_biosynth; pfam00977
529507003271	substrate binding site [chemical binding]; other site
529507003272	glutamase interaction surface [polypeptide binding]; other site
529507003273	HMMPfam hit to PF00977, Histidine biosynthesis protein, score 2.2e-113
529507003274	HisA.  Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase catalyzes the fourth step in histidine biosynthesis, an isomerisation of the aminoaldose moiety of ProFAR to the aminoketose of PRFAR (N-(5'-phospho-D-1...; Region: HisA; cd04732
529507003275	phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase; Region: TIGR00007
529507003276	catalytic residues [active]
529507003277	HMMPfam hit to PF00977, Histidine biosynthesis protein, score 4.1e-108
529507003278	imidazole glycerol phosphate synthase subunit HisH; Provisional; Region: hisH; PRK13170
529507003279	Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS); Region: GATase1_IGP_Synthase; cd01748
529507003280	putative active site [active]
529507003281	oxyanion strand; other site
529507003282	catalytic triad [active]
529507003283	HMMPfam hit to PF00117, Glutamine amidotransferase class-I, score 6.4e-42
529507003284	PS00442 Glutamine amidotransferases class-I active site.
529507003285	imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional; Region: PRK05446
529507003286	Haloacid dehalogenase-like hydrolases. The haloacid dehalogenase-like (HAD) superfamily includes L-2-haloacid dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, and many others; Region: HAD_like; cd01427
529507003287	active site
529507003288	motif I; other site
529507003289	motif II; other site
529507003290	Imidazoleglycerol-phosphate dehydratase; Region: IGPD; cd07914
529507003291	putative active site pocket [active]
529507003292	4-fold oligomerization interface [polypeptide binding]; other site
529507003293	metal binding residues [ion binding]; metal-binding site
529507003294	3-fold/trimer interface [polypeptide binding]; other site
529507003295	HMMPfam hit to PF00475, Imidazoleglycerol-phosphate dehydratase, score 2.4e-103
529507003296	PS00955 Imidazoleglycerol-phosphate dehydratase signature 2.
529507003297	PS00954 Imidazoleglycerol-phosphate dehydratase signature 1.
529507003298	histidinol-phosphate aminotransferase; Provisional; Region: PRK01688
529507003299	Aspartate aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). Pyridoxal phosphate combines with an alpha-amino acid to form a compound called a Schiff base or aldimine...; Region: AAT_like; cd00609
529507003300	pyridoxal 5'-phosphate binding site [chemical binding]; other site
529507003301	homodimer interface [polypeptide binding]; other site
529507003302	catalytic residue [active]
529507003303	HMMPfam hit to PF00155, Aminotransferase class I and II, score 1.6e-58
529507003304	PS00599 Aminotransferases class-II pyridoxal-phosphate attachment site.
529507003305	Histidinol dehydrogenase [Amino acid transport and metabolism]; Region: HisD; COG0141
529507003306	Histidinol dehydrogenase, HisD, E.C 1.1.1.23. Histidinol dehydrogenase catalyzes the last two steps in the L-histidine biosynthesis pathway, which is conserved in bacteria, archaea, fungi, and plants. These last two steps are (i) the NAD-dependent...; Region: Histidinol_dh; cd06572
529507003307	NAD binding site [chemical binding]; other site
529507003308	dimerization interface [polypeptide binding]; other site
529507003309	product binding site; other site
529507003310	substrate binding site [chemical binding]; other site
529507003311	zinc binding site [ion binding]; other site
529507003312	catalytic residues [active]
529507003313	HMMPfam hit to PF00815, Histidinol dehydrogenase, score 9.6e-241
529507003314	PS00611 Histidinol dehydrogenase signature.
529507003315	ATP phosphoribosyltransferase; Reviewed; Region: hisG; PRK00489
529507003316	ATP phosphoribosyltransferase; Region: hisG; TIGR00070
529507003317	ATP phosphoribosyltransferase, C-terminal domain; Region: HisG_C-term; TIGR03455
529507003318	HMMPfam hit to PF01634, ATP phosphoribosyltransferase, score 4.6e-80
529507003319	PS01316 ATP phosphoribosyltransferase signature.
529507003320	Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]; Region: WcaG; COG0451
529507003321	atypical (a) SDRs, subgroup 4; Region: SDR_a4; cd05266
529507003322	putative NAD(P) binding site [chemical binding]; other site
529507003323	Signal peptide predicted for PMI0667 by SignalP 2.0 HMM (Signal peptide probability 0.783) with cleavage site probability 0.394 between residues 19 and 20
529507003324	Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]; Region: Gst; COG0625
529507003325	GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of...; Region: GST_N_2; cd03047
529507003326	putative C-terminal domain interface [polypeptide binding]; other site
529507003327	putative GSH binding site (G-site) [chemical binding]; other site
529507003328	putative dimer interface [polypeptide binding]; other site
529507003329	C-terminal, alpha helical domain of an unknown subfamily 2 of Glutathione S-transferases; Region: GST_C_2; cd03180
529507003330	putative N-terminal domain interface [polypeptide binding]; other site
529507003331	putative dimer interface [polypeptide binding]; other site
529507003332	putative substrate binding pocket (H-site) [chemical binding]; other site
529507003333	HMMPfam hit to PF00043, Glutathione S-transferase, C-terminal domain, score 3.2e-11
529507003334	HMMPfam hit to PF02798, Glutathione S-transferase, N-terminal domain, score 1.1e-09
529507003335	D-alanyl-D-alanine carboxypeptidase fraction C; Provisional; Region: PRK10001
529507003336	Beta-lactamase enzyme family; Region: Beta-lactamase2; cl17872
529507003337	Penicillin-binding protein 5, C-terminal domain; Region: PBP5_C; smart00936
529507003338	Signal peptide predicted for PMI0669 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.988 between residues 28 and 29
529507003339	1 probable transmembrane helix predicted for PMI0669 by TMHMM2.0 at aa 7-29
529507003340	HMMPfam hit to PF00768, D-alanyl-D-alanine carboxypeptidase, score 4.5e-135
529507003341	HMMPfam hit to PF07943, Penicillin-binding protein 5, C-termina, score 2.1e-36
529507003342	formate--tetrahydrofolate ligase; Provisional; Region: PRK13505
529507003343	Formyltetrahydrofolate synthetase (FTHFS) catalyzes the ATP-dependent activation of formate ion via its addition to the N10 position of tetrahydrofolate. FTHFS is a highly expressed key enzyme in both the Wood-Ljungdahl pathway of autotrophic CO2...; Region: FTHFS; cd00477
529507003344	Potassium binding sites [ion binding]; other site
529507003345	Cesium cation binding sites [ion binding]; other site
529507003346	HMMPfam hit to PF01268, Formate--tetrahydrofolate ligase, score 0
529507003347	PS00721 Formate--tetrahydrofolate ligase signature 1.
529507003348	PS00017 ATP/GTP-binding site motif A (P-loop).
529507003349	L-serine dehydratase, iron-sulfur-dependent, single chain form; Region: sda_mono; TIGR00720
529507003350	Serine dehydratase beta chain; Region: SDH_beta; pfam03315
529507003351	Serine dehydratase alpha chain; Region: SDH_alpha; pfam03313
529507003352	HMMPfam hit to PF03313, Serine dehydratase alpha chain, score 6e-193
529507003353	HMMPfam hit to PF03315, Serine dehydratase beta chain, score 1.1e-95
529507003354	Amino acid permeases [Amino acid transport and metabolism]; Region: SdaC; COG0814
529507003355	serine transporter; Region: stp; TIGR00814
529507003356	11 probable transmembrane helices predicted for PMI0672 by TMHMM2.0 at aa 27-44, 48-70, 101-123, 138-160, 172-194, 214-236, 257-279, 305-327, 356-378, 382-399 and 411-433
529507003357	Membrane-associated phospholipid phosphatase [Lipid metabolism]; Region: PgpB; COG0671
529507003358	PAP2_like proteins, BcrC_like subfamily. Several members of this family have been annotated as bacitracin transport permeases, as it was suspected that they form the permease component of an ABC transporter system. It was shown, however, that BcrC from...; Region: PAP2_BcrC_like; cd03385
529507003359	active site
529507003360	HMMPfam hit to PF01569, PAP2 superfamily, score 1.7e-23
529507003361	5 probable transmembrane helices predicted for PMI0673 by TMHMM2.0 at aa 26-48, 60-82, 102-124, 129-146 and 151-173
529507003362	Uncharacterized protein family UPF0047; Region: UPF0047; pfam01894
529507003363	HMMPfam hit to PF01894, Uncharacterised protein family UPF0047, score 1.4e-46
529507003364	Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain. GRX is a glutathione (GSH) dependent reductase, catalyzing the disulfide reduction of target proteins such as ribonucleotide...; Region: GRX_family; cd02066
529507003365	GSH binding site [chemical binding]; other site
529507003366	catalytic residues [active]
529507003367	HMMPfam hit to PF00462, Glutaredoxin, score 4.5e-28
529507003368	Predicted helix-turn-helix motif with score 1188.000, SD 3.23 at aa 43-64, sequence ITKADLSKTVGKPVETVPQIFI
529507003369	PS00195 Glutaredoxin active site.
529507003370	hypothetical protein; Provisional; Region: PRK10591
529507003371	HMMPfam hit to PF07214, Protein of unknown function (DUF1418), score 5.5e-12
529507003372	2 probable transmembrane helices predicted for PMI0676 by TMHMM2.0 at aa 24-46 and 56-78
529507003373	Putative bacterial sensory transduction regulator; Region: YbjN; pfam10722
529507003374	23S rRNA methyluridine methyltransferase; Reviewed; Region: rumB; PRK03522
529507003375	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
529507003376	S-adenosylmethionine binding site [chemical binding]; other site
529507003377	HMMPfam hit to PF05958, tRNA (Uracil-5-)-methyltransferase, score 2.5e-06
529507003378	PS01230 RNA methyltransferase trmA family signature 1.
529507003379	PS01231 RNA methyltransferase trmA family signature 2.
529507003380	ABC-type arginine transport system, permease component [Amino acid transport and metabolism]; Region: ArtQ; COG4215
529507003381	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
529507003382	dimer interface [polypeptide binding]; other site
529507003383	conserved gate region; other site
529507003384	putative PBP binding loops; other site
529507003385	ABC-ATPase subunit interface; other site
529507003386	HMMPfam hit to PF00528, Binding-protein-dependent transport syst, score 8.5e-16
529507003387	5 probable transmembrane helices predicted for PMI0679 by TMHMM2.0 at aa 15-37, 50-72, 87-109, 155-174 and 189-211
529507003388	ABC-type arginine transport system, permease component [Amino acid transport and metabolism]; Region: ArtQ; COG4215
529507003389	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
529507003390	dimer interface [polypeptide binding]; other site
529507003391	conserved gate region; other site
529507003392	putative PBP binding loops; other site
529507003393	ABC-ATPase subunit interface; other site
529507003394	HMMPfam hit to PF00528, Binding-protein-dependent transport syst, score 3.1e-09
529507003395	4 probable transmembrane helices predicted for PMI0680 by TMHMM2.0 at aa 10-32, 53-75, 95-114 and 197-219
529507003396	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
529507003397	Signal peptide predicted for PMI0680 by SignalP 2.0 HMM (Signal peptide probability 0.955) with cleavage site probability 0.859 between residues 29 and 30
529507003398	putative ABC transporter arginine-biding protein; Provisional; Region: PRK15007
529507003399	Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of  substrates, such as, amino acids, peptides, sugars, vitamins and inorganic...; Region: PBPb; cd00134
529507003400	substrate binding pocket [chemical binding]; other site
529507003401	membrane-bound complex binding site; other site
529507003402	hinge residues; other site
529507003403	HMMPfam hit to PF00497, Bacterial extracellular solute-binding prot, score 1.1e-95
529507003404	PS01039 Bacterial extracellular solute-binding proteins, family 3 signature.
529507003405	Signal peptide predicted for PMI0681 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.993 between residues 19 and 20
529507003406	arginine transporter ATP-binding subunit; Provisional; Region: artP; PRK11124
529507003407	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
529507003408	Walker A/P-loop; other site
529507003409	ATP binding site [chemical binding]; other site
529507003410	Q-loop/lid; other site
529507003411	ABC transporter signature motif; other site
529507003412	Walker B; other site
529507003413	D-loop; other site
529507003414	H-loop/switch region; other site
529507003415	HMMPfam hit to PF00005, ABC transporter, score 4.9e-65
529507003416	PS00211 ABC transporters family signature.
529507003417	PS00017 ATP/GTP-binding site motif A (P-loop).
529507003418	Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]; Region: COG0702
529507003419	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
529507003420	NAD(P) binding site [chemical binding]; other site
529507003421	active site
529507003422	Protein of unknown function (DUF2867); Region: DUF2867; pfam11066
529507003423	1 probable transmembrane helix predicted for PMI0683 by TMHMM2.0 at aa 439-461
529507003424	Predicted membrane protein [Function unknown]; Region: COG2431
529507003425	HMMPfam hit to PF03956, Membrane protein of unknown function (DUF340, score 5.7e-72
529507003426	8 probable transmembrane helices predicted for PMI0684 by TMHMM2.0 at aa 5-22, 29-51, 61-83, 112-134, 139-156, 169-191, 206-228 and 273-295
529507003427	Predicted ATP-dependent endonuclease of the OLD family [DNA replication, recombination, and repair]; Region: COG3593
529507003428	Protein of unknown function (DUF2813); Region: DUF2813; pfam11398
529507003429	TOPRIM_OLD: topoisomerase-primase (TOPRIM) nucleotidyl transferase/hydrolase domain of the type found in bacterial and archaeal nucleases of the OLD (overcome lysogenization defect) family.  The bacteriophage P2 OLD protein, which has DNase as well as...; Region: TOPRIM_OLD; cd01026
529507003430	putative active site [active]
529507003431	putative metal-binding site [ion binding]; other site
529507003432	PS00017 ATP/GTP-binding site motif A (P-loop).
529507003433	macrolide transporter subunit MacA; Provisional; Region: PRK11578
529507003434	Biotin-lipoyl like; Region: Biotin_lipoyl_2; pfam13533
529507003435	HlyD family secretion protein; Region: HlyD_3; pfam13437
529507003436	1 probable transmembrane helix predicted for PMI0686 by TMHMM2.0 at aa 12-29
529507003437	HMMPfam hit to PF00529, HlyD family secretion protein, score 4.3e-07
529507003438	Predicted helix-turn-helix motif with score 1050.000, SD 2.76 at aa 309-330, sequence VPLSALGENVGINEYQVEVLVN
529507003439	macrolide transporter ATP-binding /permease protein; Provisional; Region: PRK10535
529507003440	ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein; Region: ABC_MJ0796_LolCDE_FtsE; cd03255
529507003441	Walker A/P-loop; other site
529507003442	ATP binding site [chemical binding]; other site
529507003443	Q-loop/lid; other site
529507003444	ABC transporter signature motif; other site
529507003445	Walker B; other site
529507003446	D-loop; other site
529507003447	H-loop/switch region; other site
529507003448	MacB-like periplasmic core domain; Region: MacB_PCD; pfam12704
529507003449	FtsX-like permease family; Region: FtsX; pfam02687
529507003450	HMMPfam hit to PF00005, ABC transporter, score 4e-65
529507003451	PS00017 ATP/GTP-binding site motif A (P-loop).
529507003452	PS00211 ABC transporters family signature.
529507003453	4 probable transmembrane helices predicted for PMI0687 by TMHMM2.0 at aa 269-291, 526-548, 571-593 and 608-630
529507003454	HMMPfam hit to PF02687, Predicted permease, score 1.4e-51
529507003455	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507003456	Cold-Shock Protein (CSP) contains an S1-like cold-shock domain (CSD) that is found in eukaryotes, prokaryotes, and archaea.  CSP's include the major cold-shock proteins CspA and CspB in bacteria and the eukaryotic gene regulatory factor Y-box...; Region: CSP_CDS; cd04458
529507003457	DNA-binding site [nucleotide binding]; DNA binding site
529507003458	RNA-binding motif; other site
529507003459	HMMPfam hit to PF00313, 'Cold-shock' DNA-binding domain, score 3.8e-35
529507003460	PS00352 'Cold-shock' DNA-binding domain signature.
529507003461	Uncharacterized conserved protein [Function unknown]; Region: COG2127
529507003462	HMMPfam hit to PF02617, ATP-dependent Clp protease adaptor protein C, score 2.5e-49
529507003463	ATP-dependent Clp protease ATP-binding subunit; Provisional; Region: clpA; PRK11034
529507003464	Clp amino terminal domain; Region: Clp_N; pfam02861
529507003465	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
529507003466	Walker A motif; other site
529507003467	ATP binding site [chemical binding]; other site
529507003468	Walker B motif; other site
529507003469	arginine finger; other site
529507003470	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
529507003471	Walker A motif; other site
529507003472	ATP binding site [chemical binding]; other site
529507003473	Walker B motif; other site
529507003474	C-terminal, D2-small domain, of ClpB protein; Region: ClpB_D2-small; pfam10431
529507003475	HMMPfam hit to PF02861, Clp amino terminal domain, score 1e-14
529507003476	HMMPfam hit to PF00004, ATPase family associated with various cellul, score 2.3e-18
529507003477	PS00017 ATP/GTP-binding site motif A (P-loop).
529507003478	PS00870 Chaperonins clpA/B signature 1.
529507003479	HMMPfam hit to PF07724, ATPase family associated with various cellul, score 1.3e-91
529507003480	PS00017 ATP/GTP-binding site motif A (P-loop).
529507003481	PS00871 Chaperonins clpA/B signature 2.
529507003482	S1_IF1: Translation Initiation Factor IF1, S1-like RNA-binding domain. IF1 contains an S1-like RNA-binding domain, which is found in a wide variety of RNA-associated proteins. Translation initiation includes a number of interrelated steps preceding the...; Region: S1_IF1; cd04451
529507003483	rRNA binding site [nucleotide binding]; other site
529507003484	predicted 30S ribosome binding site; other site
529507003485	HMMPfam hit to PF00575, S1 RNA binding domain, score 6.6e-11
529507003486	leucyl/phenylalanyl-tRNA--protein transferase; Reviewed; Region: aat; PRK00301
529507003487	HMMPfam hit to PF03588, Leucyl/phenylalanyl-tRNA protein transf, score 7.2e-87
529507003488	cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed; Region: PRK11160
529507003489	ABC transporter transmembrane region; Region: ABC_membrane; pfam00664
529507003490	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
529507003491	Walker A/P-loop; other site
529507003492	ATP binding site [chemical binding]; other site
529507003493	Q-loop/lid; other site
529507003494	ABC transporter signature motif; other site
529507003495	Walker B; other site
529507003496	D-loop; other site
529507003497	H-loop/switch region; other site
529507003498	HMMPfam hit to PF00005, ABC transporter, score 1e-55
529507003499	PS00211 ABC transporters family signature.
529507003500	PS00017 ATP/GTP-binding site motif A (P-loop).
529507003501	6 probable transmembrane helices predicted for PMI0693 by TMHMM2.0 at aa 16-38, 48-70, 133-155, 165-184, 242-264 and 279-301
529507003502	HMMPfam hit to PF00664, ABC transporter transmembrane region, score 0.00049
529507003503	Signal peptide predicted for PMI0693 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.492 between residues 49 and 50
529507003504	cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed; Region: PRK11174
529507003505	ABC transporter transmembrane region; Region: ABC_membrane; pfam00664
529507003506	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
529507003507	Walker A/P-loop; other site
529507003508	ATP binding site [chemical binding]; other site
529507003509	Q-loop/lid; other site
529507003510	ABC transporter signature motif; other site
529507003511	Walker B; other site
529507003512	D-loop; other site
529507003513	H-loop/switch region; other site
529507003514	This hit extended beyond the end of the feature by 1 aa and was clipped.; PS00014 Endoplasmic reticulum targeting sequence.
529507003515	HMMPfam hit to PF00005, ABC transporter, score 1.4e-57
529507003516	PS00211 ABC transporters family signature.
529507003517	PS00017 ATP/GTP-binding site motif A (P-loop).
529507003518	6 probable transmembrane helices predicted for PMI0694 by TMHMM2.0 at aa 42-64, 74-93, 148-170, 174-196, 256-278 and 293-315
529507003519	HMMPfam hit to PF00664, ABC transporter transmembrane region, score 1.1e-29
529507003520	thioredoxin reductase; Provisional; Region: PRK10262
529507003521	NAD(P)-binding Rossmann-like domain; Region: NAD_binding_8; cl17500
529507003522	Pyridine nucleotide-disulphide oxidoreductase; Region: Pyr_redox; pfam00070
529507003523	HMMPfam hit to PF00070, Pyridine nucleotide-disulphide oxidoreducta, score 4.6e-79
529507003524	PS00573 Pyridine nucleotide-disulphide oxidoreductases class-II active site.
529507003525	Signal peptide predicted for PMI0695 by SignalP 2.0 HMM (Signal peptide probability 0.992) with cleavage site probability 0.942 between residues 25 and 26
529507003526	leucine-responsive transcriptional regulator; Provisional; Region: PRK11169
529507003527	Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to...; Region: HTH_ARSR; cd00090
529507003528	putative DNA binding site [nucleotide binding]; other site
529507003529	putative Zn2+ binding site [ion binding]; other site
529507003530	AsnC family; Region: AsnC_trans_reg; pfam01037
529507003531	PS00519 Bacterial regulatory proteins, asnC family signature.
529507003532	HMMPfam hit to PF01037, AsnC family, score 4.5e-55
529507003533	Domain of unknown function (DUF4117); Region: DUF4117; pfam13491
529507003534	FtsK/SpoIIIE family; Region: FtsK_SpoIIIE; pfam01580
529507003535	Ftsk gamma domain; Region: Ftsk_gamma; pfam09397
529507003536	5 probable transmembrane helices predicted for PMI0697 by TMHMM2.0 at aa 29-51, 83-105, 118-140, 160-182 and 187-209
529507003537	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507003538	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507003539	HMMPfam hit to PF01580, FtsK/SpoIIIE family, score 1.1e-99
529507003540	PS00017 ATP/GTP-binding site motif A (P-loop).
529507003541	Outer membrane lipoprotein carrier protein LolA; Region: LolA; cl17548
529507003542	lipoprotein chaperone; Reviewed; Region: lolA; PRK00031
529507003543	Signal peptide predicted for PMI0698 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.972 between residues 21 and 22
529507003544	HMMPfam hit to PF03548, Outer membrane lipoprotein carrier protein L, score 2.9e-88
529507003545	recombination factor protein RarA; Reviewed; Region: PRK13342
529507003546	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
529507003547	Walker A motif; other site
529507003548	ATP binding site [chemical binding]; other site
529507003549	Walker B motif; other site
529507003550	arginine finger; other site
529507003551	MgsA AAA+ ATPase C terminal; Region: MgsA_C; pfam12002
529507003552	HMMPfam hit to PF00004, ATPase family associated with various cellul, score 2.7e-18
529507003553	PS00017 ATP/GTP-binding site motif A (P-loop).
529507003554	seryl-tRNA synthetase; Provisional; Region: PRK05431
529507003555	Seryl-tRNA synthetase N-terminal domain; Region: Seryl_tRNA_N; pfam02403
529507003556	Seryl-tRNA synthetase (SerRS) class II core catalytic domain. SerRS is responsible for the attachment of serine to the 3' OH group of ribose of the appropriate tRNA. This domain It is primarily responsible for ATP-dependent formation of the enzyme...; Region: SerRS_core; cd00770
529507003557	dimer interface [polypeptide binding]; other site
529507003558	active site
529507003559	motif 1; other site
529507003560	motif 2; other site
529507003561	motif 3; other site
529507003562	HMMPfam hit to PF02403, Seryl-tRNA synthetase N-terminal domain, score 2.6e-44
529507003563	HMMPfam hit to PF00587, tRNA synthetase class II core domain (G,, score 1.4e-59
529507003564	PS00179 Aminoacyl-transfer RNA synthetases class-II signature 1.
529507003565	ureidoglycolate dehydrogenase; Provisional; Region: PRK15025
529507003566	HMMPfam hit to PF02615, Malate/L-lactate dehydrogenase, score 7.6e-180
529507003567	PS00225 Crystallins beta and gamma 'Greek key' motif signature.
529507003568	6 probable transmembrane helices predicted for PMI0703 by TMHMM2.0 at aa 43-65, 69-91, 120-142, 174-196, 216-235 and 239-261
529507003569	pyruvate formate lyase-activating enzyme 1; Provisional; Region: pflA; PRK11145
529507003570	Radical SAM superfamily. Enzymes of this family generate radicals by combining a 4Fe-4S cluster and S-adenosylmethionine (SAM) in close proximity. They are characterized by a conserved CxxxCxxC motif, which coordinates the conserved iron-sulfur cluster; Region: Radical_SAM; cd01335
529507003571	FeS/SAM binding site; other site
529507003572	HMMPfam hit to PF04055, Radical SAM superfamily, score 2.6e-28
529507003573	PS01087 Radical activating enzymes signature.
529507003574	PS00190 Cytochrome c family heme-binding site signature.
529507003575	formate acetyltransferase 1; Region: pyr_form_ly_1; TIGR01255
529507003576	Pyruvate formate lyase 1; Region: PFL1; cd01678
529507003577	coenzyme A binding site [chemical binding]; other site
529507003578	active site
529507003579	catalytic residues [active]
529507003580	glycine loop; other site
529507003581	HMMPfam hit to PF01228, Glycine radical, score 5.4e-67
529507003582	PS00850 Glycine radical signature.
529507003583	HMMPfam hit to PF02901, Pyruvate formate lyase, score 0
529507003584	Formate/nitrite transporter; Region: Form_Nir_trans; cl00927
529507003585	HMMPfam hit to PF01226, Formate/nitrite transporter, score 3.4e-148
529507003586	6 probable transmembrane helices predicted for PMI0706 by TMHMM2.0 at aa 34-56, 76-98, 119-141, 161-183, 195-217 and 255-277
529507003587	PS01006 Formate and nitrite transporters signature 2.
529507003588	PS01005 Formate and nitrite transporters signature 1.
529507003589	uncharacterized domain; Region: TIGR00702
529507003590	YcaO-like family; Region: YcaO; pfam02624
529507003591	HMMPfam hit to PF02624, YcaO-like family, score 3.9e-149
529507003592	L-asparaginase II; Provisional; Region: ansB; PRK11096
529507003593	active site
529507003594	homodimer interface [polypeptide binding]; other site
529507003595	Signal peptide predicted for PMI0708 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.998 between residues 20 and 21
529507003596	1 probable transmembrane helix predicted for PMI0708 by TMHMM2.0 at aa 7-29
529507003597	PS00144 Asparaginase / glutaminase active site signature 1.
529507003598	HMMPfam hit to PF00710, Asparaginase, score 9e-147
529507003599	PS00917 Asparaginase / glutaminase active site signature 2.
529507003600	haemagglutination activity domain; Region: Haemagg_act; pfam05860
529507003601	HMMPfam hit to PF05860, haemagglutination activity domain, score 1.1e-22
529507003602	Signal peptide predicted for PMI0709 by SignalP 2.0 HMM (Signal peptide probability 0.846) with cleavage site probability 0.833 between residues 20 and 21
529507003603	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507003604	Major Facilitator Superfamily; Region: MFS_1; pfam07690
529507003605	putative substrate translocation pore; other site
529507003606	14 probable transmembrane helices predicted for PMI0710 by TMHMM2.0 at aa 25-47, 62-84, 91-113, 118-140, 147-169, 179-198, 211-233, 237-256, 268-290, 300-322, 343-365, 370-392, 413-435 and 450-472
529507003607	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 5.2e-35
529507003608	Phosphoserine aminotransferase (PSAT) family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major group in this CD corresponds to phosphoserine aminotransferase (PSAT).  PSAT is active as...; Region: PSAT_like; cd00611
529507003609	homodimer interface [polypeptide binding]; other site
529507003610	substrate-cofactor binding pocket; other site
529507003611	pyridoxal 5'-phosphate binding site [chemical binding]; other site
529507003612	catalytic residue [active]
529507003613	HMMPfam hit to PF00266, Aminotransferase class-V, score 1e-97
529507003614	PS00595 Aminotransferases class-V pyridoxal-phosphate attachment site.
529507003615	1 probable transmembrane helix predicted for PMI0712 by TMHMM2.0 at aa 5-27
529507003616	3-phosphoshikimate 1-carboxyvinyltransferase; Provisional; Region: PRK02427
529507003617	EPSP synthase domain. 3-phosphoshikimate 1-carboxyvinyltransferase (5-enolpyruvylshikimate-3-phosphate synthase) (EC 2.5.1.19) catalyses the reaction between shikimate-3-phosphate (S3P) and phosphoenolpyruvate (PEP) to form...; Region: EPSP_synthase; cd01556
529507003618	hinge; other site
529507003619	active site
529507003620	HMMPfam hit to PF00275, EPSP synthase (3-phosphoshikimate 1-car, score 1.1e-215
529507003621	PS00017 ATP/GTP-binding site motif A (P-loop).
529507003622	PS00104 EPSP synthase signature 1.
529507003623	PS00885 EPSP synthase signature 2.
529507003624	cytidylate kinase; Provisional; Region: cmk; PRK00023
529507003625	Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor; Region: CMPK; cd02020
529507003626	CMP-binding site; other site
529507003627	The sites determining sugar specificity; other site
529507003628	HMMPfam hit to PF02224, Cytidylate kinase, score 1.5e-81
529507003629	30S ribosomal protein S1; Reviewed; Region: rpsA; PRK06299
529507003630	S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture...; Region: S1_RPS1_repeat_ec1_hs1; cd05687
529507003631	RNA binding site [nucleotide binding]; other site
529507003632	S1_RPS1_repeat_ec2_hs2: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture...; Region: S1_RPS1_repeat_ec2_hs2; cd04465
529507003633	RNA binding site [nucleotide binding]; other site
529507003634	S1_RPS1_repeat_ec3: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists...; Region: S1_RPS1_repeat_ec3; cd05688
529507003635	RNA binding site [nucleotide binding]; other site
529507003636	S1_RPS1_repeat_ec4: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists...; Region: S1_RPS1_repeat_ec4; cd05689
529507003637	RNA binding site [nucleotide binding]; other site
529507003638	S1_like: Ribosomal protein S1-like RNA-binding domain. Found in a wide variety of RNA-associated proteins. Originally identified in S1 ribosomal protein. This superfamily also contains the Cold Shock Domain (CSD), which is a homolog of the S1 domain; Region: S1_like; cl09927
529507003639	RNA binding site [nucleotide binding]; other site
529507003640	S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists...; Region: S1_RPS1_repeat_ec6; cd05691
529507003641	RNA binding site [nucleotide binding]; other site
529507003642	HMMPfam hit to PF00575, S1 RNA binding domain, score 7.1e-13
529507003643	HMMPfam hit to PF00575, S1 RNA binding domain, score 3.4e-17
529507003644	HMMPfam hit to PF00575, S1 RNA binding domain, score 7.1e-32
529507003645	HMMPfam hit to PF00575, S1 RNA binding domain, score 4e-30
529507003646	HMMPfam hit to PF00575, S1 RNA binding domain, score 4e-25
529507003647	HMMPfam hit to PF00575, S1 RNA binding domain, score 2.1e-21
529507003648	Integration host factor (IHF) and HU are small heterodimeric members of the DNABII protein family that bind and bend DNA, functioning as architectural factors in many cellular processes including transcription, site-specific recombination, and...; Region: HU_IHF; cd00591
529507003649	IHF dimer interface [polypeptide binding]; other site
529507003650	IHF - DNA interface [nucleotide binding]; other site
529507003651	HMMPfam hit to PF00216, Bacterial DNA-binding protein, score 2e-47
529507003652	PS00045 Bacterial histone-like DNA-binding proteins signature.
529507003653	ComEC family competence protein; Provisional; Region: PRK11539
529507003654	Competence protein; Region: Competence; pfam03772
529507003655	Metallo-beta-lactamase superfamily; Region: Lactamase_B; pfam00753
529507003656	10 probable transmembrane helices predicted for PMI0717 by TMHMM2.0 at aa 36-55, 65-87, 257-279, 294-316, 321-343, 358-380, 393-415, 430-452, 469-491 and 506-528
529507003657	HMMPfam hit to PF03772, Competence protein, score 5e-41
529507003658	HMMPfam hit to PF00753, Metallo-beta-lactamase superfamily, score 3e-13
529507003659	lipid transporter ATP-binding/permease protein; Provisional; Region: PRK11176
529507003660	ABC transporter transmembrane region; Region: ABC_membrane; pfam00664
529507003661	ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C; Region: ABCC_MsbA; cd03251
529507003662	Walker A/P-loop; other site
529507003663	ATP binding site [chemical binding]; other site
529507003664	Q-loop/lid; other site
529507003665	ABC transporter signature motif; other site
529507003666	Walker B; other site
529507003667	D-loop; other site
529507003668	H-loop/switch region; other site
529507003669	HMMPfam hit to PF00664, ABC transporter transmembrane region, score 7.3e-64
529507003670	5 probable transmembrane helices predicted for PMI0718 by TMHMM2.0 at aa 28-50, 74-96, 142-164, 168-190 and 248-270
529507003671	HMMPfam hit to PF00005, ABC transporter, score 1.1e-65
529507003672	PS00017 ATP/GTP-binding site motif A (P-loop).
529507003673	PS00211 ABC transporters family signature.
529507003674	Tetraacyldisaccharide-1-P 4'-kinase [Cell envelope biogenesis, outer membrane]; Region: LpxK; COG1663
529507003675	tetraacyldisaccharide 4'-kinase; Reviewed; Region: lpxK; PRK00652
529507003676	1 probable transmembrane helix predicted for PMI0719 by TMHMM2.0 at aa 12-34
529507003677	HMMPfam hit to PF02606, Tetraacyldisaccharide-1-P 4'-kinase, score 7.6e-132
529507003678	Cold-Shock Protein (CSP) contains an S1-like cold-shock domain (CSD) that is found in eukaryotes, prokaryotes, and archaea.  CSP's include the major cold-shock proteins CspA and CspB in bacteria and the eukaryotic gene regulatory factor Y-box...; Region: CSP_CDS; cd04458
529507003679	DNA-binding site [nucleotide binding]; DNA binding site
529507003680	RNA-binding motif; other site
529507003681	HMMPfam hit to PF00313, 'Cold-shock' DNA-binding domain, score 1.3e-14
529507003682	Trm112p-like protein; Region: Trm112p; cl01066
529507003683	HMMPfam hit to PF03966, Protein of unknown function (DUF343), score 4.5e-18
529507003684	3-deoxy-manno-octulosonate cytidylyltransferase; Provisional; Region: PRK05450
529507003685	CMP-KDO synthetase catalyzes the activation of KDO which is an essential component of the lipopolysaccharide; Region: CMP-KDO-Synthetase; cd02517
529507003686	Ligand binding site; other site
529507003687	oligomer interface; other site
529507003688	HMMPfam hit to PF02348, Cytidylyltransferase, score 1e-83
529507003689	Uncharacterized conserved protein [Function unknown]; Region: COG1434
529507003690	YdcF-like. YdcF-like is a large family of mainly bacterial proteins, with a few members found in fungi, plants, and archaea. Escherichia coli YdcF has been shown to bind S-adenosyl-L-methionine (AdoMet), but a biochemical function has not been...; Region: YdcF-like; cd06259
529507003691	putative active site [active]
529507003692	HMMPfam hit to PF02698, DUF218 domain, score 2.7e-33
529507003693	3 probable transmembrane helices predicted for PMI0723 by TMHMM2.0 at aa 9-31, 41-63 and 70-92
529507003694	Methyltransferase domain; Region: Methyltransf_31; pfam13847
529507003695	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
529507003696	S-adenosylmethionine binding site [chemical binding]; other site
529507003697	condesin subunit F; Provisional; Region: PRK05260
529507003698	HMMPfam hit to PF03882, KicB killing factor, score 0
529507003699	PS00430 TonB-dependent receptor proteins signature 1.
529507003700	condesin subunit E; Provisional; Region: PRK05256
529507003701	HMMPfam hit to PF04288, MukE-like family, score 6e-137
529507003702	cell division protein MukB; Provisional; Region: mukB; PRK04863
529507003703	P-loop containing region of AAA domain; Region: AAA_29; cl17516
529507003704	Domain of unknown function (DUF4337); Region: DUF4337; pfam14235
529507003705	Putative exonuclease SbcCD, C subunit; Region: SbcCD_C; pfam13558
529507003706	HMMPfam hit to PF04310, MukB N-terminal, score 4.3e-170
529507003707	PS00017 ATP/GTP-binding site motif A (P-loop).
529507003708	Predicted helix-turn-helix motif with score 1177.000, SD 3.20 at aa 328-349, sequence TDYQAASDRLNLVQNAVRQQEK
529507003709	chloramphenicol acetyltransferase; Provisional; Region: PRK13757
529507003710	Chloramphenicol O-acetyltransferase [Defense mechanisms]; Region: COG4845
529507003711	HMMPfam hit to PF00302, Chloramphenicol acetyltransferase, score 6.5e-154
529507003712	PS00100 Chloramphenicol acetyltransferase active site.
529507003713	acid phosphatase/phosphotransferase; Provisional; Region: aphA; PRK11009
529507003714	HMMPfam hit to PF03767, HAD superfamily, subfamily IIIB (Acid, score 3.4e-38
529507003715	Signal peptide predicted for PMI0729 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.785 between residues 23 and 24
529507003716	murein L,D-transpeptidase; Provisional; Region: PRK10594
529507003717	Putative peptidoglycan binding domain; Region: PG_binding_1; pfam01471
529507003718	L,D-transpeptidase catalytic domain; Region: YkuD; pfam03734
529507003719	L,D-transpeptidase catalytic domain; Region: YkuD; pfam03734
529507003720	PS00092 N-6 Adenine-specific DNA methylases signature.
529507003721	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG3108
529507003722	Peptidase M15; Region: Peptidase_M15_3; cl01194
529507003723	Signal peptide predicted for PMI0731 by SignalP 2.0 HMM (Signal peptide probability 0.993) with cleavage site probability 0.923 between residues 30 and 31
529507003724	HMMPfam hit to PF05951, Bacterial protein of unknown function (DUF88, score 2.9e-93
529507003725	Zn-dependent hydrolases, including glyoxylases [General function prediction only]; Region: GloB; COG0491
529507003726	HMMPfam hit to PF00753, Metallo-beta-lactamase superfamily, score 1.2e-32
529507003727	type VI secretion system effector, Hcp1 family; Region: VI_effect_Hcp1; TIGR03344
529507003728	HMMPfam hit to PF05638, Protein of unknown function (DUF796), score 5.3e-63
529507003729	Type VI protein secretion system component VasA [Intracellular trafficking, secretion, and    vesicular transport]; Region: COG3519
529507003730	Bacterial protein of unknown function (DUF879); Region: DUF879; cl15462
529507003731	HMMPfam hit to PF05947, Bacterial protein of unknown function (DUF87, score 3.8e-09
529507003732	Predicted component of the type VI protein secretion system [Intracellular trafficking, secretion, and    vesicular transport]; Region: COG3515
529507003733	ImpA-related N-terminal; Region: ImpA-rel_N; pfam06812
529507003734	ImpA domain protein; Region: DUF3702; pfam12486
529507003735	1 probable transmembrane helix predicted for PMI0735 by TMHMM2.0 at aa 235-257
529507003736	HMMPfam hit to PF06812, ImpA-related N-terminal, score 2.3e-21
529507003737	Type VI protein secretion system component VasK [Intracellular trafficking, secretion, and    vesicular transport]; Region: IcmF; COG3523
529507003738	Intracellular multiplication and human macrophage-killing; Region: IcmF-related; pfam06761
529507003739	Protein of unknown function (DUF1215); Region: DUF1215; pfam06744
529507003740	HMMPfam hit to PF06744, Protein of unknown function (DUF1215), score 3e-52
529507003741	HMMPfam hit to PF06761, ImcF-related, score 9.4e-99
529507003742	3 probable transmembrane helices predicted for PMI0736 by TMHMM2.0 at aa 26-48, 63-85 and 459-481
529507003743	Signal peptide predicted for PMI0736 by SignalP 2.0 HMM (Signal peptide probability 0.976) with cleavage site probability 0.396 between residues 53 and 54
529507003744	ImpA-related N-terminal; Region: ImpA-rel_N; pfam06812
529507003745	type VI secretion-associated protein, VC_A0119 family; Region: VI_chp_7; TIGR03362
529507003746	HMMPfam hit to PF06812, ImpA-related N-terminal, score 6.6e-12
529507003747	Protein of unknown function (DUF3121); Region: DUF3121; pfam11319
529507003748	Signal peptide predicted for PMI0738 by SignalP 2.0 HMM (Signal peptide probability 0.992) with cleavage site probability 0.957 between residues 22 and 23
529507003749	Bacterial regulatory protein, Fis family; Region: HTH_8; cl17420
529507003750	type VI secretion ATPase, ClpV1 family; Region: VI_ClpV1; TIGR03345
529507003751	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
529507003752	Walker A motif; other site
529507003753	ATP binding site [chemical binding]; other site
529507003754	Walker B motif; other site
529507003755	arginine finger; other site
529507003756	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
529507003757	Walker A motif; other site
529507003758	ATP binding site [chemical binding]; other site
529507003759	Walker B motif; other site
529507003760	C-terminal, D2-small domain, of ClpB protein; Region: ClpB_D2-small; smart01086
529507003761	HMMPfam hit to PF07724, ATPase family associated with various cellul, score 7.4e-79
529507003762	PS00017 ATP/GTP-binding site motif A (P-loop).
529507003763	HMMPfam hit to PF00004, ATPase family associated with various cellul, score 1.4e-05
529507003764	PS00017 ATP/GTP-binding site motif A (P-loop).
529507003765	Type VI protein secretion system component VasF [Intracellular    trafficking, secretion, and vesicular transport]; Region: COG3455
529507003766	1 probable transmembrane helix predicted for PMI0741 by TMHMM2.0 at aa 215-237
529507003767	Predicted component of the type VI protein secretion system [Intracellular trafficking, secretion, and    vesicular transport]; Region: COG3522
529507003768	Bacterial protein of unknown function (DUF876); Region: DUF876; pfam05936
529507003769	HMMPfam hit to PF05936, Bacterial protein of unknown function (DUF87, score 4.5e-206
529507003770	Predicted component of the type VI protein secretion system [Intracellular trafficking, secretion, and    vesicular transport]; Region: COG3521
529507003771	Signal peptide predicted for PMI0743 by SignalP 2.0 HMM (Signal peptide probability 0.986) with cleavage site probability 0.555 between residues 27 and 28
529507003772	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507003773	type VI secretion system FHA domain protein; Region: VI_FHA; TIGR03354
529507003774	FHA domain; Region: FHA; pfam00498
529507003775	HMMPfam hit to PF00498, FHA domain, score 4.6e-05
529507003776	Predicted component of the type VI protein secretion system [Intracellular trafficking, secretion, and    vesicular transport]; Region: COG3520
529507003777	HMMPfam hit to PF06996, Protein of unknown function (DUF1305), score 1.4e-101
529507003778	Bacterial protein of unknown function (DUF879); Region: DUF879; pfam05947
529507003779	Type VI protein secretion system component VasA [Intracellular trafficking, secretion, and    vesicular transport]; Region: COG3519
529507003780	HMMPfam hit to PF05947, Bacterial protein of unknown function (DUF87, score 3.7e-114
529507003781	PS00017 ATP/GTP-binding site motif A (P-loop).
529507003782	type VI secretion system lysozyme-like protein; Region: VI_zyme; TIGR03357
529507003783	HMMPfam hit to PF07025, Protein of unknown function (DUF1316), score 5.3e-30
529507003784	Predicted component of the type VI protein secretion system [Intracellular trafficking, secretion, and    vesicular transport]; Region: COG3517
529507003785	Protein of unknown function (DUF877); Region: DUF877; pfam05943
529507003786	HMMPfam hit to PF05943, Protein of unknown function (DUF877), score 1.6e-303
529507003787	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507003788	Protein of unknown function (DUF770); Region: DUF770; pfam05591
529507003789	HMMPfam hit to PF05591, Protein of unknown function (DUF770), score 1.1e-82
529507003790	type VI secretion system effector, Hcp1 family; Region: VI_effect_Hcp1; TIGR03344
529507003791	HMMPfam hit to PF05638, Protein of unknown function (DUF796), score 2.3e-87
529507003792	type VI secretion system Vgr family protein; Region: VI_Rhs_Vgr; TIGR03361
529507003793	Phage late control gene D protein (GPD); Region: Phage_GPD; pfam05954
529507003794	Phage-related baseplate assembly protein; Region: Phage_base_V; pfam04717
529507003795	HMMPfam hit to PF04524, Protein of unknown function, DUF586, score 1.2e-39
529507003796	Uncharacterized protein conserved in bacteria (DUF2169); Region: DUF2169; pfam09937
529507003797	3-oxoacyl-(acyl carrier protein) synthase; Validated; Region: PRK06147
529507003798	Signal peptide predicted for PMI0754 by SignalP 2.0 HMM (Signal peptide probability 0.964) with cleavage site probability 0.422 between residues 20 and 21
529507003799	Domain of unknown function (DUF4150); Region: DUF4150; pfam13665
529507003800	Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold; Region: Thioredoxin_like; cl00388
529507003801	Transposase IS200 like; Region: Y1_Tnp; pfam01797
529507003802	HMMPfam hit to PF01797, Transposase IS200 like, score 2e-42
529507003803	Helix-turn-helix domain; Region: HTH_OrfB_IS605; pfam12323
529507003804	Transposase and inactivated derivatives [DNA replication, recombination, and repair]; Region: COG0675
529507003805	Probable transposase; Region: OrfB_IS605; pfam01385
529507003806	transposase, IS605 OrfB family, central region; Region: tspaseT_teng_C; TIGR01766
529507003807	HMMPfam hit to PF01385, Probable transposase, score 2.7e-131
529507003808	Rhs family protein [Cell envelope biogenesis, outer membrane]; Region: RhsA; COG3209
529507003809	RHS Repeat; Region: RHS_repeat; pfam05593
529507003810	RHS Repeat; Region: RHS_repeat; pfam05593
529507003811	RHS Repeat; Region: RHS_repeat; cl11982
529507003812	RHS Repeat; Region: RHS_repeat; cl11982
529507003813	HMMPfam hit to PF05593, RHS Repeat, score 0.0036
529507003814	HMMPfam hit to PF05593, RHS Repeat, score 0.014
529507003815	HMMPfam hit to PF05593, RHS Repeat, score 0.00085
529507003816	HMMPfam hit to PF05593, RHS Repeat, score 0.12
529507003817	HMMPfam hit to PF05593, RHS Repeat, score 1.5e-05
529507003818	HMMPfam hit to PF05593, RHS Repeat, score 7.5e-06
529507003819	HMMPfam hit to PF05593, RHS Repeat, score 0.00047
529507003820	HMMPfam hit to PF05593, RHS Repeat, score 0.0001
529507003821	HMMPfam hit to PF05593, RHS Repeat, score 5.4
529507003822	HMMPfam hit to PF05593, RHS Repeat, score 9.5
529507003823	HMMPfam hit to PF05593, RHS Repeat, score 0.13
529507003824	HMMPfam hit to PF05593, RHS Repeat, score 1.2
529507003825	conserved hypothetical protein (fragment);This CDS appears to be truncated at N-terminus relative to database matches.
529507003826	aromatic amino acid aminotransferase; Provisional; Region: PRK09257
529507003827	Aspartate aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). Pyridoxal phosphate combines with an alpha-amino acid to form a compound called a Schiff base or aldimine...; Region: AAT_like; cd00609
529507003828	pyridoxal 5'-phosphate binding site [chemical binding]; other site
529507003829	homodimer interface [polypeptide binding]; other site
529507003830	catalytic residue [active]
529507003831	HMMPfam hit to PF00155, Aminotransferase class I and II, score 5.7e-108
529507003832	PS00105 Aminotransferases class-I pyridoxal-phosphate attachment site.
529507003833	Outer membrane protein (porin) [Cell envelope biogenesis, outer membrane]; Region: OmpC; COG3203
529507003834	Porins form aqueous channels for the diffusion of small hydrophillic molecules across the outer membrane. Individual 16-strand anti-parallel beta-barrels form a central pore, and trimerizes thru mainly hydrophobic interactions at the interface. Trimers...; Region: gram_neg_porins; cd00342
529507003835	trimer interface [polypeptide binding]; other site
529507003836	eyelet of channel; other site
529507003837	HMMPfam hit to PF00267, Gram-negative porin, score 2.9e-169
529507003838	Signal peptide predicted for PMI0765 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.999 between residues 22 and 23
529507003839	asparaginyl-tRNA synthetase; Validated; Region: asnC; PRK03932
529507003840	EcAsnRS_like_N: N-terminal, anticodon recognition domain of the type found in Escherichia coli asparaginyl-tRNA synthetase (AsnRS) and, in Arabidopsis thaliana and Saccharomyces cerevisiae mitochondrial (mt) AsnRS. This domain is a beta-barrel domain (OB...; Region: EcAsnRS_like_N; cd04318
529507003841	putative dimer interface [polypeptide binding]; other site
529507003842	putative anticodon binding site; other site
529507003843	Asx tRNA synthetase (AspRS/AsnRS) class II core domain.  Assignment to class II aminoacyl-tRNA synthetases (aaRS) based upon its structure and the presence of three characteristic sequence motifs in the core domain. This family includes AsnRS as well as...; Region: AsxRS_core; cd00776
529507003844	homodimer interface [polypeptide binding]; other site
529507003845	motif 1; other site
529507003846	motif 2; other site
529507003847	active site
529507003848	motif 3; other site
529507003849	HMMPfam hit to PF00152, tRNA synthetases class II (D, K and N), score 5.2e-164
529507003850	PS00339 Aminoacyl-transfer RNA synthetases class-II signature 2.
529507003851	PS00179 Aminoacyl-transfer RNA synthetases class-II signature 1.
529507003852	HMMPfam hit to PF01336, OB-fold nucleic acid binding domain, score 1.3e-20
529507003853	nicotinate phosphoribosyltransferase; Region: NAPRTase; TIGR01514
529507003854	Nicotinate phosphoribosyltransferase (NAPRTase), related to PncB. Nicotinate phosphoribosyltransferase catalyses the formation of NAMN and PPi from 5-phosphoribosy -1-pyrophosphate (PRPP) and nicotinic acid, this is the first, and also rate limiting; Region: PncB_like; cd01401
529507003855	active site
529507003856	HMMPfam hit to PF04095, Nicotinate phosphoribosyltransferase (NAPRTa, score 1.1e-179
529507003857	aminopeptidase N; Provisional; Region: pepN; PRK14015
529507003858	Peptidase M1 family containing Aminopeptidase N; Region: M1_APN_1; cd09600
529507003859	active site
529507003860	Zn binding site [ion binding]; other site
529507003861	HMMPfam hit to PF01433, Peptidase family M1, score 4.7e-69
529507003862	PS00142 Neutral zinc metallopeptidases, zinc-binding region signature.
529507003863	Protein of unknown function (DUF1016); Region: DUF1016; pfam06250
529507003864	Predicted nuclease of restriction endonuclease-like fold [General    function prediction only]; Region: COG4804
529507003865	HMMPfam hit to PF06250, Protein of unknown function (DUF1016), score 2.8e-141
529507003866	dihydroorotate dehydrogenase 2; Reviewed; Region: PRK05286
529507003867	Dihydroorotate dehydrogenase (DHOD) class 2. DHOD catalyzes the oxidation of (S)-dihydroorotate to orotate. This is the fourth step and the only redox reaction in the de novo biosynthesis of UMP, the precursor of all pyrimidine nucleotides. DHOD requires...; Region: DHOD_2_like; cd04738
529507003868	quinone interaction residues [chemical binding]; other site
529507003869	active site
529507003870	catalytic residues [active]
529507003871	FMN binding site [chemical binding]; other site
529507003872	substrate binding site [chemical binding]; other site
529507003873	HMMPfam hit to PF01180, Dihydroorotate dehydrogenase, score 2.2e-154
529507003874	PS00911 Dihydroorotate dehydrogenase signature 1.
529507003875	PS00912 Dihydroorotate dehydrogenase signature 2.
529507003876	Protein of unknown function (DUF1379); Region: DUF1379; pfam07126
529507003877	HMMPfam hit to PF07126, Protein of unknown function (DUF1379), score 6.5e-71
529507003878	Uncharacterized Fe-S protein [General function prediction only]; Region: COG3217
529507003879	MOSC N-terminal beta barrel domain; Region: MOSC_N; pfam03476
529507003880	MOSC domain; Region: MOSC; pfam03473
529507003881	Ferredoxin [Energy production and conversion]; Region: Fdx; COG0633
529507003882	2Fe-2S iron-sulfur cluster binding domain. Iron-sulfur proteins play an important role in electron transfer processes and in various enzymatic reactions. The family includes plant and algal ferredoxins, which act as electron carriers in photosynthesis...; Region: fer2; cd00207
529507003883	catalytic loop [active]
529507003884	iron binding site [ion binding]; other site
529507003885	HMMPfam hit to PF00111, 2Fe-2S iron-sulfur cluster binding domain, score 4.2e-16
529507003886	PS00197 2Fe-2S ferredoxins, iron-sulfur binding region signature.
529507003887	HMMPfam hit to PF03473, MOSC domain, score 1.3e-41
529507003888	HMMPfam hit to PF03476, MOSC N-terminal beta barrel domain, score 2.5e-34
529507003889	23S rRNA m(2)G2445 methyltransferase; Provisional; Region: rlmL; PRK11783
529507003890	THUMP domain associated with S-adenosylmethionine-dependent methyltransferases; Region: THUMP_AdoMetMT; cd11715
529507003891	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cl17173
529507003892	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
529507003893	S-adenosylmethionine binding site [chemical binding]; other site
529507003894	HMMPfam hit to PF02926, THUMP domain, score 2e-13
529507003895	HMMPfam hit to PF01170, RNA methylase family UPF0020, score 7.5e-85
529507003896	PS01261 Uncharacterized protein family UPF0020 signature.
529507003897	PS00092 N-6 Adenine-specific DNA methylases signature.
529507003898	ABC transporter ATPase component; Reviewed; Region: PRK11147
529507003899	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
529507003900	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
529507003901	Walker A/P-loop; other site
529507003902	Walker A/P-loop; other site
529507003903	ATP binding site [chemical binding]; other site
529507003904	ATP binding site [chemical binding]; other site
529507003905	Q-loop/lid; other site
529507003906	Q-loop/lid; other site
529507003907	ATP-binding cassette domain of elongation factor 3, subfamily F; Region: ABCF_EF-3; cd03221
529507003908	ABC transporter signature motif; other site
529507003909	Walker B; other site
529507003910	D-loop; other site
529507003911	ABC transporter; Region: ABC_tran_2; pfam12848
529507003912	ATP-binding cassette domain of elongation factor 3, subfamily F; Region: ABCF_EF-3; cd03221
529507003913	HMMPfam hit to PF00005, ABC transporter, score 1.3e-42
529507003914	PS00017 ATP/GTP-binding site motif A (P-loop).
529507003915	PS00211 ABC transporters family signature.
529507003916	HMMPfam hit to PF00005, ABC transporter, score 1.2e-38
529507003917	PS00017 ATP/GTP-binding site motif A (P-loop).
529507003918	PS00211 ABC transporters family signature.
529507003919	paraquat-inducible membrane protein A; Provisional; Region: PRK15103
529507003920	Paraquat-inducible protein A; Region: PqiA; pfam04403
529507003921	Paraquat-inducible protein A; Region: PqiA; pfam04403
529507003922	HMMPfam hit to PF04403, Paraquat-inducible protein A, score 7.3e-64
529507003923	8 probable transmembrane helices predicted for PMI0776 by TMHMM2.0 at aa 62-81, 109-131, 148-170, 174-193, 264-286, 315-337, 360-382 and 387-409
529507003924	HMMPfam hit to PF04403, Paraquat-inducible protein A, score 2.2e-82
529507003925	paraquat-inducible protein B; Provisional; Region: PRK10807
529507003926	mce related protein; Region: MCE; pfam02470
529507003927	mce related protein; Region: MCE; pfam02470
529507003928	mce related protein; Region: MCE; pfam02470
529507003929	1 probable transmembrane helix predicted for PMI0777 by TMHMM2.0 at aa 20-42
529507003930	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG3009
529507003931	Protein of unknown function (DUF330); Region: DUF330; pfam03886
529507003932	Signal peptide predicted for PMI0778 by SignalP 2.0 HMM (Signal peptide probability 0.928) with cleavage site probability 0.827 between residues 22 and 23
529507003933	HMMPfam hit to PF03886, Protein of unknown function (DUF330), score 3.8e-40
529507003934	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507003935	conserved hypothetical protein (pseudogene);This CDS appears to have a frameshift mutation.
529507003936	Ribosome modulation factor; Region: RMF; pfam04957
529507003937	HMMPfam hit to PF04957, Ribosome modulation factor, score 7.1e-27
529507003938	FabA, beta-hydroxydecanoyl-acyl carrier protein (ACP)-dehydratase: Bacterial protein of the type II, fatty acid synthase system that binds ACP and catalyzes both dehydration and isomerization reactions, apparently in the same active site. The FabA...; Region: FabA; cd01287
529507003939	active site 1 [active]
529507003940	dimer interface [polypeptide binding]; other site
529507003941	active site 2 [active]
529507003942	Predicted ATP-dependent protease [Posttranslational modification, protein turnover, chaperones]; Region: LonB; COG1067
529507003943	Lon protease (S16) C-terminal proteolytic domain; Region: Lon_C; pfam05362
529507003944	Ter macrodomain organizer matS-binding protein; Provisional; Region: PRK05097
529507003945	HMMPfam hit to PF06303, Protein of unknown function (DUF1047), score 1.4e-102
529507003946	outer membrane protein A; Reviewed; Region: PRK10808
529507003947	OmpA-like transmembrane domain; Region: OmpA_membrane; pfam01389
529507003948	Peptidoglycan binding domains similar to the C-terminal domain of outer-membrane protein OmpA; Region: OmpA_C-like; cd07185
529507003949	ligand binding site [chemical binding]; other site
529507003950	HMMPfam hit to PF00691, OmpA family, score 1e-39
529507003951	PS01068 OmpA-like domain.
529507003952	HMMPfam hit to PF01389, OmpA-like transmembrane domain, score 2e-100
529507003953	1 probable transmembrane helix predicted for PMI0785 by TMHMM2.0 at aa 12-29
529507003954	Signal peptide predicted for PMI0785 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.991 between residues 21 and 22
529507003955	SOS cell division inhibitor; Provisional; Region: PRK10595
529507003956	HMMPfam hit to PF03846, Cell division inhibitor SulA, score 3.4e-34
529507003957	TfoX N-terminal domain; Region: TfoX_N; pfam04993
529507003958	TfoX C-terminal domain; Region: TfoX_C; pfam04994
529507003959	HMMPfam hit to PF04993, TfoX N-terminal domain, score 4.9e-12
529507003960	HMMPfam hit to PF04994, TfoX C-terminal domain, score 1.7e-21
529507003961	TIGR01666 family membrane protein; Region: YCCS
529507003962	FUSC-like inner membrane protein yccS; Region: FUSC-like; pfam12805
529507003963	Fusaric acid resistance protein-like; Region: FUSC_2; pfam13515
529507003964	HMMPfam hit to PF05976, Bacterial membrane protein of unknown functi, score 0
529507003965	Predicted helix-turn-helix motif with score 987.000, SD 2.55 at aa 604-625, sequence TSQEEAFKLLCLNHTLLSYISA
529507003966	10 probable transmembrane helices predicted for PMI0788 by TMHMM2.0 at aa 15-37, 67-86, 90-112, 117-139, 144-166, 392-414, 419-436, 443-465, 485-505 and 512-534
529507003967	DNA helicase IV; Provisional; Region: helD; PRK11054
529507003968	DNA helicase IV / RNA helicase N terminal; Region: Nucleolin_N; pfam12462
529507003969	Part of AAA domain; Region: AAA_19; pfam13245
529507003970	Family description; Region: UvrD_C_2; pfam13538
529507003971	HMMPfam hit to PF00580, UvrD/REP helicase, score 1.3e-16
529507003972	PS00017 ATP/GTP-binding site motif A (P-loop).
529507003973	Methylglyoxal synthase catalyzes the enolization of dihydroxyacetone phosphate (DHAP) to produce methylglyoxal. The first part of the catalytic mechanism is believed to be similar to TIM (triosephosphate isomerase) in that both enzymes utilize DHAP to...; Region: MGS; cd01422
529507003974	active site
529507003975	dimer interfaces [polypeptide binding]; other site
529507003976	catalytic residues [active]
529507003977	HMMPfam hit to PF02142, MGS-like domain, score 3.4e-25
529507003978	PS01335 Methylglyoxal synthase active site.
529507003979	Predicted CoA-binding protein [General function prediction only]; Region: COG1832
529507003980	HMMPfam hit to PF02629, CoA binding domain, score 7.7e-21
529507003981	heat shock protein HspQ; Provisional; Region: PRK14129
529507003982	Acylphosphatase; Region: Acylphosphatase; pfam00708
529507003983	HMMPfam hit to PF00708, Acylphosphatase, score 4.8e-07
529507003984	PS00150 Acylphosphatase signature 1.
529507003985	Dissimilatory sulfite reductase (desulfoviridin), gamma subunit [Inorganic ion transport and metabolism]; Region: DsrC; COG2920
529507003986	DsrC like protein; Region: DsrC; pfam04358
529507003987	HMMPfam hit to PF04358, DsrC like protein, score 9.6e-73
529507003988	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cd04301
529507003989	Acetyltransferases [General function prediction only]; Region: RimI; COG0456
529507003990	Coenzyme A binding pocket [chemical binding]; other site
529507003991	HMMPfam hit to PF00583, Acetyltransferase (GNAT) family, score 7.7e-15
529507003992	Domain of unknown function (DUF1869); Region: DUF1869; pfam08956
529507003993	Domain of unknown function (DUF1971); Region: DUF1971; cl17717
529507003994	curved DNA-binding protein CbpA; Provisional; Region: PRK10266
529507003995	DnaJ domain or J-domain.  DnaJ/Hsp40 (heat shock protein 40) proteins are highly conserved and play crucial roles in protein translation, folding, unfolding, translocation, and degradation. They act primarily by stimulating the ATPase activity of Hsp70s; Region: DnaJ; cd06257
529507003996	HSP70 interaction site [polypeptide binding]; other site
529507003997	C-terminal substrate binding domain of DnaJ and HSP40; Region: DnaJ_C; cd10747
529507003998	substrate binding site [polypeptide binding]; other site
529507003999	dimer interface [polypeptide binding]; other site
529507004000	HMMPfam hit to PF00226, DnaJ domain, score 1.7e-32
529507004001	PS00636 Nt-dnaJ domain signature.
529507004002	HMMPfam hit to PF01556, DnaJ C terminal region, score 4.2e-30
529507004003	chaperone-modulator protein CbpM; Provisional; Region: PRK10265
529507004004	MerR HTH family regulatory protein; Region: MerR_2; pfam13591
529507004005	Transcriptional regulator [Transcription]; Region: LysR; COG0583
529507004006	Bacterial regulatory helix-turn-helix protein, lysR family; Region: HTH_1; pfam00126
529507004007	The substrate binding domain of LysR-type transcriptional regulators (LTTRs), a member of the type 2 periplasmic binding fold protein superfamily; Region: PBP2_LTTR_substrate; cl11398
529507004008	dimerization interface [polypeptide binding]; other site
529507004009	HMMPfam hit to PF00126, Bacterial regulatory helix-turn-helix, score 3.4e-19
529507004010	Predicted helix-turn-helix motif with score 1137.000, SD 3.06 at aa 18-39, sequence GSFTRAAEKLALANSAVSRTVK
529507004011	PS00044 Bacterial regulatory proteins, lysR family signature.
529507004012	HMMPfam hit to PF03466, LysR substrate binding domain, score 3.5e-43
529507004013	Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols. AKRs are present in all phyla and are of importance to both health and industrial...; Region: Aldo_ket_red; cd06660
529507004014	Aldo/keto reductase family; Region: Aldo_ket_red; pfam00248
529507004015	active site
529507004016	catalytic tetrad [active]
529507004017	HMMPfam hit to PF00248, Aldo/keto reductase family, score 9.9e-86
529507004018	PS00062 Aldo/keto reductase family signature 2.
529507004019	PS00798 Aldo/keto reductase family signature 1.
529507004020	Peptidase family C69; Region: Peptidase_C69; cl17793
529507004021	Signal peptide predicted for PMI0803 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.868 between residues 27 and 28
529507004022	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507004023	HMMPfam hit to PF03577, Peptidase family U34, score 7.6e-151
529507004024	right oriC-binding transcriptional activator; Provisional; Region: PRK15121
529507004025	Bacterial regulatory helix-turn-helix proteins, AraC family; Region: HTH_AraC; pfam00165
529507004026	Bacterial regulatory helix-turn-helix proteins, AraC family; Region: HTH_AraC; pfam00165
529507004027	GyrI-like small molecule binding domain; Region: GyrI-like; pfam06445
529507004028	HMMPfam hit to PF06445, Bacterial transcription activator, effect, score 2.2e-09
529507004029	HMMPfam hit to PF00165, Bacterial regulatory helix-turn-helix pro, score 2.4e-11
529507004030	HMMPfam hit to PF00165, Bacterial regulatory helix-turn-helix pro, score 9.2e-12
529507004031	Predicted helix-turn-helix motif with score 1036.000, SD 2.72 at aa 26-47, sequence LSLDIIAEKSGYTKWHFQRLFK
529507004032	Membrane-bound lysozyme-inhibitor of c-type lysozyme; Region: MliC; pfam09864
529507004033	Signal peptide predicted for PMI0805 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.988 between residues 23 and 24
529507004034	Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only]; Region: MhpC; COG0596
529507004035	HMMPfam hit to PF00561, alpha/beta hydrolase fold, score 0.00011
529507004036	Cold-Shock Protein (CSP) contains an S1-like cold-shock domain (CSD) that is found in eukaryotes, prokaryotes, and archaea.  CSP's include the major cold-shock proteins CspA and CspB in bacteria and the eukaryotic gene regulatory factor Y-box...; Region: CSP_CDS; cd04458
529507004037	DNA-binding site [nucleotide binding]; DNA binding site
529507004038	RNA-binding motif; other site
529507004039	HMMPfam hit to PF00313, 'Cold-shock' DNA-binding domain, score 7.2e-44
529507004040	PS00352 'Cold-shock' DNA-binding domain signature.
529507004041	Bacterial lipid A biosynthesis acyltransferase; Region: Lip_A_acyltrans; pfam03279
529507004042	Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: LABLAT-like; Region: LPLAT_LABLAT-like; cd07984
529507004043	putative acyl-acceptor binding pocket; other site
529507004044	HMMPfam hit to PF03279, Bacterial lipid A biosynthesis acyltr, score 1.4e-87
529507004045	1 probable transmembrane helix predicted for PMI0808 by TMHMM2.0 at aa 17-39
529507004046	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
529507004047	S-adenosylmethionine binding site [chemical binding]; other site
529507004048	Signal peptide predicted for PMI0810 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 1.000 between residues 25 and 26
529507004049	Methyltransferase domain; Region: Methyltransf_31; pfam13847
529507004050	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
529507004051	S-adenosylmethionine binding site [chemical binding]; other site
529507004052	2 probable transmembrane helices predicted for PMI0813 by TMHMM2.0 at aa 10-29 and 57-79
529507004053	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507004054	Predicted esterase of the alpha/beta hydrolase fold [General function prediction only]; Region: COG3545
529507004055	Alpha/beta hydrolase family; Region: Abhydrolase_5; pfam12695
529507004056	two-component response regulator (pseudogene);This CDS contains a frameshift mutation.
529507004057	1 probable transmembrane helix predicted for PMI0816 by TMHMM2.0 at aa 2-19
529507004058	Uncharacterized protein family (UPF0150); Region: UPF0150; pfam03681
529507004059	HMMPfam hit to PF03681, Uncharacterised protein family (UPF0150), score 7.4e-14
529507004060	YcfA-like protein; Region: YcfA; pfam07927
529507004061	HMMPfam hit to PF07927, YcfA-like protein, score 7.4e-22
529507004062	phage portal protein (pseudogene);This CDS contains a frameshift mutation.
529507004063	phage-related protein (pseudogene);This CDS contains a frameshift mutation.
529507004064	Predicted hydrolase of alkaline phosphatase superfamily [General function prediction only]; Region: COG3083
529507004065	Domain of unknown function (DUF3413); Region: DUF3413; pfam11893
529507004066	Sulfatase; Region: Sulfatase; cl17466
529507004067	HMMPfam hit to PF00884, Sulfatase, score 1.9e-09
529507004068	5 probable transmembrane helices predicted for PMI0823 by TMHMM2.0 at aa 21-40, 60-82, 89-111, 135-157 and 168-190
529507004069	hypothetical protein; Provisional; Region: PRK13689
529507004070	HMMPfam hit to PF07208, Protein of unknown function (DUF1414), score 1.4e-44
529507004071	Nucleoid-associated protein [General function prediction only]; Region: COG3081
529507004072	nucleoid-associated protein NdpA; Validated; Region: PRK00378
529507004073	HMMPfam hit to PF04245, 37-kD nucleoid-associated bacterial protein, score 5.7e-179
529507004074	Ribosomal L25/TL5/CTC N-terminal 5S rRNA binding domain; Region: Ribosomal_L25_TL5_CTC; cd00495
529507004075	5S rRNA interface [nucleotide binding]; other site
529507004076	CTC domain interface [polypeptide binding]; other site
529507004077	L16 interface [polypeptide binding]; other site
529507004078	HMMPfam hit to PF01386, Ribosomal L25p family, score 8.3e-36
529507004079	DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair]; Region: SSL2; COG1061
529507004080	DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region; Region: DEXDc; cd00046
529507004081	ATP binding site [chemical binding]; other site
529507004082	putative Mg++ binding site [ion binding]; other site
529507004083	Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may...; Region: HELICc; cd00079
529507004084	nucleotide binding region [chemical binding]; other site
529507004085	ATP-binding site [chemical binding]; other site
529507004086	HMMPfam hit to PF00271, Helicase conserved C-terminal domain, score 1.5e-09
529507004087	HMMPfam hit to PF00270, DEAD/DEAH box helicase, score 1.4e-13
529507004088	HMMPfam hit to PF04851, Type III restriction enzyme, res subunit, score 6.9e-35
529507004089	16S rRNA pseudouridylate synthase A; Provisional; Region: PRK10839
529507004090	S4/Hsp/ tRNA synthetase RNA-binding domain; The domain surface is populated by conserved, charged residues that define a likely RNA-binding site;  Found in stress proteins, ribosomal proteins and tRNA synthetases; This may imply a hitherto unrecognized...; Region: S4; cd00165
529507004091	RNA binding surface [nucleotide binding]; other site
529507004092	Pseudouridine synthase, Escherichia coli RsuA like; Region: PseudoU_synth_RsuA; cd02553
529507004093	active site
529507004094	uracil binding [chemical binding]; other site
529507004095	HMMPfam hit to PF01479, S4 domain, score 2.1e-08
529507004096	HMMPfam hit to PF00849, RNA pseudouridylate synthase, score 2.4e-21
529507004097	PS01149 Rsu family of pseudouridine synthase signature.
529507004098	bicyclomycin/multidrug efflux system; Provisional; Region: PRK11102
529507004099	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507004100	putative substrate translocation pore; other site
529507004101	HMMPfam hit to PF00083, Sugar (and other) transporter, score 0.00016
529507004102	12 probable transmembrane helices predicted for PMI0829 by TMHMM2.0 at aa 13-35, 55-74, 81-100, 106-128, 141-163, 168-190, 224-246, 256-278, 285-307, 312-334, 347-369 and 373-395
529507004103	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 1.7e-55
529507004104	hypothetical protein; Provisional; Region: PRK11835
529507004105	outer membrane lipoprotein; Provisional; Region: spr; PRK10838
529507004106	NlpC/P60 family; Region: NLPC_P60; pfam00877
529507004107	HMMPfam hit to PF00877, NlpC/P60 family, score 2.5e-46
529507004108	Signal peptide predicted for PMI0831 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.547 between residues 35 and 36
529507004109	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507004110	Membrane-associated phospholipid phosphatase [Lipid metabolism]; Region: PgpB; COG0671
529507004111	PAP2_like proteins, a super-family of histidine phosphatases and vanadium haloperoxidases, includes type 2 phosphatidic acid phosphatase or lipid phosphate phosphatase (LPP), Glucose-6-phosphatase, Phosphatidylglycerophosphatase B and bacterial acid...; Region: PAP2_like; cd01610
529507004112	active site
529507004113	HMMPfam hit to PF01569, PAP2 superfamily, score 1e-06
529507004114	5 probable transmembrane helices predicted for PMI0832 by TMHMM2.0 at aa 12-31, 60-82, 95-114, 164-186 and 199-216
529507004115	Signal peptide predicted for PMI0832 by SignalP 2.0 HMM (Signal peptide probability 0.765) with cleavage site probability 0.298 between residues 31 and 32
529507004116	Signal peptide predicted for PMI0833 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.993 between residues 21 and 22
529507004117	Signal peptide predicted for PMI0834 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.638 between residues 22 and 23
529507004118	elongation factor P; Provisional; Region: PRK04542
529507004119	Elongation factor P (EF-P) KOW-like domain; Region: EFP_N; pfam08207
529507004120	S1_EF-P_repeat_1: Translation elongation factor P (EF-P), S1-like RNA-binding domain, repeat 1. EF-P stimulates the peptidyltransferase activity in the prokaryotic 70S ribosome. EF-P enhances the synthesis of certain dipeptides with...; Region: S1_EF-P_repeat_1; cd04470
529507004121	RNA binding site [nucleotide binding]; other site
529507004122	S1_EF-P_repeat_2: Translation elongation factor P (EF-P), S1-like RNA-binding domain, repeat 1. EF-P stimulates the peptidyltransferase activity in the prokaryotic 70S ribosome. EF-P enhances the synthesis of certain dipeptides with...; Region: S1_EF-P_repeat_2; cd05794
529507004123	RNA binding site [nucleotide binding]; other site
529507004124	HMMPfam hit to PF01132, Elongation factor P (EF-P), score 5.8e-95
529507004125	PS01275 Elongation factor P signature.
529507004126	Tryptophan/tyrosine permease family; Region: Trp_Tyr_perm; cl17316
529507004127	aromatic amino acid transport protein; Region: araaP; TIGR00837
529507004128	11 probable transmembrane helices predicted for PMI0836 by TMHMM2.0 at aa 13-35, 45-67, 87-109, 124-143, 150-172, 192-214, 227-246, 287-309, 322-339, 343-365 and 385-404
529507004129	HMMPfam hit to PF03222, Tryptophan/tyrosine permease family, score 5.8e-195
529507004130	Signal peptide predicted for PMI0836 by SignalP 2.0 HMM (Signal peptide probability 0.887) with cleavage site probability 0.613 between residues 26 and 27
529507004131	Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+...; Region: Nudix_Hydrolase; cl00447
529507004132	nudix motif; other site
529507004133	HMMPfam hit to PF00293, NUDIX domain, score 5.5e-29
529507004134	PS00893 mutT domain signature.
529507004135	endonuclease IV; Provisional; Region: PRK01060
529507004136	AP endonuclease family 2; These endonucleases play a role in DNA repair. Cleave phosphodiester bonds at apurinic or apyrimidinic sites; the alignment also contains hexulose-6-phosphate isomerases, enzymes that catalyze the epimerization of...; Region: AP2Ec; cd00019
529507004137	AP (apurinic/apyrimidinic) site pocket; other site
529507004138	DNA interaction; other site
529507004139	Metal-binding active site; metal-binding site
529507004140	HMMPfam hit to PF01261, Xylose isomerase-like TIM barrel, score 2.6e-64
529507004141	PS00730 AP endonucleases family 2 signature 2.
529507004142	PS00729 AP endonucleases family 2 signature 1.
529507004143	Predicted membrane protein [Function unknown]; Region: COG2855
529507004144	9 probable transmembrane helices predicted for PMI0839 by TMHMM2.0 at aa 45-67, 77-99, 134-156, 166-185, 197-219, 269-286, 307-329, 334-356 and 363-385
529507004145	HMMPfam hit to PF03601, Conserved hypothetical protein, score 2.6e-151
529507004146	putative DNA-binding transcriptional regulator; Provisional; Region: PRK10837
529507004147	Bacterial regulatory helix-turn-helix protein, lysR family; Region: HTH_1; pfam00126
529507004148	C-terminal substrate binding domain of LysR-type transcriptional regulator CysL, which activates the transcription of the cysJI operon encoding sulfite reductase, contains the type 2 periplasmic binding fold; Region: PBP2_CysL_like; cd08420
529507004149	putative dimerization interface [polypeptide binding]; other site
529507004150	HMMPfam hit to PF00126, Bacterial regulatory helix-turn-helix, score 1.5e-18
529507004151	Predicted helix-turn-helix motif with score 1175.000, SD 3.19 at aa 20-41, sequence GSTTQASQQLALSQSAVSASLT
529507004152	PS00044 Bacterial regulatory proteins, lysR family signature.
529507004153	HMMPfam hit to PF03466, LysR substrate binding domain, score 1e-56
529507004154	lysine transporter; Provisional; Region: PRK10836
529507004155	Signal peptide predicted for PMI0841 by SignalP 2.0 HMM (Signal peptide probability 0.707) with cleavage site probability 0.519 between residues 52 and 53
529507004156	HMMPfam hit to PF00324, Amino acid permease, score 6e-195
529507004157	12 probable transmembrane helices predicted for PMI0841 by TMHMM2.0 at aa 27-49, 59-81, 109-131, 136-158, 165-187, 202-224, 251-273, 297-319, 349-371, 375-397, 418-440 and 450-472
529507004158	PS00218 amino acid permeases signature.
529507004159	putative outer membrane receptor; Provisional; Region: PRK13513
529507004160	TonB dependent/Ligand-Gated channels are created by a monomeric 22 strand (22,24) anti-parallel beta-barrel. Ligands apparently bind to the large extracellular loops. The N-terminal 150-200 residues form a plug from the periplasmic end of barrel; Region: ligand_gated_channel; cd01347
529507004161	N-terminal plug; other site
529507004162	ligand-binding site [chemical binding]; other site
529507004163	Signal peptide predicted for PMI0842 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.932 between residues 27 and 28
529507004164	HMMPfam hit to PF07715, TonB-dependent Receptor Plug Domain, score 8.1e-29
529507004165	Mutant D6_33
529507004166	HMMPfam hit to PF00593, TonB dependent receptor, score 8e-28
529507004167	Amino acid transporters [Amino acid transport and metabolism]; Region: PotE; COG0531
529507004168	12 probable transmembrane helices predicted for PMI0843 by TMHMM2.0 at aa 26-44, 59-81, 102-124, 139-161, 166-188, 208-225, 246-268, 295-317, 345-364, 369-391, 403-420 and 430-447
529507004169	HMMPfam hit to PF00324, Amino acid permease, score 1.9e-13
529507004170	PAP2_like proteins, a super-family of histidine phosphatases and vanadium haloperoxidases, includes type 2 phosphatidic acid phosphatase or lipid phosphate phosphatase (LPP), Glucose-6-phosphatase, Phosphatidylglycerophosphatase B and bacterial acid...; Region: PAP2_like; cl00474
529507004171	active site
529507004172	Membrane-associated phospholipid phosphatase [Lipid metabolism]; Region: PgpB; COG0671
529507004173	Autotransporter-associated beta strand repeat; Region: Autotrns_rpt; pfam12951
529507004174	outer membrane autotransporter barrel domain; Region: autotrans_barl; TIGR01414
529507004175	Autotransporter beta-domain; Region: Autotransporter; smart00869
529507004176	HMMPfam hit to PF03797, Autotransporter beta-domain, score 6.8e-32
529507004177	Signal peptide predicted for PMI0844 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.997 between residues 27 and 28
529507004178	Pyruvate decarboxylase and related thiamine pyrophosphate-requiring enzymes [Carbohydrate transport and metabolism / Coenzyme metabolism / General function prediction only]; Region: COG3961
529507004179	Pyrimidine (PYR) binding domain of pyruvate decarboxylase (PDC), indolepyruvate decarboxylase (IPDC) and related proteins; Region: TPP_PYR_PDC_IPDC_like; cd07038
529507004180	dimer interface [polypeptide binding]; other site
529507004181	PYR/PP interface [polypeptide binding]; other site
529507004182	TPP binding site [chemical binding]; other site
529507004183	Thiamine pyrophosphate enzyme, central domain; Region: TPP_enzyme_M; pfam00205
529507004184	Thiamine pyrophosphate (TPP) family, PDC_IPDC subfamily, TPP-binding module; composed of proteins similar to pyruvate decarboxylase (PDC) and indolepyruvate decarboxylase (IPDC). PDC, a key enzyme in alcoholic fermentation, catalyzes the conversion of...; Region: TPP_PDC_IPDC; cd02005
529507004185	TPP-binding site [chemical binding]; other site
529507004186	dimer interface [polypeptide binding]; other site
529507004187	HMMPfam hit to PF00205, Thiamine pyrophosphate enzyme, central d, score 1.8e-11
529507004188	HMMPfam hit to PF02776, Thiamine pyrophosphate enzyme, N-termina, score 4.2e-53
529507004189	Transcriptional regulator [Transcription]; Region: LysR; COG0583
529507004190	Bacterial regulatory helix-turn-helix protein, lysR family; Region: HTH_1; pfam00126
529507004191	The substrate binding domain of LysR-type transcriptional regulators (LTTRs), a member of the type 2 periplasmic binding fold protein superfamily; Region: PBP2_LTTR_substrate; cl11398
529507004192	dimerization interface [polypeptide binding]; other site
529507004193	HMMPfam hit to PF00126, Bacterial regulatory helix-turn-helix, score 1.7e-17
529507004194	Predicted helix-turn-helix motif with score 1426.000, SD 4.04 at aa 16-37, sequence NGFSRAADALFITQPAISRSIK
529507004195	PS00044 Bacterial regulatory proteins, lysR family signature.
529507004196	HMMPfam hit to PF03466, LysR substrate binding domain, score 2.4e-41
529507004197	D-lactate dehydrogenase; Provisional; Region: PRK11183
529507004198	FAD binding domain; Region: FAD_binding_4; pfam01565
529507004199	D-lactate dehydrogenase, membrane binding; Region: Lact-deh-memb; pfam09330
529507004200	HMMPfam hit to PF01565, FAD binding domain, score 6.1e-12
529507004201	PS00290 Immunoglobulins and major histocompatibility complex proteins signature.
529507004202	exonuclease I; Provisional; Region: sbcB; PRK11779
529507004203	N-terminal DEDDh 3'-5' exonuclease domain of Escherichia coli exonuclease I and similar proteins; Region: ExoI_N; cd06138
529507004204	active site
529507004205	catalytic site [active]
529507004206	substrate binding site [chemical binding]; other site
529507004207	Exonuclease C-terminal; Region: Exonuc_X-T_C; pfam08411
529507004208	HMMPfam hit to PF00929, Exonuclease, score 3.5e-27
529507004209	galactoside permease; Reviewed; Region: lacY; PRK09528
529507004210	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507004211	putative substrate translocation pore; other site
529507004212	Signal peptide predicted for PMI0850 by SignalP 2.0 HMM (Signal peptide probability 0.995) with cleavage site probability 0.557 between residues 28 and 29
529507004213	HMMPfam hit to PF01306, LacY proton/sugar symporter, score 4.5e-141
529507004214	10 probable transmembrane helices predicted for PMI0850 by TMHMM2.0 at aa 12-34, 44-66, 75-97, 102-124, 167-186, 219-236, 257-279, 308-330, 342-364 and 374-396
529507004215	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 1.5e-13
529507004216	PS00038 Myc-type, 'helix-loop-helix' dimerization domain signature.
529507004217	hypothetical protein; Provisional; Region: PRK05423
529507004218	HMMPfam hit to PF04363, Protein of unknown function (DUF496), score 1.8e-64
529507004219	ribonuclease E; Reviewed; Region: rne; PRK10811
529507004220	S1_RNase_E: RNase E and RNase G, S1-like RNA-binding domain. RNase E is an essential endoribonuclease in the processing and degradation of RNA. In addition to its role in mRNA degradation, RNase E has also been implicated in the processing of rRNA, and...; Region: S1_RNase_E; cd04453
529507004221	homodimer interface [polypeptide binding]; other site
529507004222	oligonucleotide binding site [chemical binding]; other site
529507004223	Polyribonucleotide phosphorylase C terminal; Region: PNPase_C; pfam12111
529507004224	PS00152 ATP synthase alpha and beta subunits signature.
529507004225	HMMPfam hit to PF00575, S1 RNA binding domain, score 4.5e-20
529507004226	23S rRNA pseudouridylate synthase C; Provisional; Region: PRK11025
529507004227	S4/Hsp/ tRNA synthetase RNA-binding domain; The domain surface is populated by conserved, charged residues that define a likely RNA-binding site;  Found in stress proteins, ribosomal proteins and tRNA synthetases; This may imply a hitherto unrecognized...; Region: S4; cd00165
529507004228	RNA binding surface [nucleotide binding]; other site
529507004229	Pseudouridine synthase, RsuA/RluD family; Region: PseudoU_synth_RluCD_like; cd02869
529507004230	active site
529507004231	HMMPfam hit to PF01479, S4 domain, score 2.8e-10
529507004232	Predicted helix-turn-helix motif with score 982.000, SD 2.53 at aa 21-42, sequence IDNFLLARLKGVPKSMIYRIIR
529507004233	HMMPfam hit to PF00849, RNA pseudouridylate synthase, score 7.7e-56
529507004234	PS01129 Rlu family of pseudouridine synthase signature.
529507004235	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507004236	Signal peptide predicted for PMI0854 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.890 between residues 19 and 20
529507004237	Maf-like protein; Region: Maf; pfam02545
529507004238	Nucleotide binding protein Maf. Maf has been implicated in inhibition of septum formation in eukaryotes, bacteria and archaea, but homologs in B.subtilis and S.cerevisiae are nonessential for cell division. Maf has been predicted to be a nucleotide- or...; Region: Maf; cd00555
529507004239	active site
529507004240	dimer interface [polypeptide binding]; other site
529507004241	HMMPfam hit to PF02545, Maf-like protein, score 8e-61
529507004242	hypothetical protein; Provisional; Region: PRK11193
529507004243	HMMPfam hit to PF02620, Uncharacterized ACR, COG1399, score 2.1e-49
529507004244	50S ribosomal protein L32; Validated; Region: rpmF; PRK01110
529507004245	HMMPfam hit to PF01783, Ribosomal L32p protein family, score 1.3e-23
529507004246	putative phosphate acyltransferase; Provisional; Region: PRK05331
529507004247	HMMPfam hit to PF02504, Fatty acid synthesis protein, score 1.6e-152
529507004248	3-oxoacyl-(acyl carrier protein) synthase III; Reviewed; Region: PRK09352
529507004249	Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems. It is found in bacteria and plants. Elongation of fatty acids in the type II systems occurs by Claisen condensation of malonyl-acyl...; Region: KAS_III; cd00830
529507004250	dimer interface [polypeptide binding]; other site
529507004251	active site
529507004252	CoA binding pocket [chemical binding]; other site
529507004253	(acyl-carrier-protein) S-malonyltransferase [Lipid metabolism]; Region: FabD; COG0331
529507004254	malonyl CoA-acyl carrier protein transacylase; Region: fabD; TIGR00128
529507004255	HMMPfam hit to PF00698, Acyl transferase domain, score 4.6e-14
529507004256	3-ketoacyl-(acyl-carrier-protein) reductase; Validated; Region: fabG; PRK05557
529507004257	beta-Keto acyl carrier protein reductase (BKR), involved in Type II FAS, classical (c) SDRs; Region: BKR_SDR_c; cd05333
529507004258	NAD(P) binding site [chemical binding]; other site
529507004259	homotetramer interface [polypeptide binding]; other site
529507004260	homodimer interface [polypeptide binding]; other site
529507004261	active site
529507004262	HMMPfam hit to PF00106, short chain dehydrogenase, score 6e-94
529507004263	PS00061 Short-chain dehydrogenases/reductases family signature.
529507004264	acyl carrier protein; Provisional; Region: acpP; PRK00982
529507004265	HMMPfam hit to PF00550, Phosphopantetheine attachment site, score 4.8e-22
529507004266	PS00012 Phosphopantetheine attachment site.
529507004267	3-oxoacyl-(acyl carrier protein) synthase II; Reviewed; Region: PRK07314
529507004268	Beta-ketoacyl-acyl carrier protein (ACP) synthase (KAS), type I and II. KASs are responsible for the elongation steps in fatty acid biosynthesis. KASIII catalyses the initial condensation and KAS I and II catalyze further elongation steps by Claisen...; Region: KAS_I_II; cd00834
529507004269	dimer interface [polypeptide binding]; other site
529507004270	active site
529507004271	HMMPfam hit to PF00109, Beta-ketoacyl synthase, N-terminal do, score 1.2e-70
529507004272	PS00606 Beta-ketoacyl synthases active site.
529507004273	HMMPfam hit to PF02801, Beta-ketoacyl synthase, C-terminal do, score 1.1e-71
529507004274	Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase [Amino acid transport and metabolism / Coenzyme metabolism]; Region: IlvE; COG0115
529507004275	ADCL_like: 4-Amino-4-deoxychorismate lyase:  is a member of the fold-type IV of PLP dependent enzymes that converts 4-amino-4-deoxychorismate (ADC) to p-aminobenzoate and pyruvate.  Based on the information available from the crystal structure, most...; Region: ADCL_like; cd01559
529507004276	pyridoxal 5'-phosphate binding site [chemical binding]; other site
529507004277	catalytic residue [active]
529507004278	HMMPfam hit to PF01063, Aminotransferase class IV, score 2.3e-30
529507004279	Aminodeoxychorismate lyase [Coenzyme transport and metabolism]; Region: COG1559
529507004280	proteins similar to Escherichia coli yceG; Region: yceG_like; cd08010
529507004281	dimerization interface [polypeptide binding]; other site
529507004282	Signal peptide predicted for PMI0865 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.844 between residues 20 and 21
529507004283	1 probable transmembrane helix predicted for PMI0865 by TMHMM2.0 at aa 7-29
529507004284	HMMPfam hit to PF02618, Aminodeoxychorismate lyase, score 2.2e-140
529507004285	thymidylate kinase; Validated; Region: tmk; PRK00698
529507004286	Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor. TMPK represents the rate-limiting step...; Region: TMPK; cd01672
529507004287	TMP-binding site; other site
529507004288	ATP-binding site [chemical binding]; other site
529507004289	HMMPfam hit to PF02223, Thymidylate kinase, score 3.1e-82
529507004290	PS00017 ATP/GTP-binding site motif A (P-loop).
529507004291	PS01331 Thymidylate kinase signature.
529507004292	DNA polymerase III subunit delta'; Validated; Region: PRK07993
529507004293	DNA polymerase III, delta subunit, C terminal; Region: DNApol3-delta_C; pfam09115
529507004294	PS00190 Cytochrome c family heme-binding site signature.
529507004295	TatD like proteins;  E.coli TatD is a cytoplasmic protein, shown to have magnesium dependent DNase activity; Region: TatD_DNAse; cd01310
529507004296	active site
529507004297	HMMPfam hit to PF01026, TatD related DNase, score 1.4e-121
529507004298	PS01137 Uncharacterized protein family UPF0006 signature 1.
529507004299	PS01090 Uncharacterized protein family UPF0006 signature 2.
529507004300	Protein Kinase C Interacting protein related (PKCI): PKCI and related proteins belong to the ubiquitous HIT family of hydrolases that act on alpha-phosphates of ribonucleotides. The members of this subgroup have a conserved HxHxHxx motif (x is a...; Region: PKCI_related; cd01276
529507004301	nucleotide binding site/active site [active]
529507004302	HIT family signature motif; other site
529507004303	catalytic residue [active]
529507004304	HMMPfam hit to PF01230, HIT domain, score 5.7e-54
529507004305	PS00892 HIT family signature.
529507004306	Putative periplasmic lipoprotein; Region: DUF1425; cd09030
529507004307	putative dimer interface [polypeptide binding]; other site
529507004308	Signal peptide predicted for PMI0870 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.995 between residues 29 and 30
529507004309	1 probable transmembrane helix predicted for PMI0870 by TMHMM2.0 at aa 7-29
529507004310	HMMPfam hit to PF07233, Protein of unknown function (DUF1425), score 1e-23
529507004311	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507004312	Protein of unknown function (DUF3897); Region: DUF3897; pfam13036
529507004313	Signal peptide predicted for PMI0871 by SignalP 2.0 HMM (Signal peptide probability 0.918) with cleavage site probability 0.534 between residues 23 and 24
529507004314	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507004315	thiamine kinase; Region: ycfN_thiK; TIGR02721
529507004316	Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family. The APH/ChoK family is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs)...; Region: APH_ChoK_like; cd05120
529507004317	active site
529507004318	substrate binding site [chemical binding]; other site
529507004319	ATP binding site [chemical binding]; other site
529507004320	HMMPfam hit to PF01636, Phosphotransferase enzyme family, score 5.7e-10
529507004321	HMMPfam hit to PF01633, Choline/ethanolamine kinase, score 5.3e-07
529507004322	beta-hexosaminidase; Provisional; Region: PRK05337
529507004323	Beta-glucosidase-related glycosidases [Carbohydrate transport and metabolism]; Region: BglX; COG1472
529507004324	HMMPfam hit to PF00933, Glycosyl hydrolase family 3 N terminal, score 1.2e-80
529507004325	PS00775 Glycosyl hydrolases family 3 active site.
529507004326	hypothetical protein; Provisional; Region: PRK04940
529507004327	HMMPfam hit to PF05728, Uncharacterised protein family (UPF0227), score 7e-85
529507004328	NADH dehydrogenase, FAD-containing subunit [Energy production and conversion]; Region: Ndh; COG1252
529507004329	Pyridine nucleotide-disulphide oxidoreductase; Region: Pyr_redox; pfam00070
529507004330	HMMPfam hit to PF00070, Pyridine nucleotide-disulphide oxidoreducta, score 2.3e-47
529507004331	Glycine zipper 2TM domain; Region: Rick_17kDa_Anti; cl10470
529507004332	Signal peptide predicted for PMI0876 by SignalP 2.0 HMM (Signal peptide probability 0.987) with cleavage site probability 0.523 between residues 35 and 36
529507004333	transcription-repair coupling factor; Provisional; Region: PRK10689
529507004334	CarD-like/TRCF domain; Region: CarD_TRCF; smart01058
529507004335	DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region; Region: DEXDc; cd00046
529507004336	ATP binding site [chemical binding]; other site
529507004337	putative Mg++ binding site [ion binding]; other site
529507004338	Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may...; Region: HELICc; cd00079
529507004339	nucleotide binding region [chemical binding]; other site
529507004340	ATP-binding site [chemical binding]; other site
529507004341	This domain is found in proteins necessary for strand-specific repair in DNA such as TRCF in Escherichia coli; Region: TRCF; smart00982
529507004342	HMMPfam hit to PF03461, TRCF domain, score 5.5e-46
529507004343	HMMPfam hit to PF00271, Helicase conserved C-terminal domain, score 2e-19
529507004344	HMMPfam hit to PF00270, DEAD/DEAH box helicase, score 5.6e-39
529507004345	HMMPfam hit to PF04851, Type III restriction enzyme, res subunit, score 1.9e-07
529507004346	PS00017 ATP/GTP-binding site motif A (P-loop).
529507004347	HMMPfam hit to PF02559, CarD-like/TRCF domain, score 4e-50
529507004348	outer membrane-specific lipoprotein transporter subunit LolC; Provisional; Region: PRK10814
529507004349	MacB-like periplasmic core domain; Region: MacB_PCD; pfam12704
529507004350	FtsX-like permease family; Region: FtsX; pfam02687
529507004351	4 probable transmembrane helices predicted for PMI0878 by TMHMM2.0 at aa 25-47, 268-290, 311-333 and 367-389
529507004352	HMMPfam hit to PF02687, Predicted permease, score 2.6e-37
529507004353	lipoprotein transporter ATP-binding subunit; Provisional; Region: lolD; PRK11629
529507004354	ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein; Region: ABC_MJ0796_LolCDE_FtsE; cd03255
529507004355	Walker A/P-loop; other site
529507004356	ATP binding site [chemical binding]; other site
529507004357	Q-loop/lid; other site
529507004358	ABC transporter signature motif; other site
529507004359	Walker B; other site
529507004360	D-loop; other site
529507004361	H-loop/switch region; other site
529507004362	HMMPfam hit to PF00005, ABC transporter, score 2.7e-56
529507004363	PS00017 ATP/GTP-binding site motif A (P-loop).
529507004364	PS00211 ABC transporters family signature.
529507004365	outer membrane-specific lipoprotein transporter subunit LolE; Provisional; Region: PRK11146
529507004366	MacB-like periplasmic core domain; Region: MacB_PCD; pfam12704
529507004367	FtsX-like permease family; Region: FtsX; pfam02687
529507004368	4 probable transmembrane helices predicted for PMI0880 by TMHMM2.0 at aa 21-43, 271-293, 319-341 and 376-398
529507004369	HMMPfam hit to PF02687, Predicted permease, score 3.2e-46
529507004370	NAD-dependent deacetylase; Provisional; Region: PRK00481
529507004371	SIRT5_Af1_CobB: Eukaryotic, archaeal and prokaryotic group (class3) which includes human sirtuin SIRT5, Archaeoglobus fulgidus Sir2-Af1, and E. coli CobB; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which...; Region: SIRT5_Af1_CobB; cd01412
529507004372	NAD+ binding site [chemical binding]; other site
529507004373	substrate binding site [chemical binding]; other site
529507004374	Zn binding site [ion binding]; other site
529507004375	Signal peptide predicted for PMI0881 by SignalP 2.0 HMM (Signal peptide probability 0.746) with cleavage site probability 0.386 between residues 57 and 58
529507004376	HMMPfam hit to PF02146, Sir2 family, score 9.8e-77
529507004377	Di- and tripeptidases [Amino acid transport and metabolism]; Region: PepD; COG2195
529507004378	M20 Peptidase T specifically cleaves tripeptides; Region: M20_peptT; cd03892
529507004379	metal binding site [ion binding]; metal-binding site
529507004380	dimer interface [polypeptide binding]; other site
529507004381	PS00758 ArgE / dapE / ACY1 / CPG2 / yscS family signature 1.
529507004382	PS00759 ArgE / dapE / ACY1 / CPG2 / yscS family signature 2.
529507004383	HMMPfam hit to PF07687, Peptidase dimerisation domain, score 2e-27
529507004384	Uncharacterized conserved protein [Function unknown]; Region: COG2850
529507004385	sensor protein PhoQ; Provisional; Region: PRK10815
529507004386	PhoQ Sensor; Region: PhoQ_Sensor; pfam08918
529507004387	HAMP domain; Region: HAMP; pfam00672
529507004388	Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via...; Region: HisKA; cd00082
529507004389	dimer interface [polypeptide binding]; other site
529507004390	phosphorylation site [posttranslational modification]
529507004391	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
529507004392	ATP binding site [chemical binding]; other site
529507004393	Mg2+ binding site [ion binding]; other site
529507004394	G-X-G motif; other site
529507004395	HMMPfam hit to PF02518, Histidine kinase-, DNA gyrase B-, and HSP90, score 1.3e-29
529507004396	HMMPfam hit to PF00512, His Kinase A (phosphoacceptor) domain, score 0.00064
529507004397	HMMPfam hit to PF00672, HAMP domain, score 0.0017
529507004398	2 probable transmembrane helices predicted for PMI0884 by TMHMM2.0 at aa 20-42 and 193-215
529507004399	Signal peptide predicted for PMI0884 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.312 between residues 33 and 34
529507004400	DNA-binding transcriptional regulator PhoP; Provisional; Region: PRK10816
529507004401	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
529507004402	active site
529507004403	phosphorylation site [posttranslational modification]
529507004404	intermolecular recognition site; other site
529507004405	dimerization interface [polypeptide binding]; other site
529507004406	Effector domain of response regulator. Bacteria and certain eukaryotes like protozoa and higher plants use two-component signal transduction systems to detect and respond to changes in the environment. The system consists of a sensor histidine kinase and...; Region: trans_reg_C; cd00383
529507004407	DNA binding site [nucleotide binding]
529507004408	HMMPfam hit to PF00486, Transcriptional regulatory protein, C te, score 1.2e-20
529507004409	HMMPfam hit to PF00072, Response regulator receiver domain, score 3.4e-35
529507004410	adenylosuccinate lyase; Provisional; Region: PRK09285
529507004411	PurB_like adenylosuccinases (adenylsuccinate lyase, ASL); Region: PurB; cd01598
529507004412	tetramer interface [polypeptide binding]; other site
529507004413	active site
529507004414	HMMPfam hit to PF00206, Lyase, score 8.8e-100
529507004415	PS00163 Fumarate lyases signature.
529507004416	putative lysogenization regulator; Reviewed; Region: PRK00218
529507004417	HMMPfam hit to PF04356, Protein of unknown function (DUF489), score 5.2e-68
529507004418	tRNA methyl transferase; Region: tRNA_Me_trans; pfam03054
529507004419	tRNA methyl transferase. This family represents tRNA(5-methylaminomethyl-2-thiouridine)-methyltransferase which is involved in the biosynthesis of the modified nucleoside 5-methylaminomethyl-2-thiouridine present in the wobble position of some tRNAs; Region: tRNA_Me_trans; cd01998
529507004420	HMMPfam hit to PF03054, tRNA methyl transferase, score 1.6e-232
529507004421	Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function. In general, members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes...; Region: Nudix_Hydrolase_2; cd03675
529507004422	nudix motif; other site
529507004423	HMMPfam hit to PF00293, NUDIX domain, score 1.7e-21
529507004424	PS00893 mutT domain signature.
529507004425	23S rRNA pseudouridine synthase E; Provisional; Region: PRK11394
529507004426	Pseudouridine synthases catalyze the isomerization of specific uridines in an RNA molecule to pseudouridines (5-ribosyluracil, psi); Region: PseudoU_synth; cl00130
529507004427	active site
529507004428	HMMPfam hit to PF00849, RNA pseudouridylate synthase, score 1.2e-25
529507004429	PS01149 Rsu family of pseudouridine synthase signature.
529507004430	isocitrate dehydrogenase; Validated; Region: PRK07362
529507004431	isocitrate dehydrogenase; Reviewed; Region: PRK07006
529507004432	HMMPfam hit to PF00180, Isocitrate/isopropylmalate dehydrogenase, score 4.8e-160
529507004433	PS00470 Isocitrate and isopropylmalate dehydrogenases signature.
529507004434	prophage
529507004435	Bacteriophage lambda integrase, N-terminal domain; Region: Phage_integ_N; pfam09003
529507004436	Integrase [DNA replication, recombination, and repair]; Region: XerC; COG0582
529507004437	Lambda integrase, C-terminal catalytic domain. Lambda-type integrases catalyze site-specific integration and excision of temperate bacteriophages and other mobile genetic elements to and from the bacterial host chromosome.  They belong to the superfamily...; Region: INT_Lambda_C; cd00800
529507004438	dimer interface [polypeptide binding]; other site
529507004439	active site
529507004440	Int/Topo IB signature motif; other site
529507004441	HMMPfam hit to PF00589, Phage integrase family, score 4.9e-07
529507004442	Excisionase-like protein; Region: Exc; pfam07825
529507004443	Methyltransferase domain; Region: Methyltransf_25; pfam13649
529507004444	Single-stranded DNA-binding protein [DNA replication, recombination, and repair]; Region: Ssb; COG0629
529507004445	SSB_OBF: A subfamily of OB folds similar to the OB fold of ssDNA-binding protein (SSB). SSBs bind with high affinity to ssDNA. They bind to and protect ssDNA intermediates during DNA metabolic pathways. All bacterial and eukaryotic SSBs studied to date...; Region: SSB_OBF; cd04496
529507004446	dimer interface [polypeptide binding]; other site
529507004447	ssDNA binding site [nucleotide binding]; other site
529507004448	tetramer (dimer of dimers) interface [polypeptide binding]; other site
529507004449	HMMPfam hit to PF00436, Single-strand binding protein family, score 2.2e-36
529507004450	PS00736 Single-strand binding protein family signature 2.
529507004451	PS00735 Single-strand binding protein family signature 1.
529507004452	Uncharacterized conserved protein (DUF2303); Region: DUF2303; pfam10065
529507004453	PS00044 Bacterial regulatory proteins, lysR family signature.
529507004454	Predicted nuclease (RNAse H fold) [General function prediction only]; Region: COG4328
529507004455	Predicted helix-turn-helix motif with score 1749.000, SD 5.14 at aa 25-46, sequence KSKTEIARHFNVKLPSIYDWIK
529507004456	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
529507004457	Predicted transcriptional regulators [Transcription]; Region: HipB; COG1396
529507004458	sequence-specific DNA binding site [nucleotide binding]; other site
529507004459	salt bridge; other site
529507004460	Predicted helix-turn-helix motif with score 2527.000, SD 7.79 at aa 18-39, sequence GGQSEMAKRLGISPPTVNQWIN
529507004461	1 probable transmembrane helix predicted for PMI0905 by TMHMM2.0 at aa 154-176
529507004462	Domain of unknown function (DUF4222); Region: DUF4222; pfam13973
529507004463	HMMPfam hit to PF04492, Bacteriophage replication protein O, score 9.5e-07
529507004464	PS00017 ATP/GTP-binding site motif A (P-loop).
529507004465	Phage regulatory protein Rha (Phage_pRha); Region: Phage_pRha; pfam09669
529507004466	Phage antirepressor protein KilAC domain; Region: ANT; cl01462
529507004467	Protein of unknown function (DUF968); Region: DUF968; pfam06147
529507004468	HMMPfam hit to PF06914, Protein of unknown function (DUF1277), score 7.4e-96
529507004469	Phage antitermination protein Q; Region: Phage_antitermQ; pfam06530
529507004470	HMMPfam hit to PF06530, Phage antitermination protein Q, score 6.4e-51
529507004471	PS00340 Growth factor and cytokines receptors family signature 2.
529507004472	Cold-Shock Protein (CSP) contains an S1-like cold-shock domain (CSD) that is found in eukaryotes, prokaryotes, and archaea.  CSP's include the major cold-shock proteins CspA and CspB in bacteria and the eukaryotic gene regulatory factor Y-box...; Region: CSP_CDS; cd04458
529507004473	DNA-binding site [nucleotide binding]; DNA binding site
529507004474	RNA-binding motif; other site
529507004475	HMMPfam hit to PF00313, 'Cold-shock' DNA-binding domain, score 3.4e-40
529507004476	PS00352 'Cold-shock' DNA-binding domain signature.
529507004477	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
529507004478	AAA domain; Region: AAA_13; pfam13166
529507004479	Walker A/P-loop; other site
529507004480	ATP binding site [chemical binding]; other site
529507004481	PS00017 ATP/GTP-binding site motif A (P-loop).
529507004482	Uncharacterized homolog of gamma-carboxymuconolactone decarboxylase subunit [Function unknown]; Region: COG0599
529507004483	HMMPfam hit to PF02627, Carboxymuconolactone decarboxylase family, score 2.2e-23
529507004484	Cupin; Region: Cupin_6; pfam12852
529507004485	helix_turn_helix, arabinose operon control protein; Region: HTH_ARAC; smart00342
529507004486	Bacterial regulatory helix-turn-helix proteins, AraC family; Region: HTH_AraC; pfam00165
529507004487	HMMPfam hit to PF00165, Bacterial regulatory helix-turn-helix protei, score 0.00018
529507004488	Predicted helix-turn-helix motif with score 1074.000, SD 2.84 at aa 220-241, sequence WTLDSLANVASMSRATFVRQFK
529507004489	HMMPfam hit to PF00165, Bacterial regulatory helix-turn-helix protei, score 2.1e-10
529507004490	Oligosaccharyl transferase STT3 subunit; Region: STT3; pfam02516
529507004491	1 probable transmembrane helix predicted for PMI0919 by TMHMM2.0 at aa 27-49
529507004492	Endolysins and autolysins are found in viruses and bacteria, respectively. The ds DNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell...; Region: endolysin_autolysin; cd00737
529507004493	catalytic residues [active]
529507004494	Signal peptide predicted for PMI0920 by SignalP 2.0 HMM (Signal peptide probability 0.991) with cleavage site probability 0.736 between residues 24 and 25
529507004495	1 probable transmembrane helix predicted for PMI0920 by TMHMM2.0 at aa 7-29
529507004496	HMMPfam hit to PF00959, Phage lysozyme, score 6.1e-34
529507004497	Bacteriophage lysis protein; Region: Phage_lysis; pfam03245
529507004498	HMMPfam hit to PF03245, Bacteriophage lysis protein, score 1.7e-15
529507004499	1 probable transmembrane helix predicted for PMI0921 by TMHMM2.0 at aa 6-25
529507004500	Herpesvirus UL46 protein; Region: Herpes_UL46; cl17368
529507004501	Phage terminase, small subunit; Region: Terminase_4; pfam05119
529507004502	HMMPfam hit to PF05119, Phage terminase, small subunit, score 2.8e-27
529507004503	Phage terminase-like protein, large subunit [General function prediction only]; Region: COG4626
529507004504	HMMPfam hit to PF03354, Phage Terminase, score 1.1e-90
529507004505	Phage-related protein [Function unknown]; Region: COG4695
529507004506	Phage portal protein; Region: Phage_portal; pfam04860
529507004507	HMMPfam hit to PF04860, Phage portal protein, score 7.1e-113
529507004508	Predicted helix-turn-helix motif with score 995.000, SD 2.58 at aa 316-337, sequence IEQQNLGFLQYTLQPYISRWEN
529507004509	Caudovirus prohead protease; Region: Peptidase_U35; cl01521
529507004510	HMMPfam hit to PF04586, Caudovirus prohead protease, score 2.7e-48
529507004511	phage major capsid protein, HK97 family; Region: major_cap_HK97; TIGR01554
529507004512	Phage capsid family; Region: Phage_capsid; pfam05065
529507004513	Head-Tail Connector Proteins gp6 and gp15, and similar proteins; Region: gp6_gp15_like; cl12049
529507004514	Phage head-tail joining protein; Region: Phage_H_T_join; pfam05521
529507004515	HMMPfam hit to PF06264, Protein of unknown function (DUF1026), score 2e-27
529507004516	Bacteriophage protein of unknown function (DUF646); Region: DUF646; pfam04883
529507004517	HMMPfam hit to PF07772, TP901-1 ORF40-like protein, score 2.8e-14
529507004518	Protein of unknown function (DUF3168); Region: DUF3168; pfam11367
529507004519	Protein of unknown function (DUF4035); Region: DUF4035; pfam13227
529507004520	1 probable transmembrane helix predicted for PMI0935 by TMHMM2.0 at aa 21-43
529507004521	tape measure domain; Region: tape_meas_nterm; TIGR02675
529507004522	Tail length tape measure protein; Region: Phage_HK97_TLTM; pfam06120
529507004523	phage tail tape measure protein, lambda family; Region: tape_meas_lam_C; TIGR01541
529507004524	Lambda phage tail tape-measure protein (Tape_meas_lam_C); Region: Tape_meas_lam_C; pfam09718
529507004525	Predicted helix-turn-helix motif with score 1203.000, SD 3.28 at aa 136-567, sequence QRFADNADRLGLSQQKVAELTETVSKAVAISGASATAAQAALTQFGQALASGQLRGE ELNSVMEQTPALAKAIADGMGASVGELRKKAQDGEMTIEKVIQALERAADSVDKKFA TSVTTVSQGFTNLQSAMTKFIGEANQGTGATQLLTIGMATLADNLSLVAKVVEGIAV TALVAKLSQWTKATYLKNQATLNEAKATLQSAEANSVAATSAVRKAWADKEAATSAL NRAKMEYQVARGTNAEKIALDNLIATKSLARTASLNYTQALTAENVAQRALTTARRQ STVAGRALNSVMGFAGGPIGLVLTGVAALGMGLYEYSENVKQAKLESIEFANSLDTS TEALNKMSNATLVANLSKVSSGINAQLEKVEELKQQVISLQGLSKYSVESEKAFAEQ GVGDLYLKRVAEKQKELDAAMGIYAEQVNNLER
529507004526	Predicted helix-turn-helix motif with score 1203.000, SD 3.28 at aa 136-157, sequence QRFADNADRLGLSQQKVAELTE
529507004527	PS00599 Aminotransferases class-II pyridoxal-phosphate attachment site.
529507004528	Predicted helix-turn-helix motif with score 1203.000, SD 3.28 at aa 546-567, sequence EKQKELDAAMGIYAEQVNNLER
529507004529	2 probable transmembrane helices predicted for PMI0940 by TMHMM2.0 at aa 5-27 and 32-54
529507004530	Putative phage tail protein; Region: Phage-tail_3; pfam13550
529507004531	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all...; Region: FN3; cd00063
529507004532	Interdomain contacts; other site
529507004533	Cytokine receptor motif; other site
529507004534	Domain of unknown function (DUF1983); Region: DUF1983; pfam09327
529507004535	HMMPfam hit to PF00041, Fibronectin type III domain, score 0.011
529507004536	Cloacin immunity protein; Region: Cloacin_immun; pfam03513
529507004537	HMMPfam hit to PF03513, Cloacin immunity protein, score 6.4e-26
529507004538	2 probable transmembrane helices predicted for PMI0945 by TMHMM2.0 at aa 20-42 and 59-81
529507004539	phage integrase (fragment)
529507004540	isocitrate dehydrogenase (fragment);Similar to the C-terminus of Escherichia coli icd isocitrate dehydrogenase. The CDS encoding this protein lies at the left-end of the prophage. This partial CDS is part of a repeat sequence that was probably generated by the prophage insertion
529507004541	AAA domain; Region: AAA_21; pfam13304
529507004542	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
529507004543	ABC transporter signature motif; other site
529507004544	Walker B; other site
529507004545	D-loop; other site
529507004546	H-loop/switch region; other site
529507004547	PS00017 ATP/GTP-binding site motif A (P-loop).
529507004548	isocitrate dehydrogenase [NADP] (fragment);Similar to the N-terminus of Escherichia coli icd isocitrate dehydrogenase. This partial CDS is part of a repeat sequence that was probably generated by the prophage insertion
529507004549	prophage
529507004550	Bacteriophage lambda integrase, N-terminal domain; Region: Phage_integ_N; pfam09003
529507004551	Lambda integrase, C-terminal catalytic domain. Lambda-type integrases catalyze site-specific integration and excision of temperate bacteriophages and other mobile genetic elements to and from the bacterial host chromosome.  They belong to the superfamily...; Region: INT_Lambda_C; cd00800
529507004552	dimer interface [polypeptide binding]; other site
529507004553	active site
529507004554	Int/Topo IB signature motif; other site
529507004555	HMMPfam hit to PF00589, Phage integrase family, score 4.6e-07
529507004556	Excisionase-like protein; Region: Exc; pfam07825
529507004557	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
529507004558	non-specific DNA binding site [nucleotide binding]; other site
529507004559	salt bridge; other site
529507004560	sequence-specific DNA binding site [nucleotide binding]; other site
529507004561	Peptidase S24 LexA-like proteins are involved in the SOS response leading to the repair of single-stranded DNA within the bacterial cell. This family includes: the lambda repressor CI/C2 family and related bacterial prophage repressor proteins; LexA (EC...; Region: S24_LexA-like; cd06529
529507004562	Catalytic site [active]
529507004563	HMMPfam hit to PF00717, Peptidase S24-like, score 0.00059
529507004564	HMMPfam hit to PF01381, Helix-turn-helix, score 5.5e-17
529507004565	Predicted helix-turn-helix motif with score 1997.000, SD 5.99 at aa 18-39, sequence LTQEALAKMLSVSRVSITKWET
529507004566	Conserved phage C-terminus (Phg_2220_C); Region: Phg_2220_C; cl09752
529507004567	Phage antitermination protein Q; Region: Phage_antitermQ; pfam06530
529507004568	HMMPfam hit to PF06530, Phage antitermination protein Q, score 1.2e-54
529507004569	PS00228 Tubulin-beta mRNA autoregulation signal.
529507004570	Predicted helix-turn-helix motif with score 1869.000, SD 5.55 at aa 80-101, sequence CSKRSIARRWKVSESRVRQIIQ
529507004571	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
529507004572	sequence-specific DNA binding site [nucleotide binding]; other site
529507004573	salt bridge; other site
529507004574	Predicted helix-turn-helix motif with score 999.000, SD 2.59 at aa 15-36, sequence LTQEELGILAGIDEESAKIRVC
529507004575	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
529507004576	Predicted transcriptional regulators [Transcription]; Region: HipB; COG1396
529507004577	non-specific DNA binding site [nucleotide binding]; other site
529507004578	salt bridge; other site
529507004579	sequence-specific DNA binding site [nucleotide binding]; other site
529507004580	HMMPfam hit to PF01381, Helix-turn-helix, score 2.2e-09
529507004581	Winged helix-turn-helix DNA-binding; Region: HTH_35; pfam13693
529507004582	This hit extended beyond the end of the feature by 1 aa and was clipped.; PS00014 Endoplasmic reticulum targeting sequence.
529507004583	Predicted helix-turn-helix motif with score 1866.000, SD 5.54 at aa 20-41, sequence TTLAEVSRAAGLSSSTLSNALS
529507004584	DNA modification methylase [DNA replication, recombination, and repair]; Region: COG0863
529507004585	DNA methylase; Region: N6_N4_Mtase; pfam01555
529507004586	DNA methylase; Region: N6_N4_Mtase; pfam01555
529507004587	DNA modification methylase [DNA replication, recombination, and repair]; Region: COG0863
529507004588	PS00092 N-6 Adenine-specific DNA methylases signature.
529507004589	HMMPfam hit to PF01555, DNA methylase, score 2.2e-31
529507004590	Signal peptide predicted for PMI0964 by SignalP 2.0 HMM (Signal peptide probability 0.689) with cleavage site probability 0.285 between residues 32 and 33
529507004591	4 probable transmembrane helices predicted for PMI0964 by TMHMM2.0 at aa 46-68, 83-105, 128-150 and 160-182
529507004592	Bacteriophage lysis protein; Region: Phage_lysis; pfam03245
529507004593	HMMPfam hit to PF03245, Bacteriophage lysis protein, score 8.4e-14
529507004594	1 probable transmembrane helix predicted for PMI0965 by TMHMM2.0 at aa 18-35
529507004595	Domain of unknown function (DUF4297); Region: DUF4297; pfam14130
529507004596	isocitrate dehydrogenase [NADP] (fragment);Similar to the C-terminus of Escherichia coli isocitrate dehydrogenase Icd . This partial CDS is part of a repeat sequence that was probably generated by the insertion of a prophage
529507004597	This region is deleted from the repeat at the left end of this prophage
529507004598	transposase (fragment)
529507004599	Signal peptide predicted for PMI0970 by SignalP 2.0 HMM (Signal peptide probability 0.980) with cleavage site probability 0.974 between residues 47 and 48
529507004600	Alpha/beta hydrolase family; Region: Abhydrolase_5; pfam12695
529507004601	Secretory lipase; Region: LIP; pfam03583
529507004602	HMMPfam hit to PF03583, Secretory lipase, score 8.9e-06
529507004603	Cold-Shock Protein (CSP) contains an S1-like cold-shock domain (CSD) that is found in eukaryotes, prokaryotes, and archaea.  CSP's include the major cold-shock proteins CspA and CspB in bacteria and the eukaryotic gene regulatory factor Y-box...; Region: CSP_CDS; cd04458
529507004604	DNA-binding site [nucleotide binding]; DNA binding site
529507004605	RNA-binding motif; other site
529507004606	HMMPfam hit to PF00313, 'Cold-shock' DNA-binding domain, score 4.4e-39
529507004607	PS00352 'Cold-shock' DNA-binding domain signature.
529507004608	Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones]; Region: IbpA; COG0071
529507004609	alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins; Region: alpha-crystallin-Hsps_p23-like; cl00175
529507004610	HMMPfam hit to PF00011, Hsp20/alpha crystallin family, score 6.1e-13
529507004611	Signal peptide predicted for PMI0974 by SignalP 2.0 HMM (Signal peptide probability 0.978) with cleavage site probability 0.856 between residues 29 and 30
529507004612	4 probable transmembrane helices predicted for PMI0974 by TMHMM2.0 at aa 7-29, 49-71, 78-97 and 117-139
529507004613	Predicted transcriptional regulators [Transcription]; Region: COG1733
529507004614	HxlR-like helix-turn-helix; Region: HxlR; pfam01638
529507004615	HMMPfam hit to PF01638, Transcriptional regulator, score 8.3e-45
529507004616	Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]; Region: COG0702
529507004617	triphenylmethane reductase (TMR)-like proteins, NMRa-like, atypical (a) SDRs; Region: TMR_SDR_a; cd05269
529507004618	NADP binding site [chemical binding]; other site
529507004619	Signal peptide predicted for PMI0977 by SignalP 2.0 HMM (Signal peptide probability 0.998) with cleavage site probability 0.656 between residues 22 and 23
529507004620	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507004621	hypothetical protein; Provisional; Region: PRK08233
529507004622	Adenylate kinase and related kinases [Nucleotide transport and metabolism]; Region: Adk; COG0563
529507004623	active site
529507004624	Signal peptide predicted for PMI0980 by SignalP 2.0 HMM (Signal peptide probability 0.943) with cleavage site probability 0.596 between residues 32 and 33
529507004625	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
529507004626	non-specific DNA binding site [nucleotide binding]; other site
529507004627	salt bridge; other site
529507004628	sequence-specific DNA binding site [nucleotide binding]; other site
529507004629	HMMPfam hit to PF01381, Helix-turn-helix, score 3.2e-10
529507004630	Predicted helix-turn-helix motif with score 1361.000, SD 3.82 at aa 21-42, sequence LTGIEMGNRLGISQQHYSRIEN
529507004631	2 probable transmembrane helices predicted for PMI0983 by TMHMM2.0 at aa 7-29 and 64-81
529507004632	Stage 0 sporulation protein J (antagonist of Soj) containing ParB-like nuclease domain [Transcription]; Region: Spo0J; COG1475
529507004633	ParB-like nuclease domain; Region: ParBc; pfam02195
529507004634	Predicted helix-turn-helix motif with score 1108.000, SD 2.96 at aa 174-195, sequence WNDQKIGDELGMSQDEVLRLKQ
529507004635	HMMPfam hit to PF02195, ParB-like nuclease domain, score 1.2e-05
529507004636	Predicted phosphoadenosine phosphosulfate sulfotransferase [General function prediction only]; Region: COG3969
529507004637	This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase. PAPS reductase is part of the adenine nucleotide alpha hydrolases superfamily also including N type ATP PPases and ATP sulphurylases. A highly...; Region: PAPS_reductase; cd01713
529507004638	Active Sites [active]
529507004639	Domain of unknown function (DUF3440); Region: DUF3440; pfam11922
529507004640	Predicted helix-turn-helix motif with score 1077.000, SD 2.86 at aa 233-254, sequence NPIYDLMHQAGVSLSQMRICEP
529507004641	Methyltransferase domain; Region: Methyltransf_31; pfam13847
529507004642	Methyltransferase domain; Region: Methyltransf_12; pfam08242
529507004643	Uncharacterized protein conserved in bacteria [Function unknown]; Region: MmcQ; COG2315
529507004644	HMMPfam hit to PF04237, Protein of unknown function (DUF419), score 2.2e-25
529507004645	Protein of unknown function (DUF523); Region: DUF523; pfam04463
529507004646	Uncharacterized conserved protein [Function unknown]; Region: COG3272
529507004647	Protein of unknown function (DUF1722); Region: DUF1722; cl01284
529507004648	HMMPfam hit to PF04463, Protein of unknown function (DUF523), score 1e-41
529507004649	PS00339 Aminoacyl-transfer RNA synthetases class-II signature 2.
529507004650	mobilization protein (fragment)
529507004651	Protein of unknown function (DUF465); Region: DUF465; cl01070
529507004652	HMMPfam hit to PF04325, Protein of unknown function (DUF465), score 3.5e-15
529507004653	Signal peptide predicted for PMI0992 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.841 between residues 19 and 20
529507004654	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507004655	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507004656	Predicted ATPase [General function prediction only]; Region: COG3911
529507004657	AAA domain; Region: AAA_28; pfam13521
529507004658	PS00017 ATP/GTP-binding site motif A (P-loop).
529507004659	Protein of unknown function (DUF3423); Region: DUF3423; pfam11903
529507004660	Methionine Aminopeptidase 1. E.C. 3.4.11.18. Also known as methionyl aminopeptidase and Peptidase M. Catalyzes release of N-terminal amino acids, preferentially methionine, from peptides and arylamides; Region: MetAP1; cd01086
529507004661	active site
529507004662	HMMPfam hit to PF00557, metallopeptidase family M24, score 2.1e-84
529507004663	PS00680 Methionine aminopeptidase subfamily 1 signature.
529507004664	Phage antitermination protein Q; Region: Phage_antitermQ; pfam06530
529507004665	HMMPfam hit to PF06530, Phage antitermination protein Q, score 7.3e-22
529507004666	Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only]; Region: LipA; COG1075
529507004667	HMMPfam hit to PF00561, alpha/beta hydrolase fold, score 0.0021
529507004668	Predicted helix-turn-helix motif with score 1320.000, SD 3.68 at aa 93-114, sequence TKKADLARKMNLNSAQIERLLD
529507004669	Transposase IS200 like; Region: Y1_Tnp; pfam01797
529507004670	HMMPfam hit to PF01797, Transposase IS200 like, score 1.6e-44
529507004671	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507004672	Helix-turn-helix domain; Region: HTH_OrfB_IS605; pfam12323
529507004673	Transposase and inactivated derivatives [DNA replication, recombination, and repair]; Region: COG0675
529507004674	Probable transposase; Region: OrfB_IS605; pfam01385
529507004675	transposase, IS605 OrfB family, central region; Region: tspaseT_teng_C; TIGR01766
529507004676	HMMPfam hit to PF01385, Probable transposase, score 2.7e-131
529507004677	HMMPfam hit to PF07282, transposase DNA-binding domai, score 5.8e-35
529507004678	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507004679	putative hydrolase; Validated; Region: PRK09248
529507004680	Polymerase and Histidinol Phosphatase domain of Ycdx like; Region: PHP_HisPPase_Ycdx_like; cd07437
529507004681	active site
529507004682	HMMPfam hit to PF02231, PHP domain N-terminal region, score 2.6e-17
529507004683	HMMPfam hit to PF02811, PHP domain C-terminal region, score 0.00022
529507004684	Adenylyl cyclase (AC) class IV-like, a subgroup of the CYTH-like superfamily; Region: CYTH-like_AC_IV-like; cd07890
529507004685	putative active site [active]
529507004686	putative metal binding residues [ion binding]; other site
529507004687	signature motif; other site
529507004688	putative triphosphate binding site [ion binding]; other site
529507004689	dimer interface [polypeptide binding]; other site
529507004690	HMMPfam hit to PF01928, CYTH domain, score 3.8e-17
529507004691	Protein of unknown function (DUF2628); Region: DUF2628; pfam10947
529507004692	3 probable transmembrane helices predicted for PMI1005 by TMHMM2.0 at aa 41-63, 70-89 and 93-115
529507004693	Usp: Universal stress protein family. The universal stress protein Usp is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. Usp enhances the rate of cell survival during prolonged exposure to...; Region: USP_Like; cd00293
529507004694	Ligand Binding Site [chemical binding]; other site
529507004695	HMMPfam hit to PF00582, Universal stress protein family, score 1.8e-11
529507004696	nonheme-containing ferritins; Region: Nonheme_Ferritin; cd01055
529507004697	Ferritin-like domain; Region: Ferritin; pfam00210
529507004698	ferroxidase diiron center [ion binding]; other site
529507004699	HMMPfam hit to PF00210, Ferritin-like domain, score 6.5e-48
529507004700	Uncharacterized protein, homolog of Cu resistance protein CopC [General function prediction only]; Region: CopC; COG2372
529507004701	HMMPfam hit to PF04234, Copper resistance protein CopC, score 9.2e-32
529507004702	Signal peptide predicted for PMI1008 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.817 between residues 30 and 31
529507004703	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507004704	Putative copper export protein [Inorganic ion transport and metabolism]; Region: PcoD; COG1276
529507004705	HMMPfam hit to PF05425, Copper resistance protein D, score 3.5e-40
529507004706	8 probable transmembrane helices predicted for PMI1009 by TMHMM2.0 at aa 10-32, 44-66, 94-111, 118-140, 155-177, 198-220, 238-260 and 273-295
529507004707	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507004708	Protein of unknown function (DUF2511); Region: DUF2511; pfam10709
529507004709	Signal peptide predicted for PMI1010 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.993 between residues 19 and 20
529507004710	Protein of unknown function (DUF1480); Region: DUF1480; pfam07351
529507004711	HMMPfam hit to PF07351, Protein of unknown function (DUF1480), score 8.1e-23
529507004712	Paraquat-inducible protein B [General function prediction only]; Region: PqiB; COG3008
529507004713	mce related protein; Region: MCE; pfam02470
529507004714	mce related protein; Region: MCE; pfam02470
529507004715	mce related protein; Region: MCE; pfam02470
529507004716	mce related protein; Region: MCE; pfam02470
529507004717	mce related protein; Region: MCE; pfam02470
529507004718	1 probable transmembrane helix predicted for PMI1012 by TMHMM2.0 at aa 21-43
529507004719	Uncharacterized paraquat-inducible protein A [Function unknown]; Region: PqiA; COG2995
529507004720	Paraquat-inducible protein A; Region: PqiA; pfam04403
529507004721	Paraquat-inducible protein A; Region: PqiA; pfam04403
529507004722	HMMPfam hit to PF04403, Paraquat-inducible protein A, score 1.1e-85
529507004723	8 probable transmembrane helices predicted for PMI1013 by TMHMM2.0 at aa 48-70, 101-123, 136-158, 168-190, 248-270, 295-317, 338-360 and 375-397
529507004724	HMMPfam hit to PF04403, Paraquat-inducible protein A, score 8.6e-61
529507004725	GAF domain-containing protein [Signal transduction mechanisms]; Region: COG1956
529507004726	GAF domain; Region: GAF_2; pfam13185
529507004727	PS01320 Uncharacterized protein family UPF0067 signature.
529507004728	ProP expression regulator; Provisional; Region: PRK04950
529507004729	ProQ/FINO family; Region: ProQ; pfam04352
529507004730	HMMPfam hit to PF04352, ProQ activator of osmoprotectant transporter, score 9.9e-78
529507004731	carboxy-terminal protease; Provisional; Region: PRK11186
529507004732	PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts. May be responsible for...; Region: PDZ_CTP_protease; cd00988
529507004733	protein binding site [polypeptide binding]; other site
529507004734	C-terminal processing peptidase; serine protease family S41; Region: Peptidase_S41_CPP; cd07560
529507004735	Catalytic dyad [active]
529507004736	C-terminal domain of tail specific protease (DUF3340); Region: DUF3340; pfam11818
529507004737	Signal peptide predicted for PMI1016 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.700 between residues 23 and 24
529507004738	HMMPfam hit to PF00595, PDZ domain (Also known as DHR or GLGF), score 2e-16
529507004739	HMMPfam hit to PF03572, Peptidase family S41, score 7.3e-66
529507004740	outer membrane porin, OprD family; Region: OprD; pfam03573
529507004741	Signal peptide predicted for PMI1017 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.770 between residues 23 and 24
529507004742	PS00095 C-5 cytosine-specific DNA methylases C-terminal signature.
529507004743	heat shock protein HtpX; Provisional; Region: PRK05457
529507004744	HMMPfam hit to PF06509, HtpX N-terminus, score 5.6e-48
529507004745	Signal peptide predicted for PMI1018 by SignalP 2.0 HMM (Signal peptide probability 0.925) with cleavage site probability 0.184 between residues 63 and 64
529507004746	4 probable transmembrane helices predicted for PMI1018 by TMHMM2.0 at aa 5-27, 32-54, 157-179 and 194-216
529507004747	HMMPfam hit to PF01435, Peptidase family M48, score 1.2e-43
529507004748	Predicted Na+/dicarboxylate symporter [General function prediction only]; Region: COG1823
529507004749	Na+/H+-dicarboxylate symporters [Energy production and conversion]; Region: GltP; COG1301
529507004750	HMMPfam hit to PF00375, Sodium:dicarboxylate symporter family, score 1.4e-110
529507004751	9 probable transmembrane helices predicted for PMI1019 by TMHMM2.0 at aa 5-22, 34-51, 71-93, 105-127, 179-201, 232-254, 264-286, 369-391 and 395-417
529507004752	Signal peptide predicted for PMI1019 by SignalP 2.0 HMM (Signal peptide probability 0.656) with cleavage site probability 0.234 between residues 25 and 26
529507004753	inner membrane protein; Provisional; Region: PRK11648
529507004754	3 probable transmembrane helices predicted for PMI1020 by TMHMM2.0 at aa 76-98, 108-130 and 150-172
529507004755	HMMPfam hit to PF04307, Predicted membrane-bound metal-dependent hyd, score 6.6e-27
529507004756	2-deoxyglucose-6-phosphatase; Provisional; Region: PRK10826
529507004757	Haloacid dehalogenase-like hydrolases. The haloacid dehalogenase-like (HAD) superfamily includes L-2-haloacid dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, and many others; Region: HAD_like; cd01427
529507004758	motif II; other site
529507004759	HMMPfam hit to PF00702, haloacid dehalogenase-like hydrolase, score 8.8e-34
529507004760	YniB-like protein; Region: YniB; pfam14002
529507004761	3 probable transmembrane helices predicted for PMI1022 by TMHMM2.0 at aa 24-46, 96-118 and 161-183
529507004762	Phosphotransferase enzyme family; Region: APH; pfam01636
529507004763	Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family. The APH/ChoK family is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs)...; Region: APH_ChoK_like; cd05120
529507004764	active site
529507004765	substrate binding site [chemical binding]; other site
529507004766	ATP binding site [chemical binding]; other site
529507004767	HMMPfam hit to PF03881, Fructosamine kinase, score 2.5e-139
529507004768	HMMPfam hit to PF01636, Phosphotransferase enzyme family, score 1.1e-18
529507004769	ABC-type Mn2+/Zn2+ transport systems, permease components [Inorganic ion transport and metabolism]; Region: ZnuB; COG1108
529507004770	Transmembrane subunit (TM), of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters involved in the uptake of siderophores, heme, vitamin B12, or the divalent cations Mg2+ and Zn2+. PBP-dependent ABC transporters consist of...; Region: TM_ABC_iron-siderophores_like; cd06550
529507004771	ABC-ATPase subunit  interface; other site
529507004772	dimer interface [polypeptide binding]; other site
529507004773	putative PBP binding regions; other site
529507004774	8 probable transmembrane helices predicted for PMI1024 by TMHMM2.0 at aa 21-40, 55-77, 97-116, 131-153, 170-192, 196-218, 225-244 and 254-271
529507004775	HMMPfam hit to PF00950, ABC 3 transport family, score 4.2e-127
529507004776	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507004777	ABC-type Mn2+/Zn2+ transport systems, permease components [Inorganic ion transport and metabolism]; Region: ZnuB; COG1108
529507004778	Transmembrane subunit (TM), of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters involved in the uptake of siderophores, heme, vitamin B12, or the divalent cations Mg2+ and Zn2+. PBP-dependent ABC transporters consist of...; Region: TM_ABC_iron-siderophores_like; cd06550
529507004779	ABC-ATPase subunit  interface; other site
529507004780	dimer interface [polypeptide binding]; other site
529507004781	putative PBP binding regions; other site
529507004782	7 probable transmembrane helices predicted for PMI1025 by TMHMM2.0 at aa 15-37, 58-80, 95-117, 138-160, 178-200, 221-243 and 248-267
529507004783	HMMPfam hit to PF00950, ABC 3 transport family, score 9.7e-127
529507004784	manganese/iron transporter ATP-binding protein; Provisional; Region: PRK15056
529507004785	ATP-binding cassette domain of the metal-type transporters; Region: ABC_Metallic_Cations; cd03235
529507004786	HMMPfam hit to PF00005, ABC transporter, score 2e-46
529507004787	PS00211 ABC transporters family signature.
529507004788	PS00017 ATP/GTP-binding site motif A (P-loop).
529507004789	ABC-type metal ion transport system, periplasmic component/surface adhesin [Inorganic ion transport and metabolism]; Region: LraI; COG0803
529507004790	Metal binding protein PsaA.  These proteins have been shown to function as initial receptors in ABC transport of Mn2+ and as surface adhesins in some eubacterial species.  They belong to the TroA superfamily of periplasmic metal binding proteins that...; Region: PsaA; cd01137
529507004791	metal binding site [ion binding]; metal-binding site
529507004792	HMMPfam hit to PF01297, Periplasmic solute binding protein family, score 2.4e-143
529507004793	Signal peptide predicted for PMI1027 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 1.000 between residues 29 and 30
529507004794	1 probable transmembrane helix predicted for PMI1027 by TMHMM2.0 at aa 7-29
529507004795	lytic murein endotransglycosylase E; Provisional; Region: emtA; PRK15470
529507004796	Lytic Transglycosylase (LT)  and Goose Egg White Lysozyme (GEWL) domain. Members include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as, the eukaryotic "goose-type" lysozymes (GEWL).  LTs...; Region: LT_GEWL; cd00254
529507004797	N-acetyl-D-glucosamine binding site [chemical binding]; other site
529507004798	catalytic residue [active]
529507004799	Signal peptide predicted for PMI1028 by SignalP 2.0 HMM (Signal peptide probability 0.952) with cleavage site probability 0.608 between residues 25 and 26
529507004800	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507004801	HMMPfam hit to PF01464, Transglycosylase SLT domain, score 3e-29
529507004802	PS00922 Prokaryotic transglycosylases signature.
529507004803	inner membrane protein; Provisional; Region: PRK10995
529507004804	5 probable transmembrane helices predicted for PMI1029 by TMHMM2.0 at aa 13-32, 37-59, 86-108, 118-140 and 161-183
529507004805	HMMPfam hit to PF01914, MarC family integral membrane protein, score 7.4e-49
529507004806	Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis]; Region: RimL; COG1670
529507004807	Acetyltransferase (GNAT) family; Region: Acetyltransf_1; pfam00583
529507004808	HMMPfam hit to PF00583, Acetyltransferase (GNAT) family, score 3.1e-06
529507004809	tRNA-binding-domain-containing CsaA-like proteins. CsaA is a molecular chaperone with export related activities. CsaA has a putative tRNA binding activity. The functional unit of CsaA is a homodimer and this domain acts as a dimerization domain; Region: tRNA_bind_CsaA; cd02798
529507004810	dimer interface [polypeptide binding]; other site
529507004811	putative tRNA-binding site [nucleotide binding]; other site
529507004812	HMMPfam hit to PF01588, tRNA binding domain, score 4.2e-17
529507004813	helix_turn_helix, arabinose operon control protein; Region: HTH_ARAC; smart00342
529507004814	Bacterial regulatory helix-turn-helix proteins, AraC family; Region: HTH_AraC; pfam00165
529507004815	HMMPfam hit to PF00165, Bacterial regulatory helix-turn-helix protei, score 0.00068
529507004816	Predicted helix-turn-helix motif with score 1618.000, SD 4.70 at aa 145-166, sequence LTASDIAGALNISISTLQRKVK
529507004817	HMMPfam hit to PF00165, Bacterial regulatory helix-turn-helix protei, score 8.2e-11
529507004818	Mannose binding  domain of FimH and related proteins; Region: FimH_man-bind; cd10466
529507004819	mannosyl binding site [chemical binding]; other site
529507004820	Fimbrial protein; Region: Fimbrial; pfam00419
529507004821	Signal peptide predicted for PMI1033 by SignalP 2.0 HMM (Signal peptide probability 0.908) with cleavage site probability 0.601 between residues 20 and 21
529507004822	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507004823	HMMPfam hit to PF00419, Fimbrial protein, score 0.0024
529507004824	threonyl-tRNA synthetase; Reviewed; Region: thrS; PRK00413
529507004825	TGS _ThrRS_N:  ThrRS (threonyl-tRNA Synthetase)  is a class II tRNA synthetase that couples threonine to its cognate tRNA.  In addition to its catalytic and anticodon-binding domains, ThrRS has an N-terminal TGS domain, named after the ThrRS, GTPase, and...; Region: TGS_ThrRS_N; cd01667
529507004826	Threonyl and Alanyl tRNA synthetase second additional domain; Region: tRNA_SAD; pfam07973
529507004827	Threonyl-tRNA synthetase (ThrRS) class II core catalytic domain. ThrRS is a homodimer. It is responsible for the attachment of threonine to the 3' OH group of ribose of the appropriate tRNA. This domain is primarily responsible for ATP-dependent...; Region: ThrRS_core; cd00771
529507004828	active site
529507004829	dimer interface [polypeptide binding]; other site
529507004830	motif 1; other site
529507004831	motif 2; other site
529507004832	motif 3; other site
529507004833	ThrRS Threonyl-anticodon binding domain. ThrRS belongs to class II aminoacyl-tRNA synthetases (aaRS). This alignment contains the anticodon binding domain, which is responsible for specificity in tRNA-binding, so that the activated amino acid is...; Region: ThrRS_anticodon; cd00860
529507004834	anticodon binding site; other site
529507004835	HMMPfam hit to PF02824, TGS domain, score 1.6e-11
529507004836	HMMPfam hit to PF00587, tRNA synthetase class II core domain (, score 3.8e-58
529507004837	PS00179 Aminoacyl-transfer RNA synthetases class-II signature 1.
529507004838	PS00339 Aminoacyl-transfer RNA synthetases class-II signature 2.
529507004839	HMMPfam hit to PF03129, Anticodon binding domain, score 7.1e-33
529507004840	translation initiation factor IF-3; Reviewed; Region: infC; PRK00028
529507004841	Translation initiation factor IF-3, N-terminal domain; Region: IF3_N; pfam05198
529507004842	Translation initiation factor IF-3, C-terminal domain; Region: IF3_C; pfam00707
529507004843	HMMPfam hit to PF00707, Translation initiation factor IF-3, C-termin, score 6.7e-55
529507004844	50S ribosomal protein L35; Reviewed; Region: rpmI; PRK00172
529507004845	HMMPfam hit to PF01632, Ribosomal protein L35, score 1.7e-32
529507004846	PS00936 Ribosomal protein L35 signature.
529507004847	Ribosomal protein L20; Region: Ribosomal_L20; cd07026
529507004848	23S rRNA binding site [nucleotide binding]; other site
529507004849	L21 binding site [polypeptide binding]; other site
529507004850	L13 binding site [polypeptide binding]; other site
529507004851	HMMPfam hit to PF00453, Ribosomal protein L20, score 6.2e-67
529507004852	PS00937 Ribosomal protein L20 signature.
529507004853	phenylalanyl-tRNA synthetase subunit alpha; Validated; Region: pheS; PRK00488
529507004854	Aminoacyl tRNA synthetase class II, N-terminal domain; Region: Phe_tRNA-synt_N; pfam02912
529507004855	Phenylalanyl-tRNA synthetase (PheRS) alpha chain catalytic core domain. PheRS belongs to class II aminoacyl-tRNA synthetases (aaRS) based upon its structure and the presence of three characteristic sequence motifs. This domain is primarily responsible...; Region: PheRS_alpha_core; cd00496
529507004856	dimer interface [polypeptide binding]; other site
529507004857	motif 1; other site
529507004858	active site
529507004859	motif 2; other site
529507004860	motif 3; other site
529507004861	HMMPfam hit to PF02912, Aminoacyl tRNA synthetase class II, N, score 5.8e-36
529507004862	HMMPfam hit to PF01409, tRNA synthetases class II core domain, score 7.5e-140
529507004863	PS00179 Aminoacyl-transfer RNA synthetases class-II signature 1.
529507004864	PS00339 Aminoacyl-transfer RNA synthetases class-II signature 2.
529507004865	phenylalanyl-tRNA synthetase subunit beta; Reviewed; Region: pheT; PRK00629
529507004866	tRNA-binding-domain-containing prokaryotic phenylalanly tRNA synthetase (PheRS) beta chain.  PheRS aminoacylate phenylalanine transfer RNAs (tRNAphe). PheRSs belong structurally to class II aminoacyl tRNA synthetases (aaRSs) but, as they aminoacylate...; Region: tRNA_bind_bactPheRS; cd02796
529507004867	putative tRNA-binding site [nucleotide binding]; other site
529507004868	B3/4 domain; Region: B3_4; pfam03483
529507004869	tRNA synthetase B5 domain; Region: B5; smart00874
529507004870	Phenylalanyl-tRNA synthetase (PheRS) beta chain core domain. PheRS belongs to class II aminoacyl-tRNA synthetases (aaRS) based upon its structure. While class II aaRSs generally aminoacylate the 3'-OH ribose of the appropriate tRNA,  PheRS is an...; Region: PheRS_beta_core; cd00769
529507004871	dimer interface [polypeptide binding]; other site
529507004872	motif 1; other site
529507004873	motif 3; other site
529507004874	motif 2; other site
529507004875	Ferredoxin-fold anticodon binding domain; Region: FDX-ACB; pfam03147
529507004876	HMMPfam hit to PF01588, tRNA binding domain, score 5.1e-43
529507004877	HMMPfam hit to PF03483, B3/4 domain, score 1.2e-104
529507004878	HMMPfam hit to PF03484, tRNA synthetase B5 domain, score 4.8e-34
529507004879	HMMPfam hit to PF03147, Ferredoxin-fold anticodon binding domain, score 3.9e-43
529507004880	Integration host factor (IHF) and HU are small heterodimeric members of the DNABII protein family that bind and bend DNA, functioning as architectural factors in many cellular processes including transcription, site-specific recombination, and...; Region: HU_IHF; cd00591
529507004881	IHF dimer interface [polypeptide binding]; other site
529507004882	IHF - DNA interface [nucleotide binding]; other site
529507004883	HMMPfam hit to PF00216, Bacterial DNA-binding protein, score 3.3e-45
529507004884	PS00045 Bacterial histone-like DNA-binding proteins signature.
529507004885	iron-hydroxamate transporter permease subunit; Provisional; Region: PRK10577
529507004886	Transmembrane subunit (TM), of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters involved in the uptake of siderophores, heme, vitamin B12, or the divalent cations Mg2+ and Zn2+. PBP-dependent ABC transporters consist of...; Region: TM_ABC_iron-siderophores_like; cd06550
529507004887	ABC-ATPase subunit  interface; other site
529507004888	dimer interface [polypeptide binding]; other site
529507004889	putative PBP binding regions; other site
529507004890	9 probable transmembrane helices predicted for PMI1041 by TMHMM2.0 at aa 32-54, 74-96, 100-122, 127-149, 159-181, 207-229, 249-271, 283-305 and 315-337
529507004891	HMMPfam hit to PF01032, FecCD transport family, score 3.1e-94
529507004892	vitamin B12-transporter ATPase; Provisional; Region: PRK03695
529507004893	ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins; Region: ABC_Iron-Siderophores_B12_Hemin; cd03214
529507004894	Walker A/P-loop; other site
529507004895	ATP binding site [chemical binding]; other site
529507004896	Q-loop/lid; other site
529507004897	ABC transporter signature motif; other site
529507004898	Walker B; other site
529507004899	D-loop; other site
529507004900	H-loop/switch region; other site
529507004901	HMMPfam hit to PF00005, ABC transporter, score 7.5e-36
529507004902	PS00017 ATP/GTP-binding site motif A (P-loop).
529507004903	PS00211 ABC transporters family signature.
529507004904	Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane]; Region: WecE; COG0399
529507004905	3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn). AHBA_syn family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The members of this CD are involved in various biosynthetic pathways for secondary...; Region: AHBA_syn; cd00616
529507004906	inhibitor-cofactor binding pocket; inhibition site
529507004907	pyridoxal 5'-phosphate binding site [chemical binding]; other site
529507004908	catalytic residue [active]
529507004909	HMMPfam hit to PF01041, DegT/DnrJ/EryC1/StrS aminotransferase, score 5.9e-170
529507004910	undecaprenyl phosphate 4-deoxy-4-formamido-L-arabinose transferase; Provisional; Region: PRK10714
529507004911	Bacterial DPM1_like enzymes are related to eukaryotic DPM1; Region: DPM1_like_bac; cd04187
529507004912	Ligand binding site; other site
529507004913	Putative Catalytic site; other site
529507004914	DXD motif; other site
529507004915	HMMPfam hit to PF00535, Glycosyl transferase, score 1.6e-37
529507004916	2 probable transmembrane helices predicted for PMI1044 by TMHMM2.0 at aa 238-260 and 270-292
529507004917	bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated; Region: PRK08125
529507004918	Formyltransferase, catalytic core domain; Region: FMT_core; cl00395
529507004919	active site
529507004920	substrate binding site [chemical binding]; other site
529507004921	cosubstrate binding site; other site
529507004922	catalytic site [active]
529507004923	C-terminal subdomain of the formyltransferase domain on ArnA, which modifies lipid A with 4-amino-4-deoxy-l-arabinose; Region: Arna_FMT_C; cd08702
529507004924	active site
529507004925	hexamer interface [polypeptide binding]; other site
529507004926	Arna decarboxylase_like, extended (e) SDRs; Region: Arna_like_SDR_e; cd05257
529507004927	NAD binding site [chemical binding]; other site
529507004928	substrate binding site [chemical binding]; other site
529507004929	active site
529507004930	HMMPfam hit to PF00551, Formyl transferase, score 4.7e-19
529507004931	HMMPfam hit to PF02911, Formyl transferase, C-terminal domain, score 2.8e-24
529507004932	4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD; Provisional; Region: PRK15394
529507004933	Catalytic domain of Escherichia coli 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD and other bacterial homologs; Region: CE4_ArnD; cd10939
529507004934	putative active site [active]
529507004935	putative catalytic site [active]
529507004936	putative Zn binding site [ion binding]; other site
529507004937	HMMPfam hit to PF01522, Polysaccharide deacetylase, score 2e-05
529507004938	4-amino-4-deoxy-L-arabinose transferase; Provisional; Region: arnT; PRK13279
529507004939	4-amino-4-deoxy-L-arabinose transferase and related glycosyltransferases of PMT family [Cell envelope biogenesis, outer membrane]; Region: ArnT; COG1807
529507004940	Signal peptide predicted for PMI1047 by SignalP 2.0 HMM (Signal peptide probability 0.907) with cleavage site probability 0.409 between residues 28 and 29
529507004941	HMMPfam hit to PF02366, Dolichyl-phosphate-mannose-protein mannosylt, score 1.1e-47
529507004942	10 probable transmembrane helices predicted for PMI1047 by TMHMM2.0 at aa 9-26, 84-106, 115-137, 166-188, 209-231, 261-283, 296-313, 318-337, 350-372 and 387-406
529507004943	4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; Provisional; Region: PRK15051
529507004944	Signal peptide predicted for PMI1048 by SignalP 2.0 HMM (Signal peptide probability 0.929) with cleavage site probability 0.417 between residues 21 and 22
529507004945	4 probable transmembrane helices predicted for PMI1048 by TMHMM2.0 at aa 4-26, 38-60, 65-87 and 94-111
529507004946	4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; Provisional; Region: PRK02971
529507004947	Signal peptide predicted for PMI1049 by SignalP 2.0 HMM (Signal peptide probability 0.805) with cleavage site probability 0.607 between residues 18 and 19
529507004948	4 probable transmembrane helices predicted for PMI1049 by TMHMM2.0 at aa 5-22, 48-70, 83-101 and 105-124
529507004949	Bacterial chaperone lipoprotein (PulS_OutS); Region: PulS_OutS; cl09898
529507004950	NlpC/P60 family; Region: NLPC_P60; pfam00877
529507004951	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507004952	HMMPfam hit to PF00877, NlpC/P60 family, score 9.6e-50
529507004953	lipoate-protein ligase A; Provisional; Region: lplA; PRK03822
529507004954	Lipoate-protein ligase A [Coenzyme metabolism]; Region: LplA; COG0095
529507004955	Bacterial lipoate protein ligase C-terminus; Region: Lip_prot_lig_C; pfam10437
529507004956	HMMPfam hit to PF03099, Biotin/lipoate A/B protein ligase famil, score 4.6e-30
529507004957	helix_turn_helix, arabinose operon control protein; Region: HTH_ARAC; smart00342
529507004958	Bacterial regulatory helix-turn-helix proteins, AraC family; Region: HTH_AraC; pfam00165
529507004959	HMMPfam hit to PF00165, Bacterial regulatory helix-turn-helix protei, score 4.5e-12
529507004960	PS00041 Bacterial regulatory proteins, araC family signature.
529507004961	HMMPfam hit to PF00165, Bacterial regulatory helix-turn-helix protei, score 1.4e-06
529507004962	Predicted helix-turn-helix motif with score 990.000, SD 2.56 at aa 23-44, sequence IKIDTIANKSGYSKWHLQRIFK
529507004963	hydroxyglutarate oxidase; Provisional; Region: PRK11728
529507004964	Predicted dehydrogenase [General function prediction only]; Region: COG0579
529507004965	HMMPfam hit to PF01266, FAD dependent oxidoreductase, score 4e-65
529507004966	Signal peptide predicted for PMI1053 by SignalP 2.0 HMM (Signal peptide probability 0.617) with cleavage site probability 0.405 between residues 26 and 27
529507004967	Transcriptional regulators [Transcription]; Region: FadR; COG2186
529507004968	Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators; Region: WHTH_GntR; cd07377
529507004969	DNA-binding site [nucleotide binding]; DNA binding site
529507004970	FCD domain; Region: FCD; pfam07729
529507004971	HMMPfam hit to PF07729, FCD domain, score 1.9e-29
529507004972	HMMPfam hit to PF00392, Bacterial regulatory proteins, gntR family, score 7e-22
529507004973	PS00043 Bacterial regulatory proteins, gntR family signature.
529507004974	TRAP transporter, 4TM/12TM fusion protein; Region: TRAP_fused; TIGR02123
529507004975	DctM-like transporters; Region: DctM; pfam06808
529507004976	16 probable transmembrane helices predicted for PMI1055 by TMHMM2.0 at aa 26-48, 60-77, 92-114, 145-167, 187-209, 284-306, 310-332, 358-375, 380-397, 425-447, 457-476, 481-503, 507-529, 542-564, 574-596 and 608-630
529507004977	PS00017 ATP/GTP-binding site motif A (P-loop).
529507004978	HMMPfam hit to PF06808, TRAP C4-dicarboxylate transport (Dct) system, score 3.3e-32
529507004979	TRAP transporter solute receptor, TAXI family; Region: TRAP_TAXI; TIGR02122
529507004980	TRAP-type uncharacterized transport system, periplasmic component [General function prediction only]; Region: Imp; COG2358
529507004981	1 probable transmembrane helix predicted for PMI1056 by TMHMM2.0 at aa 12-31
529507004982	Signal peptide predicted for PMI1056 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.970 between residues 22 and 23
529507004983	Uncharacterized membrane-associated protein [Function unknown]; Region: DedA; COG0586
529507004984	HMMPfam hit to PF00597, DedA family, score 6e-05
529507004985	5 probable transmembrane helices predicted for PMI1057 by TMHMM2.0 at aa 10-29, 34-56, 60-82, 113-130 and 140-162
529507004986	acetolactate synthase; Reviewed; Region: PRK08617
529507004987	Pyrimidine (PYR) binding domain of POX and related proteins; Region: TPP_PYR_POX_like; cd07035
529507004988	PYR/PP interface [polypeptide binding]; other site
529507004989	dimer interface [polypeptide binding]; other site
529507004990	TPP binding site [chemical binding]; other site
529507004991	Thiamine pyrophosphate enzyme, central domain; Region: TPP_enzyme_M; pfam00205
529507004992	Thiamine pyrophosphate (TPP) family, Acetolactate synthase (ALS) subfamily, TPP-binding module; composed of proteins similar to Klebsiella pneumoniae ALS, a catabolic enzyme required for butanediol fermentation. ALS catalyzes the conversion of 2...; Region: TPP_ALS; cd02010
529507004993	TPP-binding site [chemical binding]; other site
529507004994	dimer interface [polypeptide binding]; other site
529507004995	PS00187 Thiamine pyrophosphate enzymes signature.
529507004996	HMMPfam hit to PF00205, Thiamine pyrophosphate enzyme, central d, score 4.3e-34
529507004997	HMMPfam hit to PF02776, Thiamine pyrophosphate enzyme, N-termina, score 1.3e-65
529507004998	Alpha-acetolactate decarboxylase; Region: AAL_decarboxy; pfam03306
529507004999	HMMPfam hit to PF03306, Alpha-acetolactate decarboxylase, score 1e-112
529507005000	fimbrial operon 5
529507005001	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
529507005002	non-specific DNA binding site [nucleotide binding]; other site
529507005003	salt bridge; other site
529507005004	sequence-specific DNA binding site [nucleotide binding]; other site
529507005005	HMMPfam hit to PF01381, Helix-turn-helix, score 5.8e-14
529507005006	Predicted helix-turn-helix motif with score 2317.000, SD 7.08 at aa 36-57, sequence LTGQDLAIILNVSQQQISRYEN
529507005007	fimbrial protein PefA; Provisional; Region: PRK15214
529507005008	Signal peptide predicted for PMI1061 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.998 between residues 21 and 22
529507005009	HMMPfam hit to PF00419, Fimbrial protein, score 0.00095
529507005010	fimbrial outer membrane usher protein PefC; Provisional; Region: PRK15213
529507005011	PapC N-terminal domain; Region: PapC_N; pfam13954
529507005012	Type VII secretion system (T7SS), usher protein; Region: Usher; pfam00577
529507005013	PapC C-terminal domain; Region: PapC_C; pfam13953
529507005014	Signal peptide predicted for PMI1062 by SignalP 2.0 HMM (Signal peptide probability 0.976) with cleavage site probability 0.776 between residues 22 and 23
529507005015	HMMPfam hit to PF00577, Fimbrial Usher protein, score 2.1e-168
529507005016	PS00017 ATP/GTP-binding site motif A (P-loop).
529507005017	fimbrial chaperone protein PefD; Provisional; Region: PRK15211
529507005018	Gram-negative pili assembly chaperone, N-terminal domain; Region: Pili_assembly_N; pfam00345
529507005019	Gram-negative pili assembly chaperone, C-terminal domain; Region: Pili_assembly_C; pfam02753
529507005020	Signal peptide predicted for PMI1063 by SignalP 2.0 HMM (Signal peptide probability 0.997) with cleavage site probability 0.890 between residues 22 and 23
529507005021	1 probable transmembrane helix predicted for PMI1063 by TMHMM2.0 at aa 5-27
529507005022	HMMPfam hit to PF00345, Gram-negative pili assembly chaperone, score 3.8e-42
529507005023	PS00635 Gram-negative pili assembly chaperone signature.
529507005024	HMMPfam hit to PF02753, Gram-negative pili assembly chaperone, score 5.3e-09
529507005025	Fimbrial protein; Region: Fimbrial; pfam00419
529507005026	Fimbrial protein; Region: Fimbrial; pfam00419
529507005027	Signal peptide predicted for PMI1065 by SignalP 2.0 HMM (Signal peptide probability 0.936) with cleavage site probability 0.491 between residues 24 and 25
529507005028	1 probable transmembrane helix predicted for PMI1065 by TMHMM2.0 at aa 13-35
529507005029	Signal peptide predicted for PMI1066 by SignalP 2.0 HMM (Signal peptide probability 0.985) with cleavage site probability 0.959 between residues 20 and 21
529507005030	PS00178 Aminoacyl-transfer RNA synthetases class-I signature.
529507005031	Fimbrial protein; Region: Fimbrial; pfam00419
529507005032	Signal peptide predicted for PMI1067 by SignalP 2.0 HMM (Signal peptide probability 0.827) with cleavage site probability 0.826 between residues 27 and 28
529507005033	Rhs-family protein (fragment)
529507005034	Rhs-family protein (pseudogene)
529507005035	HMMPfam hit to PF01541, GIY-YIG catalytic domain, score 0.01
529507005036	HMMPfam hit to PF05593, RHS Repeat, score 0.03
529507005037	HMMPfam hit to PF05593, RHS Repeat, score 5.3
529507005038	HMMPfam hit to PF05593, RHS Repeat, score 4.7
529507005039	HMMPfam hit to PF05593, RHS Repeat, score 0.044
529507005040	HMMPfam hit to PF05593, RHS Repeat, score 0.86
529507005041	HMMPfam hit to PF05593, RHS Repeat, score 0.00039
529507005042	HMMPfam hit to PF05593, RHS Repeat, score 0.00066
529507005043	HMMPfam hit to PF05593, RHS Repeat, score 0.0063
529507005044	HMMPfam hit to PF05593, RHS Repeat, score 0.053
529507005045	HMMPfam hit to PF05593, RHS Repeat, score 0.3
529507005046	HMMPfam hit to PF05593, RHS Repeat, score 0.0016
529507005047	HMMPfam hit to PF05488, PAAR motif, score 8e-06
529507005048	HMMPfam hit to PF05488, PAAR motif, score 0.23
529507005049	2 probable transmembrane helices predicted for PMI1078 by TMHMM2.0 at aa 35-57 and 62-84
529507005050	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507005051	HMMPfam hit to PF05488, PAAR motif, score 13
529507005052	Domain of unknown function (DUF1795); Region: DUF1795; pfam08786
529507005053	GTP-binding protein YchF; Reviewed; Region: PRK09601
529507005054	YchF GTPase; Region: YchF; cd01900
529507005055	G1 box; other site
529507005056	GTP/Mg2+ binding site [chemical binding]; other site
529507005057	Switch I region; other site
529507005058	G2 box; other site
529507005059	Switch II region; other site
529507005060	G3 box; other site
529507005061	G4 box; other site
529507005062	G5 box; other site
529507005063	TGS_YchF_C: This subfamily represents TGS domain-containing YchF GTP-binding protein, a universally conserved GTPase whose function is unknown. The N-terminal domain of the YchF protein belongs to the Obg-like family of GTPases, and some members of the...; Region: TGS_YchF_C; cd04867
529507005064	HMMPfam hit to PF06071, Protein of unknown function (DUF933), score 9.1e-62
529507005065	HMMPfam hit to PF01926, GTPase of unknown function, score 6.2e-32
529507005066	PS00017 ATP/GTP-binding site motif A (P-loop).
529507005067	PS00443 Glutamine amidotransferases class-II active site.
529507005068	Peptidyl-tRNA hydrolase (PTH) is a monomeric protein that cleaves the ester bond linking the nascent peptide and tRNA when peptidyl-tRNA is released prematurely from the ribosome. This ensures the recycling of peptidyl-tRNAs into tRNAs produced through...; Region: PTH; cd00462
529507005069	putative active site [active]
529507005070	catalytic residue [active]
529507005071	HMMPfam hit to PF01195, Peptidyl-tRNA hydrolase, score 6.9e-98
529507005072	PS01196 Peptidyl-tRNA hydrolase signature 2.
529507005073	Signal peptide predicted for PMI1081 by SignalP 2.0 HMM (Signal peptide probability 0.735) with cleavage site probability 0.721 between residues 18 and 19
529507005074	hypothetical protein; Provisional; Region: PRK10692
529507005075	Signal peptide predicted for PMI1082 by SignalP 2.0 HMM (Signal peptide probability 0.926) with cleavage site probability 0.809 between residues 26 and 27
529507005076	2 probable transmembrane helices predicted for PMI1082 by TMHMM2.0 at aa 7-26 and 41-63
529507005077	ribose-phosphate pyrophosphokinase; Provisional; Region: PRK01259
529507005078	N-terminal domain of ribose phosphate pyrophosphokinase; Region: Pribosyltran_N; pfam13793
529507005079	Phosphoribosyl transferase (PRT)-type I domain; Region: PRTases_typeI; cd06223
529507005080	active site
529507005081	HMMPfam hit to PF00156, Phosphoribosyl transferase domain, score 4.7e-37
529507005082	PS00103 Purine/pyrimidine phosphoribosyl transferases signature.
529507005083	PS00114 Phosphoribosyl pyrophosphate synthetase signature.
529507005084	4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional; Region: ipk; PRK00343
529507005085	GHMP kinases N terminal domain; Region: GHMP_kinases_N; pfam00288
529507005086	GHMP kinases C terminal; Region: GHMP_kinases_C; pfam08544
529507005087	HMMPfam hit to PF00288, GHMP kinases ATP-binding protei, score 7.7e-31
529507005088	outer membrane lipoprotein LolB; Provisional; Region: lolB; PRK00022
529507005089	Outer membrane lipoprotein LolB; Region: LolB; pfam03550
529507005090	HMMPfam hit to PF03550, Outer membrane lipoprotein LolB, score 9.1e-54
529507005091	Signal peptide predicted for PMI1085 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.271 between residues 29 and 30
529507005092	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507005093	PS00589 PTS HPR component serine phosphorylation site signature.
529507005094	glutamyl-tRNA reductase; Reviewed; Region: hemA; PRK00045
529507005095	NADP-binding domain of glutamyl-tRNA reductase; Region: NAD_bind_Glutamyl_tRNA_reduct; cd05213
529507005096	tRNA; other site
529507005097	putative tRNA binding site [nucleotide binding]; other site
529507005098	putative NADP binding site [chemical binding]; other site
529507005099	Glutamyl-tRNAGlu reductase, dimerisation domain; Region: GlutR_dimer; pfam00745
529507005100	HMMPfam hit to PF05201, Glutamyl-tRNAGlu reductase, N-terminal, score 1.6e-85
529507005101	PS00747 Glutamyl-tRNA reductase signature.
529507005102	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507005103	HMMPfam hit to PF05200, Glutamyl-tRNAGlu reductase, NAD(P) bin, score 3.1e-84
529507005104	HMMPfam hit to PF00745, Glutamyl-tRNAGlu reductase, dimerisati, score 1.7e-27
529507005105	peptide chain release factor 1; Validated; Region: prfA; PRK00591
529507005106	This domain is found in peptide chain release factors; Region: PCRF; smart00937
529507005107	RF-1 domain; Region: RF-1; pfam00472
529507005108	HMMPfam hit to PF03462, PCRF domain, score 8.7e-70
529507005109	HMMPfam hit to PF00472, Peptidyl-tRNA hydrolase domain, score 2.1e-74
529507005110	PS00745 Prokaryotic-type class I peptide chain release factors signature.
529507005111	N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional; Region: PRK09328
529507005112	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
529507005113	PS00092 N-6 Adenine-specific DNA methylases signature.
529507005114	hypothetical protein; Provisional; Region: PRK10941
529507005115	Transglutaminase-like superfamily; Region: Transglut_core2; pfam13369
529507005116	PS00030 Eukaryotic RNA-binding region RNP-1 signature.
529507005117	DAHP synthetase I family; Region: DAHP_synth_1; pfam00793
529507005118	2-dehydro-3-deoxyphosphooctonate aldolase; Provisional; Region: PRK05198
529507005119	HMMPfam hit to PF00793, DAHP synthetase I family, score 2.3e-116
529507005120	radical SAM protein, TIGR01212 family; Region: TIGR01212
529507005121	Radical SAM superfamily. Enzymes of this family generate radicals by combining a 4Fe-4S cluster and S-adenosylmethionine (SAM) in close proximity. They are characterized by a conserved CxxxCxxC motif, which coordinates the conserved iron-sulfur cluster; Region: Radical_SAM; cd01335
529507005122	FeS/SAM binding site; other site
529507005123	HMMPfam hit to PF04055, Radical SAM superfamily, score 1.6e-12
529507005124	Protein of unknown function (DUF1778); Region: DUF1778; pfam08681
529507005125	putative transporter; Provisional; Region: PRK11660
529507005126	Sulfate transporter N-terminal domain with GLY motif; Region: Sulfate_tra_GLY; pfam13792
529507005127	Sulfate transporter family; Region: Sulfate_transp; pfam00916
529507005128	Sulphate Transporter and Anti-Sigma factor antagonist domain of SulP-like sulfate transporters, plays a role in the function and regulation of the transport activity, proposed general NTP binding function; Region: STAS_SulP_like_sulfate_transporter; cd07042
529507005129	HMMPfam hit to PF01740, STAS domain, score 1.2e-12
529507005130	HMMPfam hit to PF00916, Sulfate transporter family, score 2.9e-92
529507005131	10 probable transmembrane helices predicted for PMI1093 by TMHMM2.0 at aa 33-55, 60-82, 102-124, 128-150, 171-193, 208-227, 279-301, 316-338, 359-390 and 410-441
529507005132	PS01130 Sulfate transporters signature.
529507005133	bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional; Region: ghrA; PRK15469
529507005134	Putative glycerate dehydrogenase and related proteins of the D-specific 2-hydroxy dehydrogenase family; Region: GDH_like_2; cd12164
529507005135	putative ligand binding site [chemical binding]; other site
529507005136	NAD binding site [chemical binding]; other site
529507005137	dimerization interface [polypeptide binding]; other site
529507005138	catalytic site [active]
529507005139	HMMPfam hit to PF02826, D-isomer specific 2-hydroxyacid dehydrog, score 8.3e-14
529507005140	PS00065 D-isomer specific 2-hydroxyacid dehydrogenases NAD-binding signature.
529507005141	PS00671 D-isomer specific 2-hydroxyacid dehydrogenases signature 3.
529507005142	Prolyl 4-hydroxylase alpha subunit homologues; Region: P4Hc; smart00702
529507005143	PS00338 Somatotropin, prolactin and related hormones signature 2.
529507005144	HMMPfam hit to PF03171, 2OG-Fe(II) oxygenase superfamily, score 5.7e-10
529507005145	Uncharacterized component of anaerobic dehydrogenases [General function prediction only]; Region: TorD; COG3381
529507005146	HMMPfam hit to PF06192, Cytoplasmic chaperone TorD, score 4.4e-17
529507005147	lipoprotein; Provisional; Region: PRK10598
529507005148	HMMPfam hit to PF07273, Protein of unknown function (DUF1439), score 4.2e-60
529507005149	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507005150	Signal peptide predicted for PMI1098 by SignalP 2.0 HMM (Signal peptide probability 0.966) with cleavage site probability 0.963 between residues 18 and 19
529507005151	multidrug resistance protein MdtH; Provisional; Region: PRK11646
529507005152	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507005153	putative substrate translocation pore; other site
529507005154	10 probable transmembrane helices predicted for PMI1099 by TMHMM2.0 at aa 13-35, 99-116, 136-158, 163-185, 213-235, 245-264, 276-293, 297-314, 335-357 and 367-384
529507005155	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 3.1e-47
529507005156	ribosomal-protein-S5-alanine N-acetyltransferase; Provisional; Region: PRK10809
529507005157	Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis]; Region: RimL; COG1670
529507005158	PS00050 Ribosomal protein L23 signature.
529507005159	HMMPfam hit to PF00583, Acetyltransferase (GNAT) family, score 2.8e-12
529507005160	Uncharacterized membrane protein, putative virulence factor [General function prediction only]; Region: MviN; COG0728
529507005161	MurJ/MviN, a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins; Region: MATE_MurJ_like; cd13123
529507005162	Signal peptide predicted for PMI1101 by SignalP 2.0 HMM (Signal peptide probability 0.810) with cleavage site probability 0.445 between residues 21 and 22
529507005163	13 probable transmembrane helices predicted for PMI1101 by TMHMM2.0 at aa 26-45, 91-113, 133-152, 159-181, 186-203, 237-259, 274-296, 316-338, 353-375, 382-404, 408-430, 443-465 and 478-500
529507005164	HMMPfam hit to PF03023, MviN-like protein, score 1.5e-195
529507005165	PS00225 Crystallins beta and gamma 'Greek key' motif signature.
529507005166	Signal peptide predicted for PMI1102 by SignalP 2.0 HMM (Signal peptide probability 0.998) with cleavage site probability 0.805 between residues 21 and 22
529507005167	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507005168	Arginyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]; Region: ArgS; COG0018
529507005169	Arginyl tRNA synthetase N terminal dom; Region: Arg_tRNA_synt_N; smart01016
529507005170	catalytic core domain of arginyl-tRNA synthetases; Region: ArgRS_core; cd00671
529507005171	active site
529507005172	HIGH motif; other site
529507005173	KMSK motif region; other site
529507005174	Anticodon-binding domain of arginyl tRNA synthetases; Region: Anticodon_Ia_Arg; cd07956
529507005175	tRNA binding surface [nucleotide binding]; other site
529507005176	anticodon binding site; other site
529507005177	HMMPfam hit to PF05746, DALR anticodon binding domain, score 3.8e-52
529507005178	HMMPfam hit to PF00750, tRNA synthetases class I (R), score 2.5e-193
529507005179	PS00178 Aminoacyl-transfer RNA synthetases class-I signature.
529507005180	HMMPfam hit to PF03485, Arginyl tRNA synthetase N terminal do, score 2.8e-29
529507005181	This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases; Region: Glo_EDI_BRP_like_4; cd07268
529507005182	putative metal binding site [ion binding]; other site
529507005183	HMMPfam hit to PF06185, Protein of unknown function (DUF991), score 7e-79
529507005184	copper homeostasis protein CutC; Provisional; Region: PRK11572
529507005185	HMMPfam hit to PF03932, CutC family, score 4.9e-94
529507005186	Signal peptide predicted for PMI1106 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.989 between residues 20 and 21
529507005187	ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only]; Region: Uup; COG0488
529507005188	ATP-binding cassette domain of elongation factor 3, subfamily F; Region: ABCF_EF-3; cd03221
529507005189	ABC transporter; Region: ABC_tran_2; pfam12848
529507005190	ATP-binding cassette domain of elongation factor 3, subfamily F; Region: ABCF_EF-3; cd03221
529507005191	HMMPfam hit to PF00005, ABC transporter, score 7.7e-24
529507005192	PS00017 ATP/GTP-binding site motif A (P-loop).
529507005193	HMMPfam hit to PF00005, ABC transporter, score 6.5e-23
529507005194	PS00211 ABC transporters family signature.
529507005195	PS00017 ATP/GTP-binding site motif A (P-loop).
529507005196	Methyltransferase domain; Region: Methyltransf_23; pfam13489
529507005197	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
529507005198	S-adenosylmethionine binding site [chemical binding]; other site
529507005199	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
529507005200	S-adenosylmethionine binding site [chemical binding]; other site
529507005201	Uncharacterized relative of glutathione S-transferase, MAPEG superfamily [General function prediction only]; Region: COG3788
529507005202	4 probable transmembrane helices predicted for PMI1110 by TMHMM2.0 at aa 5-22, 43-65, 70-92 and 105-127
529507005203	aspartyl-tRNA synthetase; Validated; Region: aspS; PRK00476
529507005204	EcAspRS_like_N: N-terminal, anticodon recognition domain of the type found in Escherichia coli aspartyl-tRNA synthetase (AspRS), the human mitochondrial (mt) AspRS-2, the discriminating (D) Thermus thermophilus AspRS-1, and the nondiscriminating (ND)...; Region: EcAspRS_like_N; cd04317
529507005205	dimer interface [polypeptide binding]; other site
529507005206	anticodon binding site; other site
529507005207	Asp tRNA synthetase (aspRS) class II core domain. Class II assignment is based upon its structure and the presence of three characteristic sequence motifs. AspRS is a homodimer, which attaches a specific amino acid to the 3' OH group of ribose of...; Region: AspRS_core; cd00777
529507005208	homodimer interface [polypeptide binding]; other site
529507005209	motif 1; other site
529507005210	active site
529507005211	motif 2; other site
529507005212	GAD domain; Region: GAD; pfam02938
529507005213	Class II tRNA amino-acyl synthetase-like catalytic core domain. Class II amino acyl-tRNA synthetases (aaRS) share a common fold and generally attach an amino acid to the 3' OH of ribose of the appropriate tRNA.   PheRS is an exception in that it...; Region: class_II_aaRS-like_core; cl00268
529507005214	active site
529507005215	motif 3; other site
529507005216	HMMPfam hit to PF01336, OB-fold nucleic acid binding domain, score 5.8e-29
529507005217	HMMPfam hit to PF00152, tRNA synthetases class II (D, K and N), score 1.4e-14
529507005218	PS00179 Aminoacyl-transfer RNA synthetases class-II signature 1.
529507005219	HMMPfam hit to PF02938, GAD domain, score 1.9e-40
529507005220	PS00339 Aminoacyl-transfer RNA synthetases class-II signature 2.
529507005221	Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly...; Region: Nudix_Hydrolase_7; cd04664
529507005222	nudix motif; other site
529507005223	HMMPfam hit to PF00293, NUDIX domain, score 7.5e-22
529507005224	PS00893 mutT domain signature.
529507005225	hypothetical protein; Validated; Region: PRK00110
529507005226	HMMPfam hit to PF01709, Domain of unknown function DUF28, score 2e-153
529507005227	Holliday junction resolvases (HJRs) are endonucleases that specifically resolve Holliday junction DNA intermediates during homologous recombination. HJR's occur in archaea, bacteria, and in the mitochondria of certain fungi, however this CD...; Region: RuvC_resolvase; cd00529
529507005228	active site
529507005229	putative DNA-binding cleft [nucleotide binding]; other site
529507005230	dimer interface [polypeptide binding]; other site
529507005231	HMMPfam hit to PF02075, Crossover junction endodeoxyribonuclease Ruv, score 1.8e-92
529507005232	PS01321 Crossover junction endodeoxyribonuclease ruvC signature.
529507005233	Holliday junction DNA helicase RuvA; Reviewed; Region: ruvA; PRK00116
529507005234	RuvA N terminal domain; Region: RuvA_N; pfam01330
529507005235	RuvA, C-terminal domain; Region: RuvA_C; pfam07499
529507005236	HMMPfam hit to PF01330, RuvA N terminal domain, score 1.1e-27
529507005237	HMMPfam hit to PF00633, Helix-hairpin-helix motif, score 0.053
529507005238	HMMPfam hit to PF00633, Helix-hairpin-helix motif, score 0.013
529507005239	HMMPfam hit to PF07499, RuvA, C-terminal domain, score 1.2e-15
529507005240	Holliday junction DNA helicase RuvB; Reviewed; Region: ruvB; PRK00080
529507005241	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
529507005242	Walker A motif; other site
529507005243	ATP binding site [chemical binding]; other site
529507005244	Walker B motif; other site
529507005245	arginine finger; other site
529507005246	Holliday junction DNA helicase ruvB C-terminus; Region: RuvB_C; pfam05491
529507005247	HMMPfam hit to PF05496, Holliday junction DNA helicase ruvB N-termin, score 1.4e-26
529507005248	HMMPfam hit to PF00004, ATPase family associated with various cellul, score 2e-32
529507005249	PS00017 ATP/GTP-binding site motif A (P-loop).
529507005250	HMMPfam hit to PF05491, Holliday junction DNA helicase ruvB C-termin, score 4.6e-54
529507005251	type VI secretion system effector, Hcp1 family; Region: VI_effect_Hcp1; TIGR03344
529507005252	HMMPfam hit to PF05638, Protein of unknown function (DUF796), score 1.2e-87
529507005253	type VI secretion system Vgr family protein; Region: VI_Rhs_Vgr; TIGR03361
529507005254	Phage late control gene D protein (GPD); Region: Phage_GPD; pfam05954
529507005255	Phage-related baseplate assembly protein; Region: Phage_base_V; pfam04717
529507005256	HMMPfam hit to PF04524, Protein of unknown function, DUF586, score 1.8e-39
529507005257	Uncharacterized protein conserved in bacteria (DUF2169); Region: DUF2169; pfam09937
529507005258	Domain of unknown function (DUF4150); Region: DUF4150; pfam13665
529507005259	Rhs family protein [Cell envelope biogenesis, outer membrane]; Region: RhsA; COG3209
529507005260	RHS Repeat; Region: RHS_repeat; pfam05593
529507005261	RHS Repeat; Region: RHS_repeat; pfam05593
529507005262	RHS Repeat; Region: RHS_repeat; cl11982
529507005263	RHS Repeat; Region: RHS_repeat; pfam05593
529507005264	RHS repeat-associated core domain; Region: Rhs_assc_core; TIGR03696
529507005265	Bacterial EndoU nuclease; Region: EndoU_bacteria; pfam14436
529507005266	PS00017 ATP/GTP-binding site motif A (P-loop).
529507005267	HMMPfam hit to PF05593, RHS Repeat, score 1.4
529507005268	HMMPfam hit to PF05593, RHS Repeat, score 9.2
529507005269	HMMPfam hit to PF05593, RHS Repeat, score 3
529507005270	HMMPfam hit to PF05593, RHS Repeat, score 0.00012
529507005271	HMMPfam hit to PF05593, RHS Repeat, score 0.011
529507005272	HMMPfam hit to PF05593, RHS Repeat, score 0.0088
529507005273	HMMPfam hit to PF05593, RHS Repeat, score 0.0083
529507005274	HMMPfam hit to PF05593, RHS Repeat, score 0.8
529507005275	HMMPfam hit to PF05593, RHS Repeat, score 0.17
529507005276	HMMPfam hit to PF05593, RHS Repeat, score 2.7
529507005277	HMMPfam hit to PF05593, RHS Repeat, score 6.3
529507005278	HMMPfam hit to PF05593, RHS Repeat, score 0.011
529507005279	Rhs family protein [Cell envelope biogenesis, outer membrane]; Region: RhsA; COG3209
529507005280	RHS repeat-associated core domain; Region: Rhs_assc_core; TIGR03696
529507005281	HMMPfam hit to PF05593, RHS Repeat, score 6.7
529507005282	HMMPfam hit to PF05593, RHS Repeat, score 0.011
529507005283	transposase (pseudogene)
529507005284	PS00225 Crystallins beta and gamma 'Greek key' motif signature.
529507005285	Also similar to parts of PMI1120, PMI1125, PMI1128, PMI1131, PMI1138, PMI1140, PMI1142, PMI1069, PMI1073 and PMI1077; Rhs-family protein (fragment)
529507005286	Also similar to parts of PMI1120, PMI1125, PMI1128, PMI1131, PMI1138, PMI1137, PMI1142, PMI1069, PMI1073 and PMI1077; Rhs-family protein (fragment)
529507005287	Also similar to parts of PMI1120, PMI1125, PMI1131, PMI1137, PMI1138, PMI1140, PMI1128, PMI1073 and PMI1077; Rhs-family protein (fragment)
529507005288	HMMPfam hit to PF05593, RHS Repeat, score 6.7
529507005289	HMMPfam hit to PF05593, RHS Repeat, score 0.011
529507005290	ribonuclease (fragment)
529507005291	Barstar (barnase inhibitor); Region: Barstar; pfam01337
529507005292	RNAase interaction site [polypeptide binding]; other site
529507005293	integrase (fragment)
529507005294	ABC-type Mn2+/Zn2+ transport systems, permease components [Inorganic ion transport and metabolism]; Region: ZnuB; COG1108
529507005295	Transmembrane subunit (TM), of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters involved in the uptake of siderophores, heme, vitamin B12, or the divalent cations Mg2+ and Zn2+. PBP-dependent ABC transporters consist of...; Region: TM_ABC_iron-siderophores_like; cd06550
529507005296	ABC-ATPase subunit  interface; other site
529507005297	dimer interface [polypeptide binding]; other site
529507005298	putative PBP binding regions; other site
529507005299	HMMPfam hit to PF00950, ABC 3 transport family, score 7.1e-112
529507005300	7 probable transmembrane helices predicted for PMI1150 by TMHMM2.0 at aa 5-27, 48-70, 85-107, 120-142, 178-200, 213-235 and 239-258
529507005301	Signal peptide predicted for PMI1150 by SignalP 2.0 HMM (Signal peptide probability 0.981) with cleavage site probability 0.960 between residues 18 and 19
529507005302	high-affinity zinc transporter ATPase; Reviewed; Region: znuC; PRK09544
529507005303	ATP-binding cassette domain of the metal-type transporters; Region: ABC_Metallic_Cations; cd03235
529507005304	HMMPfam hit to PF00005, ABC transporter, score 8.4e-47
529507005305	PS00211 ABC transporters family signature.
529507005306	PS00017 ATP/GTP-binding site motif A (P-loop).
529507005307	high-affinity zinc transporter periplasmic component; Reviewed; Region: znuA; PRK09545
529507005308	Zinc binding protein ZnuA. These proteins have been shown to function as initial receptors in the ABC uptake of Zn2+.  They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism; Region: ZnuA; cd01019
529507005309	metal binding site [ion binding]; metal-binding site
529507005310	Signal peptide predicted for PMI1152 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.994 between residues 32 and 33
529507005311	HMMPfam hit to PF01297, Periplasmic solute binding protein family, score 1.9e-37
529507005312	putative peptidase; Provisional; Region: PRK11649
529507005313	Lysine Motif is a small domain involved in binding peptidoglycan; Region: LysM; cd00118
529507005314	Peptidase family M23; Region: Peptidase_M23; pfam01551
529507005315	HMMPfam hit to PF01476, LysM domain, score 1.1e-05
529507005316	HMMPfam hit to PF01551, Peptidase family M23, score 1.9e-52
529507005317	Bacterial lipid A biosynthesis acyltransferase; Region: Lip_A_acyltrans; pfam03279
529507005318	Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: LABLAT-like; Region: LPLAT_LABLAT-like; cd07984
529507005319	putative acyl-acceptor binding pocket; other site
529507005320	HMMPfam hit to PF03279, Bacterial lipid A biosynthesis acyltr, score 7.3e-117
529507005321	1 probable transmembrane helix predicted for PMI1154 by TMHMM2.0 at aa 27-44
529507005322	pyruvate kinase; Provisional; Region: PRK05826
529507005323	Pyruvate kinase (PK):  Large allosteric enzyme that regulates glycolysis through binding of the substrate, phosphoenolpyruvate, and one or more allosteric effectors. Like other allosteric enzymes, PK has a high substrate affinity R state and a low...; Region: Pyruvate_Kinase; cl17342
529507005324	domain interfaces; other site
529507005325	active site
529507005326	HMMPfam hit to PF02887, Pyruvate kinase, alpha/beta domain, score 5.9e-55
529507005327	HMMPfam hit to PF00224, Pyruvate kinase, barrel domain, score 2.2e-215
529507005328	PS00110 Pyruvate kinase active site signature.
529507005329	DNA-binding transcriptional regulator HexR; Provisional; Region: PRK11302
529507005330	Helix-turn-helix domain, rpiR family; Region: HTH_6; pfam01418
529507005331	RpiR-like protein. RpiR contains a SIS (Sugar ISomerase) domain, which is found in many phosphosugar isomerases and phosphosugar binding proteins. In E. coli, rpiR negatively regulates the expression of rpiB gene. Both rpiB and rpiA are ribose phosphate...; Region: SIS_RpiR; cd05013
529507005332	putative active site [active]
529507005333	HMMPfam hit to PF01380, SIS domain, score 6.1e-27
529507005334	HMMPfam hit to PF01418, Helix-turn-helix domain, rpiR family, score 2.6e-42
529507005335	Predicted helix-turn-helix motif with score 1099.000, SD 2.93 at aa 35-56, sequence SSIALMAKTADVSEPTVNRFCR
529507005336	glucose-6-phosphate 1-dehydrogenase; Validated; Region: PRK05722
529507005337	Glucose-6-phosphate dehydrogenase, NAD binding domain; Region: G6PD_N; pfam00479
529507005338	Glucose-6-phosphate dehydrogenase, C-terminal domain; Region: G6PD_C; pfam02781
529507005339	HMMPfam hit to PF00479, Glucose-6-phosphate dehydrogenase, NAD bindi, score 1.1e-82
529507005340	PS00069 Glucose-6-phosphate dehydrogenase active site.
529507005341	HMMPfam hit to PF02781, Glucose-6-phosphate dehydrogenase, C-termina, score 1.3e-192
529507005342	multidrug efflux system protein MdtJ; Provisional; Region: PRK10452
529507005343	4 probable transmembrane helices predicted for PMI1158 by TMHMM2.0 at aa 2-19, 29-51, 56-78 and 88-105
529507005344	HMMPfam hit to PF00893, Small Multidrug Resistance protein, score 1e-26
529507005345	multidrug efflux system protein MdtI; Provisional; Region: PRK10650
529507005346	4 probable transmembrane helices predicted for PMI1159 by TMHMM2.0 at aa 11-33, 38-60, 70-92 and 99-113
529507005347	HMMPfam hit to PF00893, Small Multidrug Resistance protein, score 2e-29
529507005348	1 probable transmembrane helix predicted for PMI1160 by TMHMM2.0 at aa 15-37
529507005349	Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]; Region: WcaG; COG0451
529507005350	atypical (a) SDRs, subgroup 5; Region: SDR_a5; cd05243
529507005351	NAD(P) binding site [chemical binding]; other site
529507005352	putative active site [active]
529507005353	This group of proteins belong to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function.  The conserved domain is similar in structure to chorismate mutase but there is no sequence...; Region: YjgF_YER057c_UK114_like_2; cd06150
529507005354	homotrimer interaction site [polypeptide binding]; other site
529507005355	putative active site [active]
529507005356	HMMPfam hit to PF01042, Endoribonuclease L-PSP, score 6.5e-29
529507005357	Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair]; Region: DinG; COG1199
529507005358	DEAD/DEAH box helicase; Region: DEAD; pfam00270
529507005359	Alpha-helical domain of GINS complex proteins; Sld5, Psf1, Psf2 and Psf3; Region: GINS_A; cl17012
529507005360	Helicase C-terminal domain; Region: Helicase_C_2; pfam13307
529507005361	PS00017 ATP/GTP-binding site motif A (P-loop).
529507005362	tRNA threonylcarbamoyl adenosine modification protein YeaZ; Region: T6A_YeaZ; TIGR03725
529507005363	Glycoprotease family; Region: Peptidase_M22; pfam00814
529507005364	HMMPfam hit to PF00814, Glycoprotease family, score 2e-23
529507005365	Outer membrane lipoprotein Slp family; Region: Slp; cl01164
529507005366	Signal peptide predicted for PMI1165 by SignalP 2.0 HMM (Signal peptide probability 0.904) with cleavage site probability 0.373 between residues 27 and 28
529507005367	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507005368	HMMPfam hit to PF03843, Outer membrane lipoprotein Slp family, score 9.4e-50
529507005369	long-chain-fatty-acid--CoA ligase; Validated; Region: PRK08974
529507005370	Prokaryotic long-chain fatty acid CoA synthetases similar to Escherichia coli FadD; Region: FC-FACS_FadD_like; cd05936
529507005371	acyl-activating enzyme (AAE) consensus motif; other site
529507005372	putative AMP binding site [chemical binding]; other site
529507005373	putative active site [active]
529507005374	putative CoA binding site [chemical binding]; other site
529507005375	HMMPfam hit to PF00501, AMP-binding enzyme, score 2.9e-129
529507005376	PS00038 Myc-type, 'helix-loop-helix' dimerization domain signature.
529507005377	PS00455 AMP-binding domain signature.
529507005378	ribonuclease D; Provisional; Region: PRK10829
529507005379	DEDDy 3'-5' exonuclease domain of Ribonuclease D and similar proteins; Region: RNaseD_exo; cd06142
529507005380	catalytic site [active]
529507005381	putative active site [active]
529507005382	putative substrate binding site [chemical binding]; other site
529507005383	HRDC domain; Region: HRDC; pfam00570
529507005384	HMMPfam hit to PF01612, 3'-5' exonuclease, score 9.1e-48
529507005385	HMMPfam hit to PF00570, HRDC domain, score 2.8e-20
529507005386	cell division topological specificity factor MinE; Reviewed; Region: minE; PRK00296
529507005387	HMMPfam hit to PF03776, Septum formation topological specificity fac, score 1.8e-46
529507005388	cell division inhibitor MinD; Provisional; Region: PRK10818
529507005389	Bacterial cell division requires the formation of a septum at mid-cell. The site is determined by the min operon products MinC, MinD and MinE. MinC is a nonspecific inhibitor of the septum protein FtsZ. MinE is the supressor of MinC. MinD plays a pivotal...; Region: MinD; cd02036
529507005390	Switch I; other site
529507005391	Switch II; other site
529507005392	HMMPfam hit to PF01656, CobQ/CobB/MinD/ParA nucleotide binding domai, score 1.3e-26
529507005393	PS00017 ATP/GTP-binding site motif A (P-loop).
529507005394	septum formation inhibitor; Reviewed; Region: minC; PRK03511
529507005395	Septum formation inhibitor MinC, N-terminal domain; Region: MinC_N; pfam05209
529507005396	Septum formation inhibitor MinC, C-terminal domain; Region: MinC_C; pfam03775
529507005397	HMMPfam hit to PF03775, Septum formation inhibitor MinC, C-terminal, score 1.9e-61
529507005398	HMMPfam hit to PF05209, Septum formation inhibitor MinC, N-terminal, score 7.2e-36
529507005399	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG3100
529507005400	HMMPfam hit to PF05166, Family of unknown function (DUF709), score 7e-49
529507005401	Transglycosylase SLT domain; Region: SLT_2; pfam13406
529507005402	Uncharacterized conserved protein (DUF2042); Region: DUF2042; cl10727
529507005403	Lytic Transglycosylase (LT)  and Goose Egg White Lysozyme (GEWL) domain. Members include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as, the eukaryotic "goose-type" lysozymes (GEWL).  LTs...; Region: LT_GEWL; cd00254
529507005404	N-acetyl-D-glucosamine binding site [chemical binding]; other site
529507005405	catalytic residue [active]
529507005406	Signal peptide predicted for PMI1172 by SignalP 2.0 HMM (Signal peptide probability 0.987) with cleavage site probability 0.334 between residues 27 and 28
529507005407	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507005408	hypothetical protein; Provisional; Region: PRK10691
529507005409	2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway) [Secondary metabolites biosynthesis, transport, and catabolism]; Region: MhpD; COG0179
529507005410	HMMPfam hit to PF01557, Fumarylacetoacetate (FAA) hydrolase fam, score 4.6e-69
529507005411	hypothetical protein; Provisional; Region: PRK05170
529507005412	HMMPfam hit to PF05779, Bacterial protein of unknown function (DUF83, score 1.1e-96
529507005413	ABC-type uncharacterized transport system, permease component [General function prediction only]; Region: COG0390
529507005414	HMMPfam hit to PF03649, Uncharacterised protein family (UPF0014), score 1.9e-125
529507005415	7 probable transmembrane helices predicted for PMI1175 by TMHMM2.0 at aa 5-24, 36-58, 62-79, 91-113, 123-145, 192-209 and 219-241
529507005416	putative ABC transporter ATP-binding protein YbbL; Provisional; Region: PRK10247
529507005417	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
529507005418	Walker A/P-loop; other site
529507005419	ATP binding site [chemical binding]; other site
529507005420	Q-loop/lid; other site
529507005421	ABC transporter signature motif; other site
529507005422	Walker B; other site
529507005423	D-loop; other site
529507005424	H-loop/switch region; other site
529507005425	HMMPfam hit to PF00005, ABC transporter, score 1.9e-44
529507005426	PS00211 ABC transporters family signature.
529507005427	PS00017 ATP/GTP-binding site motif A (P-loop).
529507005428	Alpha/beta hydrolase family; Region: Abhydrolase_5; pfam12695
529507005429	Signal peptide predicted for PMI1177 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.996 between residues 22 and 23
529507005430	right oriC-binding transcriptional activator; Provisional; Region: PRK15121
529507005431	Bacterial regulatory helix-turn-helix proteins, AraC family; Region: HTH_AraC; pfam00165
529507005432	GyrI-like small molecule binding domain; Region: GyrI-like; pfam06445
529507005433	HMMPfam hit to PF00165, Bacterial regulatory helix-turn-helix protei, score 9.2e-13
529507005434	PS00041 Bacterial regulatory proteins, araC family signature.
529507005435	HMMPfam hit to PF00165, Bacterial regulatory helix-turn-helix protei, score 2.4e-08
529507005436	Transcriptional regulator [Transcription]; Region: AcrR; COG1309
529507005437	Bacterial regulatory proteins, tetR family; Region: TetR_N; pfam00440
529507005438	HMMPfam hit to PF00440, Bacterial regulatory proteins, tetR family, score 1.9e-11
529507005439	Predicted helix-turn-helix motif with score 1026.000, SD 2.68 at aa 41-62, sequence VSIDEISRYARVTKGAFYHHFS
529507005440	methyl-accepting chemotaxis protein I; Provisional; Region: PRK15041
529507005441	HAMP (Histidine kinases, Adenylyl cyclases, Methyl binding proteins, Phosphatases) domain; Region: HAMP; smart00304
529507005442	Methyl-accepting chemotaxis protein (MCP), signaling domain; Region: MCP_signal; cd11386
529507005443	dimer interface [polypeptide binding]; other site
529507005444	putative CheW interface [polypeptide binding]; other site
529507005445	Signal peptide predicted for PMI1180 by SignalP 2.0 HMM (Signal peptide probability 0.874) with cleavage site probability 0.616 between residues 29 and 30
529507005446	2 probable transmembrane helices predicted for PMI1180 by TMHMM2.0 at aa 13-30 and 183-205
529507005447	HMMPfam hit to PF00672, HAMP domain, score 1.1e-08
529507005448	HMMPfam hit to PF00015, Methyl-accepting chemotaxis protein (MCP) s, score 6.3e-90
529507005449	Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only]; Region: LdhA; COG1052
529507005450	D-Lactate and related Dehydrogenases, NAD-binding and catalytic domains; Region: LDH_like_2; cd12183
529507005451	putative ligand binding site [chemical binding]; other site
529507005452	putative NAD binding site [chemical binding]; other site
529507005453	catalytic site [active]
529507005454	HMMPfam hit to PF02826, D-isomer specific 2-hydroxyacid dehydrog, score 1.8e-93
529507005455	PS00671 D-isomer specific 2-hydroxyacid dehydrogenases signature 3.
529507005456	PS00670 D-isomer specific 2-hydroxyacid dehydrogenases signature 2.
529507005457	PS00065 D-isomer specific 2-hydroxyacid dehydrogenases NAD-binding signature.
529507005458	HMMPfam hit to PF00389, D-isomer specific 2-hydroxyacid dehydrog, score 3.4e-19
529507005459	hypothetical protein; Provisional; Region: PRK10695
529507005460	Signal peptide predicted for PMI1182 by SignalP 2.0 HMM (Signal peptide probability 0.946) with cleavage site probability 0.547 between residues 36 and 37
529507005461	Signal peptide predicted for PMI1183 by SignalP 2.0 HMM (Signal peptide probability 0.708) with cleavage site probability 0.285 between residues 31 and 32
529507005462	YnbE-like lipoprotein; Region: Lipoprotein_19; pfam13617
529507005463	1 probable transmembrane helix predicted for PMI1183 by TMHMM2.0 at aa 9-31
529507005464	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507005465	Protein of unknown function (DUF1318); Region: DUF1318; pfam07027
529507005466	Signal peptide predicted for PMI1184 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.993 between residues 23 and 24
529507005467	HMMPfam hit to PF07027, Protein of unknown function (DUF1318), score 7.4e-46
529507005468	Fimbrial protein; Region: Fimbrial; pfam00419
529507005469	fimbrial operon 6
529507005470	HMMPfam hit to PF00419, Fimbrial protein, score 0.017
529507005471	Signal peptide predicted for PMI1185 by SignalP 2.0 HMM (Signal peptide probability 0.991) with cleavage site probability 0.945 between residues 23 and 24
529507005472	1 probable transmembrane helix predicted for PMI1185 by TMHMM2.0 at aa 5-22
529507005473	P pilus assembly protein, porin PapC [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimD; COG3188
529507005474	PapC N-terminal domain; Region: PapC_N; pfam13954
529507005475	Type VII secretion system (T7SS), usher protein; Region: Usher; pfam00577
529507005476	PapC C-terminal domain; Region: PapC_C; pfam13953
529507005477	HMMPfam hit to PF00577, Fimbrial Usher protein, score 1e-99
529507005478	PS01151 Fimbrial biogenesis outer membrane usher protein signature.
529507005479	Signal peptide predicted for PMI1186 by SignalP 2.0 HMM (Signal peptide probability 0.993) with cleavage site probability 0.977 between residues 25 and 26
529507005480	P pilus assembly protein, chaperone PapD [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimC; COG3121
529507005481	Gram-negative pili assembly chaperone, N-terminal domain; Region: Pili_assembly_N; pfam00345
529507005482	Gram-negative pili assembly chaperone, C-terminal domain; Region: Pili_assembly_C; pfam02753
529507005483	HMMPfam hit to PF00345, Gram-negative pili assembly chaperone, score 4.2e-11
529507005484	1 probable transmembrane helix predicted for PMI1187 by TMHMM2.0 at aa 5-24
529507005485	Signal peptide predicted for PMI1187 by SignalP 2.0 HMM (Signal peptide probability 0.970) with cleavage site probability 0.969 between residues 20 and 21
529507005486	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507005487	Fimbrial protein; Region: Fimbrial; cl01416
529507005488	HMMPfam hit to PF00419, Fimbrial protein, score 0.015
529507005489	Signal peptide predicted for PMI1188 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.903 between residues 26 and 27
529507005490	Truncated at C-terminus relative to database matches. Highly similar (75.5 38d) to the nearby CDS PMI1191; acyl carrier protein phosphodiesterase (fragment)
529507005491	P pilus assembly protein, pilin FimA [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimA; COG3539
529507005492	HMMPfam hit to PF00419, Fimbrial protein, score 0.0078
529507005493	Signal peptide predicted for PMI1190 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.964 between residues 26 and 27
529507005494	azoreductase; Reviewed; Region: PRK00170
529507005495	NADPH-dependent FMN reductase; Region: FMN_red; pfam03358
529507005496	HMMPfam hit to PF02525, Flavodoxin-like fold, score 2e-36
529507005497	ATP-dependent RNA helicase HrpA; Provisional; Region: PRK11131
529507005498	DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region; Region: DEXDc; cd00046
529507005499	ATP binding site [chemical binding]; other site
529507005500	putative Mg++ binding site [ion binding]; other site
529507005501	Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may...; Region: HELICc; cd00079
529507005502	nucleotide binding region [chemical binding]; other site
529507005503	ATP-binding site [chemical binding]; other site
529507005504	Helicase associated domain (HA2); Region: HA2; pfam04408
529507005505	Oligonucleotide/oligosaccharide-binding (OB)-fold; Region: OB_NTP_bind; pfam07717
529507005506	Domain of unknown function (DUF3418); Region: DUF3418; pfam11898
529507005507	HMMPfam hit to PF00270, DEAD/DEAH box helicase, score 3.4e-08
529507005508	PS00017 ATP/GTP-binding site motif A (P-loop).
529507005509	HMMPfam hit to PF00271, Helicase conserved C-terminal domain, score 3.2e-12
529507005510	HMMPfam hit to PF04408, Helicase associated domain (HA2), score 1.5e-25
529507005511	HMMPfam hit to PF07717, Domain of unknown function (DUF1605), score 1e-19
529507005512	fimbrial operon 7
529507005513	Signal peptide predicted for PMI1193 by SignalP 2.0 HMM (Signal peptide probability 0.996) with cleavage site probability 0.877 between residues 22 and 23
529507005514	Fimbrial protein; Region: Fimbrial; cl01416
529507005515	HMMPfam hit to PF00419, Fimbrial protein, score 0.0079
529507005516	P pilus assembly protein, porin PapC [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimD; COG3188
529507005517	PapC N-terminal domain; Region: PapC_N; pfam13954
529507005518	Type VII secretion system (T7SS), usher protein; Region: Usher; pfam00577
529507005519	PapC C-terminal domain; Region: PapC_C; pfam13953
529507005520	HMMPfam hit to PF00577, Fimbrial Usher protein, score 2.9e-88
529507005521	PS00284 Serpins signature.
529507005522	PS01151 Fimbrial biogenesis outer membrane usher protein signature.
529507005523	Signal peptide predicted for PMI1195 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.988 between residues 19 and 20
529507005524	P pilus assembly protein, chaperone PapD [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimC; COG3121
529507005525	Gram-negative pili assembly chaperone, N-terminal domain; Region: Pili_assembly_N; pfam00345
529507005526	Gram-negative pili assembly chaperone, C-terminal domain; Region: Pili_assembly_C; pfam02753
529507005527	HMMPfam hit to PF02753, Gram-negative pili assembly chaperone, score 2.8e-10
529507005528	HMMPfam hit to PF00345, Gram-negative pili assembly chaperone, score 1.7e-33
529507005529	1 probable transmembrane helix predicted for PMI1196 by TMHMM2.0 at aa 5-24
529507005530	Signal peptide predicted for PMI1196 by SignalP 2.0 HMM (Signal peptide probability 0.984) with cleavage site probability 0.916 between residues 21 and 22
529507005531	P pilus assembly protein, pilin FimA [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimA; COG3539
529507005532	HMMPfam hit to PF00419, Fimbrial protein, score 4.2e-07
529507005533	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507005534	Signal peptide predicted for PMI1197 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.998 between residues 24 and 25
529507005535	transporter, basic amino acid/polyamine antiporter (APA) family; Region: 2A0302; TIGR00905
529507005536	13 probable transmembrane helices predicted for PMI1198 by TMHMM2.0 at aa 5-27, 37-59, 90-112, 127-149, 161-183, 203-222, 235-257, 272-294, 331-350, 360-382, 389-406, 410-429 and 441-463
529507005537	HMMPfam hit to PF00324, Amino acid permease, score 2.5e-05
529507005538	Signal peptide predicted for PMI1198 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.687 between residues 21 and 22
529507005539	Protein of unknown function (DUF1471); Region: DUF1471; pfam07338
529507005540	Protein of unknown function (DUF1471); Region: DUF1471; pfam07338
529507005541	Protein of unknown function (DUF1471); Region: DUF1471; pfam07338
529507005542	PS01067 Protein secE/sec61-gamma signature.
529507005543	HMMPfam hit to PF07338, Protein of unknown function (DUF1471), score 2.3e-08
529507005544	Signal peptide predicted for PMI1199 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.961 between residues 23 and 24
529507005545	NAD(P) transhydrogenase subunit alpha; Provisional; Region: pntA; PRK09424
529507005546	Rubrum transdehydrogenase NAD-binding and catalytic domains; Region: Rubrum_tdh; cd05304
529507005547	ligand binding site [chemical binding]; other site
529507005548	homodimer interface [polypeptide binding]; other site
529507005549	NAD(P) binding site [chemical binding]; other site
529507005550	trimer interface B [polypeptide binding]; other site
529507005551	trimer interface A [polypeptide binding]; other site
529507005552	Domain of unknown function (DUF3814); Region: DUF3814; pfam12769
529507005553	HMMPfam hit to PF05222, Alanine dehydrogenase/PNT, N-terminal dom, score 8e-72
529507005554	PS00836 Alanine dehydrogenase & pyridine nucleotide transhydrogenase signature 1.
529507005555	HMMPfam hit to PF01262, Alanine dehydrogenase/PNT, C-terminal dom, score 9.8e-113
529507005556	5 probable transmembrane helices predicted for PMI1200 by TMHMM2.0 at aa 169-191, 402-419, 423-445, 452-471 and 476-498
529507005557	PS00837 Alanine dehydrogenase & pyridine nucleotide transhydrogenase signature 2.
529507005558	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507005559	pyridine nucleotide transhydrogenase; Provisional; Region: pntB; PRK09444
529507005560	NAD(P) transhydrogenase beta subunit; Region: PNTB; pfam02233
529507005561	Signal peptide predicted for PMI1201 by SignalP 2.0 HMM (Signal peptide probability 0.637) with cleavage site probability 0.372 between residues 22 and 23
529507005562	HMMPfam hit to PF02233, NAD(P) transhydrogenase beta subunit, score 0
529507005563	9 probable transmembrane helices predicted for PMI1201 by TMHMM2.0 at aa 5-24, 36-53, 57-74, 86-105, 120-142, 163-180, 185-207, 214-236 and 240-259
529507005564	universal stress protein UspE; Provisional; Region: PRK11175
529507005565	Usp: Universal stress protein family. The universal stress protein Usp is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. Usp enhances the rate of cell survival during prolonged exposure to...; Region: USP_Like; cd00293
529507005566	Ligand Binding Site [chemical binding]; other site
529507005567	Usp: Universal stress protein family. The universal stress protein Usp is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. Usp enhances the rate of cell survival during prolonged exposure to...; Region: USP_Like; cd00293
529507005568	Ligand Binding Site [chemical binding]; other site
529507005569	HMMPfam hit to PF00582, Universal stress protein family, score 5.6e-07
529507005570	HMMPfam hit to PF00582, Universal stress protein family, score 7.6e-15
529507005571	fumarate/nitrate reduction transcriptional regulator; Provisional; Region: PRK11161
529507005572	effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO...; Region: CAP_ED; cd00038
529507005573	ligand binding site [chemical binding]; other site
529507005574	flexible hinge region; other site
529507005575	helix_turn_helix, cAMP Regulatory protein C-terminus; DNA binding domain of prokaryotic regulatory proteins belonging to the catabolite activator protein family; Region: HTH_CRP; cd00092
529507005576	putative switch regulator; other site
529507005577	non-specific DNA interactions [nucleotide binding]; other site
529507005578	DNA binding site [nucleotide binding]
529507005579	sequence specific DNA binding site [nucleotide binding]; other site
529507005580	putative cAMP binding site [chemical binding]; other site
529507005581	HMMPfam hit to PF00325, Bacterial regulatory proteins, crp famil, score 3.3e-15
529507005582	PS00042 Bacterial regulatory proteins, crp family signature.
529507005583	Predicted helix-turn-helix motif with score 1841.000, SD 5.46 at aa 199-220, sequence MTRGDIGNYLGLTVETISRLLG
529507005584	HMMPfam hit to PF00027, Cyclic nucleotide-binding domain, score 6.4e-21
529507005585	anaerobic dimethyl sulfoxide reductase, A subunit, DmsA/YnfE family; Region: dmsA_ynfE; TIGR02166
529507005586	This CD (MopB_DmsA-EC) includes the DmsA enzyme of the dmsABC operon encoding the anaerobic dimethylsulfoxide reductase (DMSOR) of Escherichia coli and other related DMSOR-like enzymes. Unlike other DMSOR-like enzymes, this group has a  predicted...; Region: MopB_DmsA-EC; cd02770
529507005587	putative [Fe4-S4] binding site [ion binding]; other site
529507005588	putative molybdopterin cofactor binding site [chemical binding]; other site
529507005589	The MopB_CT_DmsA-EC CD includes the DmsA enzyme of the dmsABC operon encoding the anaerobic dimethylsulfoxide reductase (DMSOR) of Escherichia coli and other related DMSOR-like enzymes. Unlike other DMSOR-like enzymes, this group has a  predicted...; Region: MopB_CT_DmsA-EC; cd02794
529507005590	putative molybdopterin cofactor binding site; other site
529507005591	Signal peptide predicted for PMI1204 by SignalP 2.0 HMM (Signal peptide probability 0.983) with cleavage site probability 0.623 between residues 42 and 43
529507005592	HMMPfam hit to PF04879, Molybdopterin oxidoreductase Fe4S4 do, score 3.2e-05
529507005593	HMMPfam hit to PF00384, Molybdopterin oxidoreductase, score 4e-79
529507005594	PS00490 Prokaryotic molybdopterin oxidoreductases signature 2.
529507005595	HMMPfam hit to PF01568, Molydopterin dinucleotide binding dom, score 1.3e-32
529507005596	PS00932 Prokaryotic molybdopterin oxidoreductases signature 3.
529507005597	DMSO reductase, iron-sulfur subunit; Region: DMSO_dmsB; TIGR02951
529507005598	4Fe-4S binding domain; Region: Fer4; pfam00037
529507005599	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 0.014
529507005600	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507005601	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 4.6e-08
529507005602	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
529507005603	DMSO reductase anchor subunit (DmsC); Region: DmsC; cl17519
529507005604	8 probable transmembrane helices predicted for PMI1206 by TMHMM2.0 at aa 10-30, 43-65, 87-106, 113-135, 148-170, 182-199, 232-254 and 259-281
529507005605	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507005606	4Fe-4S dicluster domain; Region: Fer4_7; pfam12838
529507005607	RPB11 and RPB3 subunits of RNA polymerase; Region: RNAP_RPB11_RPB3; cl11409
529507005608	4Fe-4S dicluster domain; Region: Fer4_7; pfam12838
529507005609	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 0.0013
529507005610	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 9.6e-07
529507005611	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
529507005612	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 4.6e-06
529507005613	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 0.00014
529507005614	putative NAD(P)H quinone oxidoreductase, PIG3 family; Region: quinone_pig3; TIGR02824
529507005615	PIG3 p53-inducible quinone oxidoreductase; Region: p53_inducible_oxidoreductase; cd05276
529507005616	NAD(P) binding site [chemical binding]; other site
529507005617	HMMPfam hit to PF00107, Zinc-binding dehydrogenase, score 3.3e-84
529507005618	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
529507005619	Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes. PLP combines with an alpha-amino acid to form a compound called a Schiff base or aldimine intermediate, which depending on the reaction, is the...; Region: AAT_I; cl00321
529507005620	PS00190 Cytochrome c family heme-binding site signature.
529507005621	Predicted transcriptional regulators [Transcription]; Region: COG1695
529507005622	Transcriptional regulator PadR-like family; Region: PadR; pfam03551
529507005623	HMMPfam hit to PF03551, Transcriptional regulator PadR-like family, score 5e-23
529507005624	Signal peptide predicted for PMI1212 by SignalP 2.0 HMM (Signal peptide probability 0.997) with cleavage site probability 0.996 between residues 56 and 57
529507005625	alkyl hydroperoxide reductase subunit C; Provisional; Region: PRK10382
529507005626	Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides; Region: PRX_Typ2cys; cd03015
529507005627	dimer interface [polypeptide binding]; other site
529507005628	decamer (pentamer of dimers) interface [polypeptide binding]; other site
529507005629	catalytic triad [active]
529507005630	peroxidatic and resolving cysteines [active]
529507005631	HMMPfam hit to PF00578, AhpC/TSA family, score 1.7e-63
529507005632	alkyl hydroperoxide reductase subunit F; Provisional; Region: PRK15317
529507005633	Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) family, N-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which in turn catalyzes the reduction...; Region: AhpF_NTD_N; cd02974
529507005634	catalytic residue [active]
529507005635	TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then...; Region: AhpF_NTD_C; cd03026
529507005636	catalytic residues [active]
529507005637	Pyridine nucleotide-disulphide oxidoreductase; Region: Pyr_redox; pfam00070
529507005638	HMMPfam hit to PF00070, Pyridine nucleotide-disulphide oxidoreducta, score 1.7e-64
529507005639	PS00573 Pyridine nucleotide-disulphide oxidoreductases class-II active site.
529507005640	Prolyl oligopeptidase family; Region: Peptidase_S9; pfam00326
529507005641	Signal peptide predicted for PMI1215 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.979 between residues 29 and 30
529507005642	PS00120 Lipases, serine active site.
529507005643	4 probable transmembrane helices predicted for PMI1216 by TMHMM2.0 at aa 21-43, 63-85, 92-114 and 124-146
529507005644	Acetyltransferase (GNAT) domain; Region: Acetyltransf_10; pfam13673
529507005645	Acetyltransferase (GNAT) domain; Region: Acetyltransf_7; pfam13508
529507005646	Predicted permeases [General function prediction only]; Region: COG0679
529507005647	Signal peptide predicted for PMI1218 by SignalP 2.0 HMM (Signal peptide probability 0.859) with cleavage site probability 0.840 between residues 18 and 19
529507005648	HMMPfam hit to PF03547, Auxin Efflux Carrier, score 1.2e-05
529507005649	9 probable transmembrane helices predicted for PMI1218 by TMHMM2.0 at aa 4-21, 30-49, 64-83, 104-126, 130-152, 159-181, 191-213, 234-256 and 279-301
529507005650	AMP nucleosidase; Provisional; Region: PRK08292
529507005651	Bacterial AMP nucleoside phosphorylase N-terminus; Region: AMNp_N; pfam10423
529507005652	Nucleoside phosphorylase [Nucleotide transport and metabolism]; Region: Pfs; COG0775
529507005653	HMMPfam hit to PF01048, Phosphorylase family, score 4.7e-79
529507005654	Phage integrase, N-terminal SAM-like domain; Region: Phage_integr_N; cl12235
529507005655	tyrosine recombinase XerD; Region: recomb_XerD; TIGR02225
529507005656	DNA breaking-rejoining enzymes, C-terminal catalytic domain. The DNA breaking-rejoining enzyme superfamily includes type IB topoisomerases and tyrosine recombinases that share the same fold in their catalytic domain containing six conserved active site...; Region: DNA_BRE_C; cl00213
529507005657	active site
529507005658	DNA binding site [nucleotide binding]
529507005659	Int/Topo IB signature motif; other site
529507005660	HMMPfam hit to PF00589, Phage integrase family, score 3.4e-22
529507005661	HMMPfam hit to PF02899, Phage integrase, N-terminal SAM-like, score 0.0037
529507005662	L-Asparaginase type 2. L-Asparaginase hydrolyzes L-asparagine to L-aspartate and ammonia. The proenzyme undergoes an autoproteolytic cleavage into alpha and beta subunits to expose a threonine residue which becomes the N-terminal residue of the beta...; Region: Asparaginase_2; cd04701
529507005663	catalytic nucleophile [active]
529507005664	HMMPfam hit to PF01112, Asparaginase, score 4.3e-111
529507005665	PS00017 ATP/GTP-binding site motif A (P-loop).
529507005666	Signal peptide predicted for PMI1222 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.997 between residues 23 and 24
529507005667	HlyD family secretion protein; Region: HlyD; pfam00529
529507005668	Biotin-lipoyl like; Region: Biotin_lipoyl_2; pfam13533
529507005669	HlyD family secretion protein; Region: HlyD_3; pfam13437
529507005670	1 probable transmembrane helix predicted for PMI1223 by TMHMM2.0 at aa 9-27
529507005671	HMMPfam hit to PF00529, HlyD family secretion protein, score 8.8e-20
529507005672	ABC-type multidrug transport system, ATPase component [Defense mechanisms]; Region: CcmA; COG1131
529507005673	ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A; Region: ABC_DR_subfamily_A; cd03230
529507005674	Walker A/P-loop; other site
529507005675	ATP binding site [chemical binding]; other site
529507005676	Q-loop/lid; other site
529507005677	ABC transporter signature motif; other site
529507005678	Walker B; other site
529507005679	D-loop; other site
529507005680	H-loop/switch region; other site
529507005681	ABC-type multidrug transport system, ATPase component [Defense mechanisms]; Region: CcmA; COG1131
529507005682	ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A; Region: ABC_DR_subfamily_A; cd03230
529507005683	Walker A/P-loop; other site
529507005684	ATP binding site [chemical binding]; other site
529507005685	Q-loop/lid; other site
529507005686	ABC transporter signature motif; other site
529507005687	Walker B; other site
529507005688	D-loop; other site
529507005689	H-loop/switch region; other site
529507005690	ABC-2 family transporter protein; Region: ABC2_membrane_3; pfam12698
529507005691	ABC-type multidrug transport system, permease component [Defense mechanisms]; Region: COG0842
529507005692	ABC-2 family transporter protein; Region: ABC2_membrane_2; pfam12679
529507005693	HMMPfam hit to PF00005, ABC transporter, score 3.7e-65
529507005694	PS00017 ATP/GTP-binding site motif A (P-loop).
529507005695	PS00211 ABC transporters family signature.
529507005696	HMMPfam hit to PF00005, ABC transporter, score 2.4e-51
529507005697	PS00017 ATP/GTP-binding site motif A (P-loop).
529507005698	5 probable transmembrane helices predicted for PMI1224 by TMHMM2.0 at aa 569-591, 725-747, 780-802, 809-831 and 895-917
529507005699	HMMPfam hit to PF01061, ABC-2 type transporter, score 1.9e-05
529507005700	ABC-type multidrug transport system, permease component [Defense mechanisms]; Region: COG0842
529507005701	ABC-2 type transporter; Region: ABC2_membrane; pfam01061
529507005702	Signal peptide predicted for PMI1225 by SignalP 2.0 HMM (Signal peptide probability 0.964) with cleavage site probability 0.717 between residues 41 and 42
529507005703	6 probable transmembrane helices predicted for PMI1225 by TMHMM2.0 at aa 26-48, 178-200, 231-253, 257-279, 286-308 and 344-366
529507005704	HMMPfam hit to PF01061, ABC-2 type transporter, score 3.9e-25
529507005705	PS00890 ABC-2 type transport system integral membrane proteins signature.
529507005706	DNA-binding transcriptional activator KdpE; Provisional; Region: PRK10529
529507005707	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
529507005708	active site
529507005709	phosphorylation site [posttranslational modification]
529507005710	intermolecular recognition site; other site
529507005711	dimerization interface [polypeptide binding]; other site
529507005712	Effector domain of response regulator. Bacteria and certain eukaryotes like protozoa and higher plants use two-component signal transduction systems to detect and respond to changes in the environment. The system consists of a sensor histidine kinase and...; Region: trans_reg_C; cd00383
529507005713	DNA binding site [nucleotide binding]
529507005714	HMMPfam hit to PF00486, Transcriptional regulatory protein, C te, score 1.6e-17
529507005715	HMMPfam hit to PF00072, Response regulator receiver domain, score 5.7e-37
529507005716	sensor protein KdpD; Provisional; Region: PRK10490
529507005717	Osmosensitive K+ channel His kinase sensor domain; Region: KdpD; pfam02702
529507005718	USP domain is located between the N-terminal sensor domain and C-terminal catalytic domain of this Osmosensitive K+ channel histidine kinase family. The family of KdpD sensor kinase proteins regulates the kdpFABC operon responsible for potassium...; Region: USP_OKCHK; cd01987
529507005719	Ligand Binding Site [chemical binding]; other site
529507005720	Domain of unknown function (DUF4118); Region: DUF4118; pfam13493
529507005721	GAF domain; Region: GAF_3; pfam13492
529507005722	Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via...; Region: HisKA; cd00082
529507005723	dimer interface [polypeptide binding]; other site
529507005724	phosphorylation site [posttranslational modification]
529507005725	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
529507005726	ATP binding site [chemical binding]; other site
529507005727	Mg2+ binding site [ion binding]; other site
529507005728	G-X-G motif; other site
529507005729	HMMPfam hit to PF02518, Histidine kinase-, DNA gyrase B-, and HSP90, score 8.1e-35
529507005730	HMMPfam hit to PF00512, His Kinase A (phosphoacceptor) domain, score 3.7e-16
529507005731	4 probable transmembrane helices predicted for PMI1227 by TMHMM2.0 at aa 407-426, 433-450, 454-476 and 483-505
529507005732	HMMPfam hit to PF00582, Universal stress protein family, score 0.00012
529507005733	HMMPfam hit to PF02702, Osmosensitive K+ channel His kinase sensor, score 1.6e-144
529507005734	PS00017 ATP/GTP-binding site motif A (P-loop).
529507005735	exported protein (fragment);This CDS is truncated at N-terminus.
529507005736	HMMPfam hit to PF03401, Bordetella uptake gene (bug) product, score 0.0012
529507005737	Tripartite tricarboxylate transporter TctB family; Region: TctB; pfam07331
529507005738	Signal peptide predicted for PMI1229 by SignalP 2.0 HMM (Signal peptide probability 0.965) with cleavage site probability 0.770 between residues 29 and 30
529507005739	4 probable transmembrane helices predicted for PMI1229 by TMHMM2.0 at aa 7-29, 34-53, 74-103 and 118-140
529507005740	Tripartite tricarboxylate transporter TctA family; Region: TctA; pfam01970
529507005741	12 probable transmembrane helices predicted for PMI1230 by TMHMM2.0 at aa 7-29, 39-61, 106-128, 143-160, 165-184, 194-216, 261-283, 318-340, 360-382, 397-419, 432-449 and 464-486
529507005742	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507005743	HMMPfam hit to PF01970, Integral membrane protein DUF112, score 2.4e-118
529507005744	dihydroxyacetone kinase subunit DhaK; Provisional; Region: PRK14481
529507005745	Dihydroxyacetone kinase [Carbohydrate transport and metabolism]; Region: DAK1; COG2376
529507005746	HMMPfam hit to PF02733, Dak1 domain, score 7.6e-100
529507005747	DAK2 domain; Region: Dak2; pfam02734
529507005748	HMMPfam hit to PF02734, DAK2 domain, score 4.8e-06
529507005749	Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane]; Region: DapA; COG0329
529507005750	Dihydrodipicolinate synthase family; Region: DHDPS-like; cd00408
529507005751	inhibitor site; inhibition site
529507005752	active site
529507005753	dimer interface [polypeptide binding]; other site
529507005754	catalytic residue [active]
529507005755	HMMPfam hit to PF00701, Dihydrodipicolinate synthetase family, score 2.3e-55
529507005756	Threonine dehydratase: The first step in amino acid degradation is the removal of nitrogen. Although the nitrogen atoms of most amino acids are transferred to alpha-ketoglutarate before removal, the alpha-amino group of threonine can be directly...; Region: Thr-dehyd; cd01562
529507005757	tetramer interface [polypeptide binding]; other site
529507005758	Pyridoxal-phosphate dependent enzyme; Region: PALP; pfam00291
529507005759	pyridoxal 5'-phosphate binding site [chemical binding]; other site
529507005760	catalytic residue [active]
529507005761	HMMPfam hit to PF00291, Pyridoxal-phosphate dependent enzyme, score 1.8e-83
529507005762	YjgF, YER057c, and UK114 belong to a large family of proteins present in bacteria, archaea, and eukaryotes with no definitive function. The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no...; Region: YjgF_YER057c_UK114_family; cd00448
529507005763	homotrimer interaction site [polypeptide binding]; other site
529507005764	putative active site [active]
529507005765	HMMPfam hit to PF01042, Endoribonuclease L-PSP, score 1.8e-24
529507005766	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cd04301
529507005767	Coenzyme A binding pocket [chemical binding]; other site
529507005768	HMMPfam hit to PF00583, Acetyltransferase (GNAT) family, score 7.7e-13
529507005769	leucine export protein LeuE; Provisional; Region: PRK10958
529507005770	6 probable transmembrane helices predicted for PMI1237 by TMHMM2.0 at aa 10-32, 45-67, 77-99, 120-142, 157-179 and 192-214
529507005771	HMMPfam hit to PF01810, LysE type translocator, score 9.1e-53
529507005772	PPOX class probable FMN-dependent enzyme, DR_2398 family; Region: PPOX_FMN_DR2398; TIGR04025
529507005773	HMMPfam hit to PF01243, Pyridoxamine 5'-phosphate oxidase, score 3.4e-19
529507005774	endonuclease III; includes endonuclease III (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA glycosidases (Alka-family) and other DNA glycosidases; Region: ENDO3c; cd00056
529507005775	endonuclease III; Region: ENDO3c; smart00478
529507005776	minor groove reading motif; other site
529507005777	helix-hairpin-helix signature motif; other site
529507005778	substrate binding pocket [chemical binding]; other site
529507005779	active site
529507005780	HMMPfam hit to PF00730, HhH-GPD superfamily base excision DNA repair, score 1.6e-10
529507005781	Bacterial regulatory helix-turn-helix proteins, AraC family; Region: HTH_AraC; pfam00165
529507005782	helix_turn_helix, arabinose operon control protein; Region: HTH_ARAC; smart00342
529507005783	Methylated DNA-protein cysteine methyltransferase [DNA replication, recombination, and repair]; Region: Ada; COG0350
529507005784	6-O-methylguanine DNA methyltransferase, ribonuclease-like domain; Region: Methyltransf_1N; pfam02870
529507005785	The DNA repair protein O6-alkylguanine-DNA alkyltransferase (ATase; also known as AGT, AGAT and MGMT) reverses O6-alkylation DNA damage by transferring O6-alkyl adducts to an active site cysteine irreversibly, without inducing DNA strand breaks. ATases...; Region: ATase; cd06445
529507005786	DNA binding site [nucleotide binding]
529507005787	active site
529507005788	HMMPfam hit to PF00165, Bacterial regulatory helix-turn-helix, score 4.7e-13
529507005789	HMMPfam hit to PF00165, Bacterial regulatory helix-turn-helix, score 0.22
529507005790	HMMPfam hit to PF02870, 6-O-methylguanine DNA methyltransfera, score 4.8e-05
529507005791	HMMPfam hit to PF01035, 6-O-methylguanine DNA methyltransfera, score 4.7e-45
529507005792	PS00374 Methylated-DNA--protein-cysteine methyltransferase active site.
529507005793	ASC-1 homology domain, subfamily similar to Escherichia coli Yqfb. The ASCH domain, a small beta-barrel domain found in all three kingdoms of life, resembles the RNA-binding PUA domain and may also interact with RNA. ASCH has been proposed to function as...; Region: ASCH_yqfb_like; cd06552
529507005794	HMMPfam hit to PF06164, Bacterial protein of unknown function (DUF97, score 6.9e-50
529507005795	ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only]; Region: Uup; COG0488
529507005796	ATP-binding cassette domain of elongation factor 3, subfamily F; Region: ABCF_EF-3; cd03221
529507005797	ATP-binding cassette domain of elongation factor 3, subfamily F; Region: ABCF_EF-3; cd03221
529507005798	HMMPfam hit to PF00005, ABC transporter, score 7.9e-34
529507005799	PS00211 ABC transporters family signature.
529507005800	PS00017 ATP/GTP-binding site motif A (P-loop).
529507005801	HMMPfam hit to PF00005, ABC transporter, score 8e-40
529507005802	PS00017 ATP/GTP-binding site motif A (P-loop).
529507005803	D-alanyl-alanine synthetase A; Reviewed; Region: ddl; PRK01966
529507005804	D-ala D-ala ligase N-terminus; Region: Dala_Dala_lig_N; pfam01820
529507005805	D-ala D-ala ligase C-terminus; Region: Dala_Dala_lig_C; pfam07478
529507005806	HMMPfam hit to PF01820, D-ala D-ala ligase N-terminus, score 4.2e-54
529507005807	PS00017 ATP/GTP-binding site motif A (P-loop).
529507005808	PS00843 D-alanine--D-alanine ligase signature 1.
529507005809	HMMPfam hit to PF07478, D-ala D-ala ligase C-terminus, score 2.9e-114
529507005810	PS00844 D-alanine--D-alanine ligase signature 2.
529507005811	This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases; Region: Glo_EDI_BRP_like_2; cd07253
529507005812	dimer interface [polypeptide binding]; other site
529507005813	Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily; Region: Glyoxalase; pfam00903
529507005814	metal binding site [ion binding]; metal-binding site
529507005815	HMMPfam hit to PF00903, Glyoxalase/Bleomycin resistance protein/Di, score 2.3e-12
529507005816	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG3755
529507005817	Signal peptide predicted for PMI1245 by SignalP 2.0 HMM (Signal peptide probability 0.725) with cleavage site probability 0.715 between residues 27 and 28
529507005818	HMMPfam hit to PF07007, Protein of unknown function (DUF1311), score 8.9e-20
529507005819	Signal peptide predicted for PMI1246 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.953 between residues 22 and 23
529507005820	ABC-type metal ion transport system, periplasmic component/surface antigen [Inorganic ion transport and metabolism]; Region: NlpA; COG1464
529507005821	NLPA lipoprotein; Region: Lipoprotein_9; pfam03180
529507005822	Signal peptide predicted for PMI1247 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.822 between residues 22 and 23
529507005823	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507005824	HMMPfam hit to PF03180, NLPA lipoprotein, score 3.6e-84
529507005825	methionine gamma-lyase; Validated; Region: PRK07049
529507005826	CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis. This pathway is unique to microorganisms and plants, rendering the enzyme an attractive target for the development of...; Region: CGS_like; cd00614
529507005827	homodimer interface [polypeptide binding]; other site
529507005828	substrate-cofactor binding pocket; other site
529507005829	pyridoxal 5'-phosphate binding site [chemical binding]; other site
529507005830	catalytic residue [active]
529507005831	HMMPfam hit to PF01053, Cys/Met metabolism PLP-dependent enzy, score 6.3e-103
529507005832	Acetyltransferase (GNAT) domain; Region: Acetyltransf_3; pfam13302
529507005833	Acetyltransferase (GNAT) family; Region: Acetyltransf_1; pfam00583
529507005834	HMMPfam hit to PF00583, Acetyltransferase (GNAT) family, score 5e-09
529507005835	Helix-turn-helix domain; Region: HTH_18; pfam12833
529507005836	Bacterial regulatory helix-turn-helix proteins, AraC family; Region: HTH_AraC; pfam00165
529507005837	HMMPfam hit to PF00165, Bacterial regulatory helix-turn-helix protei, score 1.6e-08
529507005838	putative transporter; Provisional; Region: PRK10054
529507005839	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507005840	putative substrate translocation pore; other site
529507005841	12 probable transmembrane helices predicted for PMI1251 by TMHMM2.0 at aa 13-35, 45-67, 74-93, 98-120, 133-155, 165-187, 208-230, 245-264, 277-296, 300-317, 337-359 and 363-382
529507005842	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 1.5e-31
529507005843	Signal peptide predicted for PMI1251 by SignalP 2.0 HMM (Signal peptide probability 0.992) with cleavage site probability 0.416 between residues 24 and 25
529507005844	acetyl-CoA carboxylase carboxyltransferase subunit alpha; Validated; Region: PRK05724
529507005845	acetyl-CoA carboxylase carboxyltransferase alpha subunit; Provisional; Region: accA; CHL00198
529507005846	HMMPfam hit to PF03255, Acetyl co-enzyme A carboxylase carboxyltrans, score 3.8e-96
529507005847	Transcriptional regulator [Transcription]; Region: LysR; COG0583
529507005848	Bacterial regulatory helix-turn-helix protein, lysR family; Region: HTH_1; pfam00126
529507005849	The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain; Region: PBP2_CrgA_like; cd08422
529507005850	putative effector binding pocket; other site
529507005851	dimerization interface [polypeptide binding]; other site
529507005852	HMMPfam hit to PF00126, Bacterial regulatory helix-turn-helix, score 5.6e-20
529507005853	Predicted helix-turn-helix motif with score 1028.000, SD 2.69 at aa 18-39, sequence AQFASAARSLSMPTSNVSRAIK
529507005854	PS00044 Bacterial regulatory proteins, lysR family signature.
529507005855	HMMPfam hit to PF03466, LysR substrate binding domain, score 6e-31
529507005856	PS00030 Eukaryotic RNA-binding region RNP-1 signature.
529507005857	drug resistance transporter, EmrB/QacA subfamily; Region: efflux_EmrB; TIGR00711
529507005858	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507005859	putative substrate translocation pore; other site
529507005860	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507005861	putative substrate translocation pore; other site
529507005862	14 probable transmembrane helices predicted for PMI1254 by TMHMM2.0 at aa 7-29, 44-66, 75-94, 99-121, 134-156, 162-184, 193-215, 225-244, 266-288, 303-320, 329-348, 358-380, 401-423 and 465-487
529507005863	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 1.8e-61
529507005864	PS00216 Sugar transport proteins signature 1.
529507005865	Signal peptide predicted for PMI1254 by SignalP 2.0 HMM (Signal peptide probability 0.996) with cleavage site probability 0.463 between residues 29 and 30
529507005866	Transcriptional regulator [Transcription]; Region: AcrR; COG1309
529507005867	Bacterial regulatory proteins, tetR family; Region: TetR_N; pfam00440
529507005868	HMMPfam hit to PF00440, Bacterial regulatory proteins, tetR family, score 8.6e-18
529507005869	Predicted helix-turn-helix motif with score 1165.000, SD 3.15 at aa 39-60, sequence TTVSDIVKQAGVAKGTYYHYFT
529507005870	ABC transporter ATP-binding protein; Provisional; Region: PRK15064
529507005871	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
529507005872	Walker A/P-loop; other site
529507005873	ATP binding site [chemical binding]; other site
529507005874	Q-loop/lid; other site
529507005875	ABC transporter signature motif; other site
529507005876	Walker B; other site
529507005877	D-loop; other site
529507005878	H-loop/switch region; other site
529507005879	ABC transporter; Region: ABC_tran_2; pfam12848
529507005880	ATP-binding cassette domain of elongation factor 3, subfamily F; Region: ABCF_EF-3; cd03221
529507005881	HMMPfam hit to PF00005, ABC transporter, score 2e-41
529507005882	PS00017 ATP/GTP-binding site motif A (P-loop).
529507005883	PS00277 Staphylococcal enterotoxin/Streptococcal pyrogenic exotoxin signature 1.
529507005884	HMMPfam hit to PF00005, ABC transporter, score 1.3e-40
529507005885	PS00017 ATP/GTP-binding site motif A (P-loop).
529507005886	hypothetical protein; Validated; Region: PRK00124
529507005887	HMMPfam hit to PF02639, Uncharacterized BCR, YaiI/YqxD family COG167, score 1.4e-73
529507005888	N-ethylammeline chlorohydrolase; Provisional; Region: PRK09045
529507005889	TRZ/ATZ family contains enzymes from the atrazine degradation pathway and related hydrolases. Atrazine, a chlorinated herbizide, can be catabolized by a variety of different bacteria. The first three steps of the atrazine dehalogenation pathway are...; Region: ATZ_TRZ_like; cd01298
529507005890	active site
529507005891	putative substrate binding pocket [chemical binding]; other site
529507005892	Signal peptide predicted for PMI1259 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.991 between residues 21 and 22
529507005893	HMMPfam hit to PF01979, Amidohydrolase family, score 9.2e-56
529507005894	PS00017 ATP/GTP-binding site motif A (P-loop).
529507005895	DNA-binding transcriptional regulator YidZ; Provisional; Region: PRK10216
529507005896	Bacterial regulatory helix-turn-helix protein, lysR family; Region: HTH_1; pfam00126
529507005897	The C-terminal substrate binding domain of LysR-type transcriptional regulators that involved in the catabolism of nitroaromatic/naphthalene compounds and that of related regulators; contains the type 2 periplasmic binding fold; Region: PBP2_Nitroaromatics_like; cd08417
529507005898	substrate binding pocket [chemical binding]; other site
529507005899	dimerization interface [polypeptide binding]; other site
529507005900	HMMPfam hit to PF00126, Bacterial regulatory helix-turn-helix protei, score 9.2e-15
529507005901	PS00044 Bacterial regulatory proteins, lysR family signature.
529507005902	Predicted helix-turn-helix motif with score 1431.000, SD 4.06 at aa 24-45, sequence RSVTLAAKWLSISPSAVSKALA
529507005903	multidrug efflux system protein MdtL; Provisional; Region: PRK10473
529507005904	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507005905	putative substrate translocation pore; other site
529507005906	HMMPfam hit to PF00083, Sugar (and other) transporter, score 3.2e-05
529507005907	12 probable transmembrane helices predicted for PMI1261 by TMHMM2.0 at aa 13-35, 50-72, 79-98, 103-125, 138-160, 165-187, 222-244, 254-276, 283-302, 307-329, 342-364 and 369-391
529507005908	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 1.7e-46
529507005909	PS00216 Sugar transport proteins signature 1.
529507005910	Predicted helix-turn-helix motif with score 998.000, SD 2.59 at aa 33-54, sequence TGLTAIASDLNASEVTLHHAFS
529507005911	Signal peptide predicted for PMI1261 by SignalP 2.0 HMM (Signal peptide probability 0.703) with cleavage site probability 0.558 between residues 30 and 31
529507005912	tRNA 2-selenouridine synthase; Provisional; Region: PRK11784
529507005913	Member of the Rhodanese Homology Domain superfamily. This CD includes several putative ATP /GTP binding proteins including E. coli YbbB; Region: RHOD_YbbB; cd01520
529507005914	active site residue [active]
529507005915	PS00017 ATP/GTP-binding site motif A (P-loop).
529507005916	Signal peptide predicted for PMI1263 by SignalP 2.0 HMM (Signal peptide probability 0.969) with cleavage site probability 0.873 between residues 26 and 27
529507005917	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507005918	2 probable transmembrane helices predicted for PMI1263 by TMHMM2.0 at aa 38-60 and 70-92
529507005919	multidrug resistance protein MdtN; Provisional; Region: PRK10476
529507005920	Biotin-lipoyl like; Region: Biotin_lipoyl_2; pfam13533
529507005921	HlyD family secretion protein; Region: HlyD_3; pfam13437
529507005922	Signal peptide predicted for PMI1264 by SignalP 2.0 HMM (Signal peptide probability 0.861) with cleavage site probability 0.449 between residues 38 and 39
529507005923	1 probable transmembrane helix predicted for PMI1264 by TMHMM2.0 at aa 12-34
529507005924	HMMPfam hit to PF00529, HlyD family secretion protein, score 1.3e-26
529507005925	Fusaric acid resistance protein-like; Region: FUSC_2; pfam13515
529507005926	10 probable transmembrane helices predicted for PMI1265 by TMHMM2.0 at aa 30-52, 67-89, 96-118, 150-172, 334-353, 357-374, 381-403, 408-427, 432-449 and 464-486
529507005927	HMMPfam hit to PF04632, Fusaric acid resistance protein conserved re, score 2.1e-13
529507005928	Signal peptide predicted for PMI1266 by SignalP 2.0 HMM (Signal peptide probability 0.646) with cleavage site probability 0.185 between residues 36 and 37
529507005929	type I secretion outer membrane protein, TolC family; Region: type_I_sec_TolC; TIGR01844
529507005930	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507005931	HMMPfam hit to PF02321, Outer membrane efflux protein, score 3.3e-26
529507005932	HMMPfam hit to PF02321, Outer membrane efflux protein, score 5.5e-21
529507005933	2 probable transmembrane helices predicted for PMI1267 by TMHMM2.0 at aa 9-28 and 62-84
529507005934	putative chaperone; Provisional; Region: PRK11678
529507005935	Escherichia coli YegD, a putative chaperone protein, and related proteins; Region: YegD_like; cd10231
529507005936	nucleotide binding site [chemical binding]; other site
529507005937	putative NEF/HSP70 interaction site [polypeptide binding]; other site
529507005938	SBD interface [polypeptide binding]; other site
529507005939	PS00329 Heat shock hsp70 proteins family signature 2.
529507005940	PS00017 ATP/GTP-binding site motif A (P-loop).
529507005941	Threonine aldolase [Amino acid transport and metabolism]; Region: GLY1; COG2008
529507005942	Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes. PLP combines with an alpha-amino acid to form a compound called a Schiff base or aldimine intermediate, which depending on the reaction, is the...; Region: AAT_I; cl00321
529507005943	pyridoxal 5'-phosphate binding pocket [chemical binding]; other site
529507005944	catalytic residue [active]
529507005945	HMMPfam hit to PF01212, Beta-eliminating lyase, score 1.1e-20
529507005946	YjbD family (DUF3811); Region: DUF3811; cl08125
529507005947	Putative threonine efflux protein [Amino acid transport and metabolism]; Region: RhtB; COG1280
529507005948	5 probable transmembrane helices predicted for PMI1271 by TMHMM2.0 at aa 5-27, 42-64, 71-88, 143-165 and 178-197
529507005949	HMMPfam hit to PF01810, LysE type translocator, score 1.9e-10
529507005950	Escherichia coli xylulokinase-like D-xylulose kinases; a subgroup of the FGGY family of carbohydrate kinases; Region: FGGY_D-XK_EcXK-like; cd07808
529507005951	xylulokinase; Provisional; Region: PRK15027
529507005952	N- and C-terminal domain interface [polypeptide binding]; other site
529507005953	active site
529507005954	MgATP binding site [chemical binding]; other site
529507005955	catalytic site [active]
529507005956	metal binding site [ion binding]; metal-binding site
529507005957	xylulose binding site [chemical binding]; other site
529507005958	homodimer interface [polypeptide binding]; other site
529507005959	HMMPfam hit to PF02782, FGGY family of carbohydrate kinases, C-termi, score 8.1e-79
529507005960	PS00445 FGGY family of carbohydrate kinases signature 2.
529507005961	PS00133 Zinc carboxypeptidases, zinc-binding region 2 signature.
529507005962	HMMPfam hit to PF00370, FGGY family of carbohydrate kinases, N-termi, score 3.5e-115
529507005963	PS00933 FGGY family of carbohydrate kinases signature 1.
529507005964	xylose isomerase; Provisional; Region: PRK05474
529507005965	xylose isomerase; Region: xylose_isom_A; TIGR02630
529507005966	HMMPfam hit to PF01261, Xylose isomerase-like TIM barrel, score 1e-11
529507005967	PS00172 Xylose isomerase signature 1.
529507005968	Na+/H+ antiporter NhaC; Region: antiport_nhaC; TIGR00931
529507005969	HMMPfam hit to PF03553, Na+/H+ antiporter family, score 2.6e-70
529507005970	11 probable transmembrane helices predicted for PMI1274 by TMHMM2.0 at aa 13-35, 40-59, 80-102, 112-134, 141-163, 196-218, 239-258, 263-285, 327-349, 364-386 and 438-460
529507005971	Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism]; Region: MalY; COG1168
529507005972	Aspartate aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). Pyridoxal phosphate combines with an alpha-amino acid to form a compound called a Schiff base or aldimine...; Region: AAT_like; cd00609
529507005973	pyridoxal 5'-phosphate binding site [chemical binding]; other site
529507005974	homodimer interface [polypeptide binding]; other site
529507005975	catalytic residue [active]
529507005976	HMMPfam hit to PF00155, Aminotransferase class I and II, score 2.4e-10
529507005977	Ligand-binding domain of DNA transcription repressor specific for xylose (XylR); Region: PBP1_XylR; cd01543
529507005978	putative dimerization interface [polypeptide binding]; other site
529507005979	Transcriptional regulators [Transcription]; Region: PurR; COG1609
529507005980	putative ligand binding site [chemical binding]; other site
529507005981	helix_turn_helix, arabinose operon control protein; Region: HTH_ARAC; smart00342
529507005982	Bacterial regulatory helix-turn-helix proteins, AraC family; Region: HTH_AraC; pfam00165
529507005983	HMMPfam hit to PF00532, Periplasmic binding proteins and sugar b, score 0.26
529507005984	HMMPfam hit to PF00165, Bacterial regulatory helix-turn-helix pr, score 0.0006
529507005985	Predicted helix-turn-helix motif with score 1273.000, SD 3.52 at aa 304-325, sequence IKTEQVLDAVNMSRSNLEQRFK
529507005986	PS00041 Bacterial regulatory proteins, araC family signature.
529507005987	HMMPfam hit to PF00165, Bacterial regulatory helix-turn-helix pr, score 2.2e-14
529507005988	Uncharacterized conserved protein (DUF2132); Region: DUF2132; pfam09905
529507005989	exosortase A system-associated hydrolase 1; Region: hydr1_PEP; TIGR03100
529507005990	Putative lysophospholipase; Region: Hydrolase_4; pfam12146
529507005991	1 probable transmembrane helix predicted for PMI1278 by TMHMM2.0 at aa 7-29
529507005992	This region appears to be originated from a mobile element
529507005993	Uncharacterized enzyme involved in biosynthesis of extracellular polysaccharides [General function prediction only]; Region: COG2329
529507005994	HMMPfam hit to PF03992, Antibiotic biosynthesis monooxygenase, score 3.8e-05
529507005995	PS00339 Aminoacyl-transfer RNA synthetases class-II signature 2.
529507005996	HMMPfam hit to PF01022, Bacterial regulatory protein, arsR family, score 1.5e-10
529507005997	Predicted helix-turn-helix motif with score 1092.000, SD 2.91 at aa 43-64, sequence WTATELSIVADISASTTSSHLS
529507005998	4 probable transmembrane helices predicted for PMI1281 by TMHMM2.0 at aa 7-29, 49-68, 75-97 and 117-139
529507005999	Signal peptide predicted for PMI1281 by SignalP 2.0 HMM (Signal peptide probability 0.622) with cleavage site probability 0.253 between residues 40 and 41
529507006000	Signal peptide predicted for PMI1283 by SignalP 2.0 HMM (Signal peptide probability 0.998) with cleavage site probability 0.970 between residues 22 and 23
529507006001	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cd04301
529507006002	Coenzyme A binding pocket [chemical binding]; other site
529507006003	HMMPfam hit to PF00583, Acetyltransferase (GNAT) family, score 1.4e-06
529507006004	2 probable transmembrane helices predicted for PMI1285 by TMHMM2.0 at aa 9-31 and 46-65
529507006005	lipoprotein; Provisional; Region: PRK10540
529507006006	Signal peptide predicted for PMI1286 by SignalP 2.0 HMM (Signal peptide probability 0.981) with cleavage site probability 0.244 between residues 28 and 29
529507006007	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507006008	2 probable transmembrane helices predicted for PMI1287 by TMHMM2.0 at aa 21-40 and 44-66
529507006009	malonic semialdehyde reductase; Provisional; Region: PRK10538
529507006010	classical (c) SDR, subgroup 5; Region: SDR_c5; cd05346
529507006011	putative NAD(P) binding site [chemical binding]; other site
529507006012	homodimer interface [polypeptide binding]; other site
529507006013	homotetramer interface [polypeptide binding]; other site
529507006014	active site
529507006015	HMMPfam hit to PF00106, short chain dehydrogenase, score 4.3e-63
529507006016	PS00061 Short-chain dehydrogenases/reductases family signature.
529507006017	hypothetical protein; Provisional; Region: PRK13659
529507006018	Signal peptide predicted for PMI1289 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.941 between residues 31 and 32
529507006019	HMMPfam hit to PF06932, Protein of unknown function (DUF1283), score 1.3e-31
529507006020	Protein of unknown function (DUF1161); Region: DUF1161; pfam06649
529507006021	HMMPfam hit to PF06649, Protein of unknown function (DUF1161), score 2e-31
529507006022	Signal peptide predicted for PMI1290 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.547 between residues 19 and 20
529507006023	The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain. Functionally, proteins in this superfamily use the energy from hydrolysis of NTP to transfer electron or ion; Region: Fer4_NifH; cl17203
529507006024	AAA domain; Region: AAA_26; pfam13500
529507006025	HMMPfam hit to PF01656, CobQ/CobB/MinD/ParA nucleotide binding domai, score 9.9e-17
529507006026	MarR family; Region: MarR_2; cl17246
529507006027	Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism]; Region: NagC; COG1940
529507006028	Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily; Region: NBD_sugar-kinase_HSP70_actin; cl17037
529507006029	Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily; Region: NBD_sugar-kinase_HSP70_actin; cl17037
529507006030	HMMPfam hit to PF00480, ROK family, score 2.8e-10
529507006031	PS00017 ATP/GTP-binding site motif A (P-loop).
529507006032	Transcriptional regulator [Transcription]; Region: LysR; COG0583
529507006033	Bacterial regulatory helix-turn-helix protein, lysR family; Region: HTH_1; pfam00126
529507006034	The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of aromatic compounds and that of other related regulators, contains type 2 periplasmic binding fold; Region: PBP2_LTTR_aromatics_like; cd08414
529507006035	dimerization interface [polypeptide binding]; other site
529507006036	substrate binding pocket [chemical binding]; other site
529507006037	HMMPfam hit to PF03466, LysR substrate binding domain, score 4e-43
529507006038	HMMPfam hit to PF00126, Bacterial regulatory helix-turn-helix, score 9.4e-23
529507006039	PS00044 Bacterial regulatory proteins, lysR family signature.
529507006040	Predicted helix-turn-helix motif with score 1801.000, SD 5.32 at aa 18-39, sequence LHFGKAAERLNISQPPLSQQIQ
529507006041	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507006042	Major Facilitator Superfamily; Region: MFS_1; pfam07690
529507006043	putative substrate translocation pore; other site
529507006044	HMMPfam hit to PF00083, Sugar (and other) transporter, score 8e-05
529507006045	12 probable transmembrane helices predicted for PMI1294 by TMHMM2.0 at aa 38-60, 75-97, 110-129, 133-155, 162-184, 194-216, 245-267, 277-294, 306-328, 333-355, 368-390 and 394-416
529507006046	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 1.3e-44
529507006047	PS00216 Sugar transport proteins signature 1.
529507006048	DNA replication terminus site-binding protein; Provisional; Region: PRK02951
529507006049	HMMPfam hit to PF05472, DNA replication terminus site-binding protei, score 9.6e-133
529507006050	fumarate hydratase; Reviewed; Region: fumC; PRK00485
529507006051	Class II fumarases; Region: Fumarase_classII; cd01362
529507006052	active site
529507006053	tetramer interface [polypeptide binding]; other site
529507006054	HMMPfam hit to PF00206, Lyase, score 3.2e-187
529507006055	PS00163 Fumarate lyases signature.
529507006056	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG5339
529507006057	Bacterial protein of unknown function (DUF945); Region: DUF945; pfam06097
529507006058	HMMPfam hit to PF06097, Bacterial protein of unknown function (DUF94, score 1.8e-28
529507006059	Signal peptide predicted for PMI1297 by SignalP 2.0 HMM (Signal peptide probability 0.959) with cleavage site probability 0.754 between residues 19 and 20
529507006060	von Willebrand factor type A domain; Region: VWA_2; pfam13519
529507006061	1 probable transmembrane helix predicted for PMI1299 by TMHMM2.0 at aa 10-28
529507006062	Adenosine deaminase [Nucleotide transport and metabolism]; Region: Add; COG1816
529507006063	Adenosine deaminase (ADA) is a monomeric zinc dependent enzyme which catalyzes the irreversible hydrolytic deamination of both adenosine, as well as desoxyadenosine, to ammonia and inosine or desoxyinosine, respectively. ADA plays an important role in...; Region: ADA; cd01320
529507006064	active site
529507006065	purine riboside binding site [chemical binding]; other site
529507006066	HMMPfam hit to PF00962, Adenosine/AMP deaminase, score 2.6e-111
529507006067	PS00485 Adenosine and AMP deaminase signature.
529507006068	Predicted Na+-dependent transporter [General function prediction only]; Region: COG0385
529507006069	SBF-like CPA transporter family (DUF4137); Region: DUF4137; pfam13593
529507006070	9 probable transmembrane helices predicted for PMI1301 by TMHMM2.0 at aa 13-32, 38-60, 73-95, 105-127, 134-156, 171-190, 211-230, 235-257 and 289-311
529507006071	Signal peptide predicted for PMI1301 by SignalP 2.0 HMM (Signal peptide probability 0.998) with cleavage site probability 0.825 between residues 30 and 31
529507006072	putative oxidoreductase; Provisional; Region: PRK11579
529507006073	Oxidoreductase family, NAD-binding Rossmann fold; Region: GFO_IDH_MocA; pfam01408
529507006074	Oxidoreductase family, C-terminal alpha/beta domain; Region: GFO_IDH_MocA_C; pfam02894
529507006075	HMMPfam hit to PF02894, Oxidoreductase family, C-terminal alph, score 1.2e-13
529507006076	HMMPfam hit to PF01408, Oxidoreductase family, NAD-binding Ros, score 3.3e-38
529507006077	Protein of unknown function (DUF2569); Region: DUF2569; pfam10754
529507006078	4 probable transmembrane helices predicted for PMI1303 by TMHMM2.0 at aa 20-42, 62-84, 97-116 and 126-144
529507006079	electron transport complex protein RsxA; Provisional; Region: PRK05151
529507006080	HMMPfam hit to PF02508, Rnf-Nqr subunit, membrane protein, score 2.3e-109
529507006081	6 probable transmembrane helices predicted for PMI1304 by TMHMM2.0 at aa 5-27, 37-56, 69-88, 103-125, 132-154 and 169-191
529507006082	electron transport complex protein RnfB; Provisional; Region: PRK05113
529507006083	Putative Fe-S cluster; Region: FeS; cl17515
529507006084	4Fe-4S binding domain; Region: Fer4; pfam00037
529507006085	Signal peptide predicted for PMI1305 by SignalP 2.0 HMM (Signal peptide probability 0.743) with cleavage site probability 0.333 between residues 23 and 24
529507006086	1 probable transmembrane helix predicted for PMI1305 by TMHMM2.0 at aa 4-26
529507006087	HMMPfam hit to PF04060, Fe-S cluster, score 4.1e-15
529507006088	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 1.1e-07
529507006089	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
529507006090	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 6.3e-06
529507006091	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
529507006092	Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion]; Region: RnfC; COG4656
529507006093	SLBB domain; Region: SLBB; pfam10531
529507006094	The HCP family of iron-sulfur proteins includes hybrid cluster protein (HCP), acetyl-CoA synthase (ACS), and carbon monoxide dehydrogenase (CODH), all of which contain [Fe4-S4] metal clusters at their active sites. These proteins have a conserved...; Region: HCP_like; cl14655
529507006095	HMMPfam hit to PF01512, Respiratory-chain NADH dehydrogenase, score 2.2e-72
529507006096	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 0.00012
529507006097	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
529507006098	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 0.00019
529507006099	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
529507006100	electron transport complex protein RnfD; Reviewed; Region: rnfD; PRK00816
529507006101	HMMPfam hit to PF03116, NQR2, RnfD, RnfE family, score 1.5e-148
529507006102	9 probable transmembrane helices predicted for PMI1307 by TMHMM2.0 at aa 30-49, 53-72, 79-101, 105-127, 134-156, 222-244, 249-271, 281-303 and 310-327
529507006103	electron transport complex protein RnfG; Validated; Region: PRK01908
529507006104	Signal peptide predicted for PMI1308 by SignalP 2.0 HMM (Signal peptide probability 0.754) with cleavage site probability 0.451 between residues 28 and 29
529507006105	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507006106	1 probable transmembrane helix predicted for PMI1308 by TMHMM2.0 at aa 13-35
529507006107	PS00606 Beta-ketoacyl synthases active site.
529507006108	HMMPfam hit to PF04205, FMN-binding domain, score 8.8e-17
529507006109	electron transport complex RsxE subunit; Provisional; Region: PRK12405
529507006110	HMMPfam hit to PF02508, Rnf-Nqr subunit, membrane protein, score 1.4e-110
529507006111	Signal peptide predicted for PMI1309 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.372 between residues 38 and 39
529507006112	4 probable transmembrane helices predicted for PMI1309 by TMHMM2.0 at aa 74-96, 101-123, 136-158 and 189-211
529507006113	PS00284 Serpins signature.
529507006114	endonuclease III; Provisional; Region: PRK10702
529507006115	endonuclease III; includes endonuclease III (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA glycosidases (Alka-family) and other DNA glycosidases; Region: ENDO3c; cd00056
529507006116	minor groove reading motif; other site
529507006117	helix-hairpin-helix signature motif; other site
529507006118	substrate binding pocket [chemical binding]; other site
529507006119	active site
529507006120	iron-sulpphur binding domain in DNA-(apurinic or apyrimidinic site) lyase (subfamily of ENDO3); Region: FES; smart00525
529507006121	HMMPfam hit to PF00730, HhH-GPD superfamily base excision DNA repair, score 4.5e-19
529507006122	HMMPfam hit to PF00633, Helix-hairpin-helix motif, score 4.5e-06
529507006123	PS01155 Endonuclease III family signature.
529507006124	PS00764 Endonuclease III iron-sulfur binding region signature.
529507006125	exoribonuclease II; Provisional; Region: PRK05054
529507006126	Ribonuclease B OB domain; Region: OB_RNB; pfam08206
529507006127	RNB domain; Region: RNB; pfam00773
529507006128	S1 RNA binding domain; Region: S1; pfam00575
529507006129	HMMPfam hit to PF00773, RNB-like protein, score 1.6e-95
529507006130	PS01175 Ribonuclease II family signature.
529507006131	translation initiation factor Sui1; Validated; Region: PRK06824
529507006132	Homologs of eIF1/SUI1 including Escherichia coli YciH; Region: YciH_like; cd11567
529507006133	putative rRNA binding site [nucleotide binding]; other site
529507006134	HMMPfam hit to PF01253, Translation initiation factor SUI1, score 2e-35
529507006135	PS01118 Translation initiation factor SUI1 signature.
529507006136	Orotidine 5'-phosphate decarboxylase (ODCase) is a dimeric enzyme that decarboxylates orotidine 5'-monophosphate (OMP) to form uridine 5'-phosphate (UMP), an essential step in the pyrimidine biosynthetic pathway. In mammals, UMP synthase...; Region: OMP_decarboxylase_like; cd04725
529507006137	active site
529507006138	dimer interface [polypeptide binding]; other site
529507006139	HMMPfam hit to PF00215, Orotidine 5'-phosphate decarboxylase / HUMP, score 1.1e-87
529507006140	PS00156 Orotidine 5'-phosphate decarboxylase active site.
529507006141	tetratricopeptide repeat protein; Provisional; Region: PRK11788
529507006142	Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi; Region: TPR; cd00189
529507006143	binding surface
529507006144	TPR motif; other site
529507006145	HMMPfam hit to PF07719, Tetratricopeptide repeat, score 1.5
529507006146	HMMPfam hit to PF07719, Tetratricopeptide repeat, score 0.69
529507006147	Predicted membrane protein [Function unknown]; Region: COG3771
529507006148	HMMPfam hit to PF06305, Protein of unknown function (DUF1049), score 7.1e-44
529507006149	2 probable transmembrane helices predicted for PMI1315 by TMHMM2.0 at aa 5-24 and 44-66
529507006150	Signal peptide predicted for PMI1315 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.374 between residues 20 and 21
529507006151	PAP2_like proteins, a super-family of histidine phosphatases and vanadium haloperoxidases, includes type 2 phosphatidic acid phosphatase or lipid phosphate phosphatase (LPP), Glucose-6-phosphatase, Phosphatidylglycerophosphatase B and bacterial acid...; Region: PAP2_like; cd01610
529507006152	Membrane-associated phospholipid phosphatase [Lipid metabolism]; Region: PgpB; COG0671
529507006153	active site
529507006154	HMMPfam hit to PF01569, PAP2 superfamily, score 6.1e-16
529507006155	6 probable transmembrane helices predicted for PMI1316 by TMHMM2.0 at aa 7-29, 49-68, 75-97, 157-179, 186-205 and 209-231
529507006156	Signal peptide predicted for PMI1316 by SignalP 2.0 HMM (Signal peptide probability 0.798) with cleavage site probability 0.220 between residues 23 and 24
529507006157	GTP cyclohydrolase II (RibA).  GTP cyclohydrolase II catalyzes the conversion of GTP to 2,5-diamino-6-ribosylamino-4(3H)-pyrimidinone 5' phosphate, formate, pyrophosphate (APy), and GMP in the biosynthetic pathway of riboflavin. Riboflavin is the...; Region: GTP_cyclohydro2; cd00641
529507006158	dimerization interface [polypeptide binding]; other site
529507006159	active site
529507006160	HMMPfam hit to PF00925, GTP cyclohydrolase II, score 1e-113
529507006161	NLPA lipoprotein; Region: Lipoprotein_9; cl17547
529507006162	cytoplasmic membrane lipoprotein-28; Provisional; Region: PRK09861
529507006163	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507006164	HMMPfam hit to PF03180, NLPA lipoprotein, score 7.5e-120
529507006165	Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only]; Region: PaaY; COG0663
529507006166	Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). Proteins containing hexapeptide repeats are often enzymes...; Region: LbetaH; cl00160
529507006167	Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). Proteins containing hexapeptide repeats are often enzymes...; Region: LbetaH; cl00160
529507006168	putative trimer interface [polypeptide binding]; other site
529507006169	putative CoA binding site [chemical binding]; other site
529507006170	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 67
529507006171	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 0.2
529507006172	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 0.052
529507006173	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 12
529507006174	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 0.3
529507006175	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 21
529507006176	aconitate hydratase; Validated; Region: PRK09277
529507006177	Aconitase A catalytic domain; Region: AcnA_IRP; cd01586
529507006178	substrate binding site [chemical binding]; other site
529507006179	ligand binding site [chemical binding]; other site
529507006180	Aconitase A swivel domain. This is the major form of the TCA cycle enzyme aconitate hydratase, also known as aconitase and citrate hydro-lyase. It includes bacterial and archaeal aconitase A, and the eukaryotic cytosolic form of aconitase. This group...; Region: AcnA_IRP_Swivel; cd01580
529507006181	substrate binding site [chemical binding]; other site
529507006182	HMMPfam hit to PF00694, Aconitase C-terminal domain, score 1.1e-63
529507006183	HMMPfam hit to PF00330, Aconitase family (aconitate hydratase), score 3e-277
529507006184	PS01244 Aconitase family signature 2.
529507006185	PS00450 Aconitase family signature 1.
529507006186	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507006187	transcriptional regulator CysB; Reviewed; Region: cysB; PRK12681
529507006188	Bacterial regulatory helix-turn-helix protein, lysR family; Region: HTH_1; pfam00126
529507006189	The C-terminal substrate domain of LysR-type transcriptional regulators CysB-like contains type 2 periplasmic binding fold; Region: PBP2_CysB_like; cd08413
529507006190	substrate binding site [chemical binding]; other site
529507006191	dimerization interface [polypeptide binding]; other site
529507006192	HMMPfam hit to PF03466, LysR substrate binding domain, score 5.6e-43
529507006193	HMMPfam hit to PF00126, Bacterial regulatory helix-turn-helix, score 2.1e-15
529507006194	PS00044 Bacterial regulatory proteins, lysR family signature.
529507006195	Predicted helix-turn-helix motif with score 1124.000, SD 3.02 at aa 17-38, sequence LNVSTTAERLYTSQPGISKQIR
529507006196	This region carries 5 highly similar lipoproteins
529507006197	1 probable transmembrane helix predicted for PMI1324 by TMHMM2.0 at aa 15-37
529507006198	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507006199	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507006200	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507006201	1 probable transmembrane helix predicted for PMI1326 by TMHMM2.0 at aa 4-26
529507006202	1 probable transmembrane helix predicted for PMI1327 by TMHMM2.0 at aa 15-37
529507006203	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507006204	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507006205	Lipase (class 3).  Lipases are esterases that can hydrolyze long-chain acyl-triglycerides into di- and monoglycerides, glycerol, and free fatty acids at a water/lipid interface.  A typical feature of lipases is "interfacial activation," the...; Region: Lipase_3; cd00519
529507006206	active site flap/lid [active]
529507006207	nucleophilic elbow; other site
529507006208	catalytic triad [active]
529507006209	HMMPfam hit to PF01764, Lipase (class 3), score 3.7e-21
529507006210	PS00343 Gram-positive cocci surface proteins 'anchoring' hexapeptide.
529507006211	PS00017 ATP/GTP-binding site motif A (P-loop).
529507006212	Domain of unknown function (DUF4123); Region: DUF4123; pfam13503
529507006213	Predicted helix-turn-helix motif with score 1024.000, SD 2.67 at aa 1-22, sequence MSLTWTSWLTNTIQSDVYFLIN
529507006214	type VI secretion system Vgr family protein; Region: VI_Rhs_Vgr; TIGR03361
529507006215	Phage late control gene D protein (GPD); Region: Phage_GPD; pfam05954
529507006216	Phage-related baseplate assembly protein; Region: Phage_base_V; pfam04717
529507006217	Putative type VI secretion system Rhs element Vgr; Region: T6SS_Vgr; pfam13296
529507006218	Uncharacterized protein conserved in bacteria (DUF2345); Region: DUF2345; cl01733
529507006219	HMMPfam hit to PF04524, Protein of unknown function, DUF586, score 2.7e-38
529507006220	PAAR motif; Region: PAAR_motif; pfam05488
529507006221	Cu/Zn superoxide dismutase [Inorganic ion transport and metabolism]; Region: SodC; COG2032
529507006222	Copper/zinc superoxide dismutase (SOD). superoxide dismutases catalyse the conversion of superoxide radicals to molecular oxygen. Three evolutionarily distinct families of SODs are known, of which the copper/zinc-binding family is one. Defects in the...; Region: Cu-Zn_Superoxide_Dismutase; cd00305
529507006223	E-class dimer interface [polypeptide binding]; other site
529507006224	P-class dimer interface [polypeptide binding]; other site
529507006225	active site
529507006226	Cu2+ binding site [ion binding]; other site
529507006227	Zn2+ binding site [ion binding]; other site
529507006228	HMMPfam hit to PF00080, Copper/zinc superoxide dismutase (SODC), score 3.7e-46
529507006229	PS00332 Copper/Zinc superoxide dismutase signature 2.
529507006230	PS00087 Copper/Zinc superoxide dismutase signature 1.
529507006231	Signal peptide predicted for PMI1333 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.970 between residues 19 and 20
529507006232	DNA topoisomerase I subunit omega; Validated; Region: PRK07561
529507006233	TOPRIM_TopoIA_TopoI: The topoisomerase-primase (TORPIM) domain found in members of the type IA family of DNA topoisomerases (Topo IA) similar to Escherichia coli DNA topoisomerase I.   Type IA DNA topoisomerases remove (relax) negative supercoils in the...; Region: TOPRIM_TopoIA_TopoI; cd03363
529507006234	active site
529507006235	interdomain interaction site; other site
529507006236	putative metal-binding site [ion binding]; other site
529507006237	nucleotide binding site [chemical binding]; other site
529507006238	DNA Topoisomerase, subtype IA; DNA-binding, ATP-binding and catalytic domain of bacterial DNA topoisomerases I and III, and eukaryotic DNA topoisomerase III and eubacterial and archael reverse gyrases. Topoisomerases clevage single or double stranded DNA...; Region: TOP1Ac; cd00186
529507006239	domain I; other site
529507006240	DNA binding groove [nucleotide binding]
529507006241	phosphate binding site [ion binding]; other site
529507006242	domain II; other site
529507006243	domain III; other site
529507006244	nucleotide binding site [chemical binding]; other site
529507006245	catalytic site [active]
529507006246	domain IV; other site
529507006247	Topoisomerase DNA binding C4 zinc finger; Region: zf-C4_Topoisom; pfam01396
529507006248	Topoisomerase DNA binding C4 zinc finger; Region: zf-C4_Topoisom; pfam01396
529507006249	Topoisomerase I zinc-ribbon-like; Region: Topo_Zn_Ribbon; pfam08272
529507006250	Topoisomerase I zinc-ribbon-like; Region: Topo_Zn_Ribbon; pfam08272
529507006251	HMMPfam hit to PF01396, Topoisomerase DNA binding C4 zinc fing, score 7.1e-16
529507006252	HMMPfam hit to PF01396, Topoisomerase DNA binding C4 zinc fing, score 7.5e-10
529507006253	HMMPfam hit to PF01131, DNA topoisomerase, score 6e-178
529507006254	PS00396 Prokaryotic DNA topoisomerase I active site.
529507006255	HMMPfam hit to PF01751, Toprim domain, score 3.9e-35
529507006256	hypothetical protein; Provisional; Region: PRK11037
529507006257	Peptidase family S49 N-terminal; Region: Peptidase_S49_N; pfam08496
529507006258	putative inner membrane peptidase; Provisional; Region: PRK11778
529507006259	Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad; Region: S49_Sppa_N_C; cd07023
529507006260	tandem repeat interface [polypeptide binding]; other site
529507006261	oligomer interface [polypeptide binding]; other site
529507006262	active site residues [active]
529507006263	HMMPfam hit to PF01343, Peptidase family S49, score 1.3e-54
529507006264	2 probable transmembrane helices predicted for PMI1336 by TMHMM2.0 at aa 10-32 and 189-206
529507006265	putative oxoacyl-(acyl carrier protein) reductase; Provisional; Region: PRK08945
529507006266	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
529507006267	NAD(P) binding site [chemical binding]; other site
529507006268	active site
529507006269	HMMPfam hit to PF00106, short chain dehydrogenase, score 5.7e-52
529507006270	PS00061 Short-chain dehydrogenases/reductases family signature.
529507006271	ATP:corrinoid adenosyltransferase [Coenzyme metabolism]; Region: BtuR; COG2109
529507006272	cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated; Region: PRK05986
529507006273	HMMPfam hit to PF02572, ATP:corrinoid adenosyltransferase BtuR, score 2.1e-105
529507006274	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507006275	23S rRNA pseudouridylate synthase B; Provisional; Region: PRK10700
529507006276	S4/Hsp/ tRNA synthetase RNA-binding domain; The domain surface is populated by conserved, charged residues that define a likely RNA-binding site;  Found in stress proteins, ribosomal proteins and tRNA synthetases; This may imply a hitherto unrecognized...; Region: S4; cl09940
529507006277	RNA binding surface [nucleotide binding]; other site
529507006278	Pseudouridine synthase, Escherichia coli RluB like; Region: PseudoU_synth_RluB; cd02556
529507006279	probable active site [active]
529507006280	HMMPfam hit to PF00849, RNA pseudouridylate synthase, score 3e-14
529507006281	PS01149 Rsu family of pseudouridine synthase signature.
529507006282	HMMPfam hit to PF01479, S4 domain, score 0.00019
529507006283	hypothetical protein; Provisional; Region: PRK11630
529507006284	HMMPfam hit to PF01300, yrdC domain, score 9e-71
529507006285	PS01147 SUA5/yciO/yrdC family signature.
529507006286	Predicted metal-dependent phosphoesterases (PHP family) [General function prediction only]; Region: COG0613
529507006287	Polymerase and Histidinol Phosphatase domain of Histidinol phosphate phosphatase (HisPPase) AMP bound; Region: PHP_HisPPase_AMP; cd07438
529507006288	active site
529507006289	Polymerase and Histidinol Phosphatase domain of Histidinol phosphate phosphatase (HisPPase) AMP bound; Region: PHP_HisPPase_AMP; cd07438
529507006290	HMMPfam hit to PF02811, PHP domain C-terminal region, score 2.3e-15
529507006291	HMMPfam hit to PF02231, PHP domain N-terminal region, score 4.3e-22
529507006292	anthranilate synthase component I; Provisional; Region: PRK13564
529507006293	Anthranilate synthase component I, N terminal region; Region: Anth_synt_I_N; pfam04715
529507006294	chorismate binding enzyme; Region: Chorismate_bind; pfam00425
529507006295	HMMPfam hit to PF04715, Anthranilate synthase component I, N, score 3.8e-21
529507006296	PS00012 Phosphopantetheine attachment site.
529507006297	HMMPfam hit to PF00425, chorismate binding enzyme, score 1.1e-147
529507006298	Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase; Region: GATase1_Anthranilate_Synthase; cd01743
529507006299	Glutamine amidotransferase class-I; Region: GATase; pfam00117
529507006300	glutamine binding [chemical binding]; other site
529507006301	catalytic triad [active]
529507006302	HMMPfam hit to PF00117, Glutamine amidotransferase class-I, score 3e-63
529507006303	PS00442 Glutamine amidotransferases class-I active site.
529507006304	anthranilate phosphoribosyltransferase; Provisional; Region: trpD; PRK00188
529507006305	Glycosyl transferase family, helical bundle domain; Region: Glycos_trans_3N; pfam02885
529507006306	Glycosyl transferase family, a/b domain; Region: Glycos_transf_3; pfam00591
529507006307	HMMPfam hit to PF02885, Glycosyl transferase family, helical, score 6.5e-24
529507006308	HMMPfam hit to PF00591, Glycosyl transferase family, a/b doma, score 3.1e-128
529507006309	bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional; Region: PRK09427
529507006310	Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the...; Region: IGPS; cd00331
529507006311	active site
529507006312	ribulose/triose binding site [chemical binding]; other site
529507006313	phosphate binding site [ion binding]; other site
529507006314	substrate (anthranilate) binding pocket [chemical binding]; other site
529507006315	product (indole) binding pocket [chemical binding]; other site
529507006316	Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP). Most PRAIs are...; Region: PRAI; cd00405
529507006317	active site
529507006318	HMMPfam hit to PF00218, Indole-3-glycerol phosphate synthase, score 3.1e-139
529507006319	PS00614 Indole-3-glycerol phosphate synthase signature.
529507006320	HMMPfam hit to PF00697, N-(5'phosphoribosyl)anthranilate (PRA) isome, score 6.4e-66
529507006321	PS00126 3'5'-cyclic nucleotide phosphodiesterases signature.
529507006322	tryptophan synthase, beta subunit; Region: trpB; TIGR00263
529507006323	Tryptophan synthase-beta:  Trptophan synthase is a bifunctional enzyme that catalyses the last two steps in the biosynthesis of L-tryptophan via its alpha and beta reactions. In the alpha reaction, indole 3-glycerol phosphate is cleaved reversibly to...; Region: Trp-synth_B; cd06446
529507006324	pyridoxal 5'-phosphate binding site [chemical binding]; other site
529507006325	catalytic residue [active]
529507006326	HMMPfam hit to PF00291, Pyridoxal-phosphate dependent enzyme, score 1.1e-117
529507006327	PS00168 Tryptophan synthase beta chain pyridoxal-phosphate attachment site.
529507006328	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507006329	tryptophan synthase alpha subunit; Provisional; Region: trpA; CHL00200
529507006330	Ttryptophan synthase (TRPS) alpha subunit (TSA). TPRS is a bifunctional tetrameric enzyme (2 alpha and 2 beta subunits) that catalyzes the last two steps of L-tryptophan biosynthesis. Alpha and beta subunit catalyze two distinct reactions which are both...; Region: Tryptophan_synthase_alpha; cd04724
529507006331	substrate binding site [chemical binding]; other site
529507006332	active site
529507006333	catalytic residues [active]
529507006334	heterodimer interface [polypeptide binding]; other site
529507006335	HMMPfam hit to PF00290, Tryptophan synthase alpha chain, score 3.8e-129
529507006336	PS00167 Tryptophan synthase alpha chain signature.
529507006337	BON domain; Region: BON; pfam04972
529507006338	Signal peptide predicted for PMI1349 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.618 between residues 29 and 30
529507006339	PS00038 Myc-type, 'helix-loop-helix' dimerization domain signature.
529507006340	1 probable transmembrane helix predicted for PMI1349 by TMHMM2.0 at aa 7-29
529507006341	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507006342	HMMPfam hit to PF04972, phospholipid-binding domain, score 1.3e-13
529507006343	outer membrane protein W; Provisional; Region: PRK10959
529507006344	HMMPfam hit to PF03922, OmpW family, score 2.8e-84
529507006345	This hit extended beyond the end of the feature by 1 aa and was clipped.; PS00695 Enterobacterial virulence outer membrane protein signature 2.
529507006346	Signal peptide predicted for PMI1350 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.954 between residues 21 and 22
529507006347	Uncharacterized protein family (UPF0259); Region: UPF0259; cl11642
529507006348	HMMPfam hit to PF06790, Uncharacterised protein family (UPF0259), score 4.9e-12
529507006349	Signal peptide predicted for PMI1351 by SignalP 2.0 HMM (Signal peptide probability 0.609) with cleavage site probability 0.314 between residues 45 and 46
529507006350	5 probable transmembrane helices predicted for PMI1351 by TMHMM2.0 at aa 20-42, 85-107, 134-168, 189-208 and 223-245
529507006351	Sulfate permease and related transporters (MFS superfamily) [Inorganic ion transport and metabolism]; Region: SUL1; COG0659
529507006352	Sulfate transporter N-terminal domain with GLY motif; Region: Sulfate_tra_GLY; pfam13792
529507006353	Sulfate transporter family; Region: Sulfate_transp; pfam00916
529507006354	Sulphate Transporter and Anti-Sigma factor antagonist domain of SulP-like sulfate transporters, plays a role in the function and regulation of the transport activity, proposed general NTP binding function; Region: STAS_SulP_like_sulfate_transporter; cd07042
529507006355	HMMPfam hit to PF01740, STAS domain, score 0.0016
529507006356	HMMPfam hit to PF00916, Sulfate transporter family, score 3e-61
529507006357	11 probable transmembrane helices predicted for PMI1352 by TMHMM2.0 at aa 23-45, 49-71, 76-98, 108-127, 140-162, 182-199, 211-233, 260-282, 326-348, 352-374 and 394-416
529507006358	intracellular septation protein A; Reviewed; Region: PRK00259
529507006359	HMMPfam hit to PF04279, Intracellular septation protein A, score 4.5e-76
529507006360	5 probable transmembrane helices predicted for PMI1353 by TMHMM2.0 at aa 27-49, 56-73, 83-102, 124-146 and 156-175
529507006361	Brown fat-inducible thioesterase (BFIT).  Brain acyl-CoA hydrolase (BACH).  These enzymes deacylate long-chain fatty acids by hydrolyzing acyl-CoA thioesters to free fatty acids and CoA-SH. Eukaryotic members of this family are expressed in brain, testis; Region: BFIT_BACH; cd03442
529507006362	HMMPfam hit to PF03061, Thioesterase superfamily, score 3.7e-21
529507006363	transport protein TonB; Provisional; Region: PRK10819
529507006364	Gram-negative bacterial tonB protein; Region: TonB; pfam03544
529507006365	HMMPfam hit to PF03544, Gram-negative bacterial tonB protein, score 8e-13
529507006366	PS00018 EF-hand calcium-binding domain.
529507006367	1 probable transmembrane helix predicted for PMI1355 by TMHMM2.0 at aa 5-27
529507006368	Signal peptide predicted for PMI1355 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.824 between residues 20 and 21
529507006369	cardiolipin synthetase; Reviewed; Region: cls; PRK01642
529507006370	Phospholipase_D-nuclease N-terminal; Region: PLDc_N; pfam13396
529507006371	Catalytic domain, repeat 1, of Escherichia coli cardiolipin synthase and similar proteins; Region: PLDc_EcCLS_like_1; cd09152
529507006372	putative active site [active]
529507006373	catalytic site [active]
529507006374	Catalytic domain, repeat 2, of Escherichia coli cardiolipin synthase and similar proteins; Region: PLDc_EcCLS_like_2; cd09158
529507006375	putative active site [active]
529507006376	catalytic site [active]
529507006377	2 probable transmembrane helices predicted for PMI1357 by TMHMM2.0 at aa 10-29 and 36-58
529507006378	HMMPfam hit to PF00614, Phospholipase D Active site motif, score 2.4e-07
529507006379	HMMPfam hit to PF00614, Phospholipase D Active site motif, score 2.7e-07
529507006380	dsDNA-mimic protein; Reviewed; Region: PRK05094
529507006381	HMMPfam hit to PF04269, Protein of unknown function, DUF440, score 2.3e-33
529507006382	Outer membrane protein beta-barrel domain; Region: OMP_b-brl; cl17254
529507006383	HMMPfam hit to PF06316, Enterobacterial Ail/Lom protein, score 1.3e-13
529507006384	This hit extended beyond the end of the feature by 1 aa and was clipped.; PS00695 Enterobacterial virulence outer membrane protein signature 2.
529507006385	Signal peptide predicted for PMI1359 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.915 between residues 23 and 24
529507006386	This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases; Region: Glo_EDI_BRP_like_1; cd08352
529507006387	Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily; Region: Glyoxalase; pfam00903
529507006388	putative metal binding site [ion binding]; other site
529507006389	HMMPfam hit to PF00903, Glyoxalase/Bleomycin resistance protein/Di, score 2.7e-21
529507006390	Uncharacterized conserved protein [Function unknown]; Region: COG1359
529507006391	HMMPfam hit to PF03992, Antibiotic biosynthesis monooxygenase, score 4e-18
529507006392	leucine export protein LeuE; Provisional; Region: PRK10958
529507006393	6 probable transmembrane helices predicted for PMI1362 by TMHMM2.0 at aa 20-42, 51-73, 88-110, 130-152, 172-194 and 201-220
529507006394	HMMPfam hit to PF01810, LysE type translocator, score 9.9e-51
529507006395	tRNA 2-thiocytidine biosynthesis protein TtcA; Provisional; Region: PRK10696
529507006396	This is a subfamily of Adenine nucleotide alpha hydrolases superfamily.Adeninosine nucleotide alpha hydrolases superfamily  includes N type ATP PPases and ATP sulphurylases. It forms a apha/beta/apha fold which  binds to Adenosine group.  This subfamily; Region: Alpha_ANH_like_II; cd01993
529507006397	Ligand Binding Site [chemical binding]; other site
529507006398	HMMPfam hit to PF01171, PP-loop family, score 5.9e-13
529507006399	Mg2+ and Co2+ transporters [Inorganic ion transport and metabolism]; Region: CorA; COG0598
529507006400	Salmonella typhimurium Zn2+ transporter ZntB-like subgroup; Region: ZntB-like_1; cd12833
529507006401	Cl binding site [ion binding]; other site
529507006402	oligomer interface [polypeptide binding]; other site
529507006403	HMMPfam hit to PF01544, CorA-like Mg2+ transporter protein, score 8.9e-06
529507006404	2 probable transmembrane helices predicted for PMI1364 by TMHMM2.0 at aa 267-289 and 299-321
529507006405	Domain of unknown function (DUF4377); Region: DUF4377; pfam14302
529507006406	Signal peptide predicted for PMI1365 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.698 between residues 21 and 22
529507006407	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507006408	Outer membrane protein beta-barrel domain; Region: OMP_b-brl; pfam13505
529507006409	Signal peptide predicted for PMI1366 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.798 between residues 21 and 22
529507006410	oligopeptide ABC transporter substrate-binding protein OppA; Provisional; Region: PRK15104
529507006411	The substrate-binding component of an ABC-type oligopetide import system contains the type 2 periplasmic binding fold; Region: PBP2_OppA; cd08504
529507006412	peptide binding site [polypeptide binding]; other site
529507006413	HMMPfam hit to PF00496, Bacterial extracellular solute-binding prot, score 6.4e-80
529507006414	PS01040 Bacterial extracellular solute-binding proteins, family 5 signature.
529507006415	Signal peptide predicted for PMI1367 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.993 between residues 23 and 24
529507006416	Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx). Tpx is a...; Region: PRX_Atyp2cys; cd03014
529507006417	dimer interface [polypeptide binding]; other site
529507006418	catalytic triad [active]
529507006419	peroxidatic and resolving cysteines [active]
529507006420	HMMPfam hit to PF00578, AhpC/TSA family, score 2e-30
529507006421	PS01265 Tpx family signature.
529507006422	DNA-binding transcriptional regulator TyrR; Provisional; Region: PRK10820
529507006423	N-terminal ACT domain of the TyrR protein; Region: ACT_TyrR; cd04877
529507006424	putative aromatic amino acid binding site; other site
529507006425	PAS domain; Region: PAS; smart00091
529507006426	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
529507006427	Walker A motif; other site
529507006428	ATP binding site [chemical binding]; other site
529507006429	Walker B motif; other site
529507006430	arginine finger; other site
529507006431	Predicted helix-turn-helix motif with score 1652.000, SD 4.81 at aa 486-507, sequence PSTRKLAKRLGISHTAIANKLR
529507006432	PS00688 Sigma-54 interaction domain C-terminal part signature.
529507006433	HMMPfam hit to PF00158, Sigma-54 interaction domain, score 3.7e-118
529507006434	PS00675 Sigma-54 interaction domain ATP-binding region A signature.
529507006435	HMMPfam hit to PF01842, ACT domain, score 0.0004
529507006436	hypothetical protein; Provisional; Region: PRK05415
529507006437	Domain of unknown function (DUF697); Region: DUF697; cl12064
529507006438	HMMPfam hit to PF05128, Family of unknown function (DUF697), score 7e-168
529507006439	2 probable transmembrane helices predicted for PMI1371 by TMHMM2.0 at aa 69-88 and 98-120
529507006440	Predicted ATPase [General function prediction only]; Region: COG3106
529507006441	HMMPfam hit to PF04317, YcjX-like family, DUF463, score 4.2e-296
529507006442	PS00225 Crystallins beta and gamma 'Greek key' motif signature.
529507006443	PS00017 ATP/GTP-binding site motif A (P-loop).
529507006444	peripheral inner membrane phage-shock protein; Provisional; Region: PRK10497
529507006445	1 probable transmembrane helix predicted for PMI1373 by TMHMM2.0 at aa 22-44
529507006446	Signal peptide predicted for PMI1373 by SignalP 2.0 HMM (Signal peptide probability 0.995) with cleavage site probability 0.642 between residues 40 and 41
529507006447	DNA-binding transcriptional activator PspC; Provisional; Region: PRK10697
529507006448	phage shock protein C; Region: phageshock_pspC; TIGR02978
529507006449	HMMPfam hit to PF04024, PspC domain, score 4.2e-28
529507006450	1 probable transmembrane helix predicted for PMI1374 by TMHMM2.0 at aa 37-59
529507006451	phage shock protein B; Provisional; Region: pspB; PRK09458
529507006452	HMMPfam hit to PF06667, Phage shock protein B, score 1.1e-42
529507006453	1 probable transmembrane helix predicted for PMI1375 by TMHMM2.0 at aa 4-26
529507006454	phage shock protein PspA; Provisional; Region: PRK10698
529507006455	HMMPfam hit to PF04012, PspA/IM30 family, score 4.8e-54
529507006456	phage shock protein operon transcriptional activator; Provisional; Region: pspF; PRK11608
529507006457	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
529507006458	Walker A motif; other site
529507006459	ATP binding site [chemical binding]; other site
529507006460	Walker B motif; other site
529507006461	arginine finger; other site
529507006462	Bacterial regulatory protein, Fis family; Region: HTH_8; cl17420
529507006463	HMMPfam hit to PF00158, Sigma-54 interaction domain, score 2e-120
529507006464	PS00676 Sigma-54 interaction domain ATP-binding region B signature.
529507006465	PS00688 Sigma-54 interaction domain C-terminal part signature.
529507006466	Predicted helix-turn-helix motif with score 1039.000, SD 2.73 at aa 305-326, sequence YNQKMAAEKLALSYDQLRGLIK
529507006467	ABC-type dipeptide transport system, periplasmic component [Amino acid transport and metabolism]; Region: DdpA; COG0747
529507006468	The substrate-binding component of an ABC-type dipeptide import system contains the type 2 periplasmic binding fold; Region: PBP2_DppA_like; cd08493
529507006469	peptide binding site [polypeptide binding]; other site
529507006470	Signal peptide predicted for PMI1378 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.980 between residues 21 and 22
529507006471	HMMPfam hit to PF00496, Bacterial extracellular solute-binding prot, score 2.1e-78
529507006472	PS01040 Bacterial extracellular solute-binding proteins, family 5 signature.
529507006473	antimicrobial peptide ABC transporter permease SapB; Provisional; Region: PRK15110
529507006474	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
529507006475	putative PBP binding loops; other site
529507006476	ABC-ATPase subunit interface; other site
529507006477	Signal peptide predicted for PMI1379 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.441 between residues 25 and 26
529507006478	5 probable transmembrane helices predicted for PMI1379 by TMHMM2.0 at aa 9-31, 80-102, 114-136, 251-273 and 286-308
529507006479	HMMPfam hit to PF00528, Binding-protein-dependent transport syst, score 4.9e-53
529507006480	antimicrobial peptide ABC transporter permease SapC; Provisional; Region: PRK15111
529507006481	N-terminal TM domain of oligopeptide transport permease C; Region: OppC_N; pfam12911
529507006482	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
529507006483	dimer interface [polypeptide binding]; other site
529507006484	conserved gate region; other site
529507006485	putative PBP binding loops; other site
529507006486	ABC-ATPase subunit interface; other site
529507006487	5 probable transmembrane helices predicted for PMI1380 by TMHMM2.0 at aa 28-50, 100-122, 149-171, 224-246 and 261-283
529507006488	HMMPfam hit to PF00528, Binding-protein-dependent transport syst, score 4.7e-35
529507006489	antimicrobial peptide ABC transporter ATP-binding protein; Provisional; Region: PRK15093
529507006490	ATP-binding cassette domain of nickel/oligopeptides specific transporters; Region: ABC_NikE_OppD_transporters; cd03257
529507006491	Walker A/P-loop; other site
529507006492	ATP binding site [chemical binding]; other site
529507006493	Q-loop/lid; other site
529507006494	ABC transporter signature motif; other site
529507006495	Walker B; other site
529507006496	D-loop; other site
529507006497	H-loop/switch region; other site
529507006498	Oligopeptide/dipeptide transporter, C-terminal region; Region: oligo_HPY; cl07097
529507006499	HMMPfam hit to PF00005, ABC transporter, score 5.6e-56
529507006500	PS00017 ATP/GTP-binding site motif A (P-loop).
529507006501	antimicrobial peptide ABC system ATP-binding protein SapF; Provisional; Region: PRK15112
529507006502	ATP-binding cassette domain of nickel/oligopeptides specific transporters; Region: ABC_NikE_OppD_transporters; cd03257
529507006503	Walker A/P-loop; other site
529507006504	ATP binding site [chemical binding]; other site
529507006505	Q-loop/lid; other site
529507006506	ABC transporter signature motif; other site
529507006507	Walker B; other site
529507006508	D-loop; other site
529507006509	H-loop/switch region; other site
529507006510	HMMPfam hit to PF00005, ABC transporter, score 3.8e-61
529507006511	PS00017 ATP/GTP-binding site motif A (P-loop).
529507006512	PS00211 ABC transporters family signature.
529507006513	enoyl-(acyl carrier protein) reductase; Provisional; Region: PRK07984
529507006514	Enoyl acyl carrier protein (ACP) reductase (ENR), divergent SDR; Region: ENR_SDR; cd05372
529507006515	NAD binding site [chemical binding]; other site
529507006516	homotetramer interface [polypeptide binding]; other site
529507006517	homodimer interface [polypeptide binding]; other site
529507006518	substrate binding site [chemical binding]; other site
529507006519	active site
529507006520	HMMPfam hit to PF00106, short chain dehydrogenase, score 1.3e-09
529507006521	glutathionine S-transferase; Provisional; Region: PRK10542
529507006522	GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens; Region: GST_N_Beta; cd03057
529507006523	C-terminal domain interface [polypeptide binding]; other site
529507006524	GSH binding site (G-site) [chemical binding]; other site
529507006525	dimer interface [polypeptide binding]; other site
529507006526	C-terminal, alpha helical domain of Class Beta Glutathione S-transferases; Region: GST_C_Beta; cd03188
529507006527	dimer interface [polypeptide binding]; other site
529507006528	N-terminal domain interface [polypeptide binding]; other site
529507006529	substrate binding pocket (H-site) [chemical binding]; other site
529507006530	HMMPfam hit to PF02798, Glutathione S-transferase, N-terminal domain, score 3.4e-24
529507006531	HMMPfam hit to PF00043, Glutathione S-transferase, C-terminal domain, score 9.3e-20
529507006532	pyridoxamine kinase; Validated; Region: PRK05756
529507006533	Pyridoxal kinase plays a key role in the synthesis of the active coenzyme pyridoxal-5'-phosphate  (PLP), by catalyzing the phosphorylation of the precursor vitamin B6  in the presence of Zn2+ and ATP. Mammals are unable to synthesize PLP de novo and...; Region: pyridoxal_pyridoxamine_kinase; cd01173
529507006534	dimer interface [polypeptide binding]; other site
529507006535	pyridoxal binding site [chemical binding]; other site
529507006536	ATP binding site [chemical binding]; other site
529507006537	tyrosyl-tRNA synthetase; Validated; Region: PRK05912
529507006538	catalytic core domain of tyrosinyl-tRNA synthetase; Region: TyrRS_core; cd00805
529507006539	active site
529507006540	HIGH motif; other site
529507006541	dimer interface [polypeptide binding]; other site
529507006542	KMSKS motif; other site
529507006543	S4/Hsp/ tRNA synthetase RNA-binding domain; The domain surface is populated by conserved, charged residues that define a likely RNA-binding site;  Found in stress proteins, ribosomal proteins and tRNA synthetases; This may imply a hitherto unrecognized...; Region: S4; cd00165
529507006544	RNA binding surface [nucleotide binding]; other site
529507006545	HMMPfam hit to PF01479, S4 domain, score 8.2e-06
529507006546	HMMPfam hit to PF00579, tRNA synthetases class I (W and Y), score 9.1e-126
529507006547	PS00178 Aminoacyl-transfer RNA synthetases class-I signature.
529507006548	pyridoxamine 5'-phosphate oxidase; Provisional; Region: PRK05679
529507006549	Pyridoxamine 5'-phosphate oxidase; Region: Pyridox_oxidase; pfam01243
529507006550	Pyridoxine 5'-phosphate oxidase C-terminal dimerisation region; Region: PNPOx_C; pfam10590
529507006551	PS01064 Pyridoxamine 5'-phosphate oxidase signature.
529507006552	HMMPfam hit to PF01243, Pyridoxamine 5'-phosphate oxidase, score 5.8e-30
529507006553	anhydro-N-acetylmuramic acid kinase; Reviewed; Region: anmK; PRK09585
529507006554	HMMPfam hit to PF03702, Uncharacterised protein family (UPF0075), score 6.1e-230
529507006555	Glycine zipper 2TM domain; Region: Rick_17kDa_Anti; cl10470
529507006556	Signal peptide predicted for PMI1389 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.476 between residues 25 and 26
529507006557	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507006558	HMMPfam hit to PF05433, Rickettsia 17 kDa surface antigen, score 1e-11
529507006559	transcriptional regulator SlyA; Provisional; Region: PRK03573
529507006560	MarR family; Region: MarR; pfam01047
529507006561	HMMPfam hit to PF01047, MarR family, score 1.1e-25
529507006562	Predicted helix-turn-helix motif with score 1097.000, SD 2.92 at aa 47-68, sequence QSQIQLAKAIGIEQPSLVRTLD
529507006563	Predicted Fe-S protein [General function prediction only]; Region: COG3313
529507006564	HMMPfam hit to PF06945, Protein of unknown function (DUF1289), score 1.5e-21
529507006565	Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily; Region: Glyoxalase; pfam00903
529507006566	Glyoxalase I catalyzes the isomerization of the hemithioacetal, formed by a 2-oxoaldehyde and glutathione, to S-D-lactoylglutathione; Region: Glyoxalase_I; cd07233
529507006567	dimer interface [polypeptide binding]; other site
529507006568	active site
529507006569	metal binding site [ion binding]; metal-binding site
529507006570	glutathione binding site [chemical binding]; other site
529507006571	HMMPfam hit to PF00903, Glyoxalase/Bleomycin resistance protein/Di, score 3.7e-44
529507006572	PS00934 Glyoxalase I signature 1.
529507006573	PS00935 Glyoxalase I signature 2.
529507006574	DNA polymerase III, epsilon subunit and related 3'-5' exonucleases [DNA replication, recombination, and repair]; Region: DnaQ; COG0847
529507006575	DEDDh 3'-5' exonuclease domain of RNase T; Region: RNaseT; cd06134
529507006576	dimer interface [polypeptide binding]; other site
529507006577	catalytic site [active]
529507006578	putative active site [active]
529507006579	putative substrate binding site [chemical binding]; other site
529507006580	HMMPfam hit to PF00929, Exonuclease, score 7.1e-33
529507006581	Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins. The non-PICOT members of this family contain only the GRX-like domain, whereas PICOT contains an N-terminal TRX-like domain...; Region: GRX_PICOT_like; cd03028
529507006582	putative GSH binding site [chemical binding]; other site
529507006583	catalytic residues [active]
529507006584	HMMPfam hit to PF00462, Glutaredoxin, score 0.00013
529507006585	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507006586	TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure. Specific for this family is the conserved phosphate binding site at the edges of strands 7 and 8. The phosphate...; Region: TIM_phosphate_binding; cl17186
529507006587	Predicted permeases [General function prediction only]; Region: COG0730
529507006588	Signal peptide predicted for PMI1396 by SignalP 2.0 HMM (Signal peptide probability 0.612) with cleavage site probability 0.264 between residues 18 and 19
529507006589	8 probable transmembrane helices predicted for PMI1396 by TMHMM2.0 at aa 5-36, 46-68, 75-97, 107-124, 145-167, 182-204, 216-238 and 248-270
529507006590	HMMPfam hit to PF01925, Domain of unknown function DUF81, score 1.8e-33
529507006591	PS00107 Protein kinases ATP-binding region signature.
529507006592	superoxide dismutase; Provisional; Region: PRK10543
529507006593	Iron/manganese superoxide dismutases, alpha-hairpin domain; Region: Sod_Fe_N; pfam00081
529507006594	Iron/manganese superoxide dismutases, C-terminal domain; Region: Sod_Fe_C; pfam02777
529507006595	HMMPfam hit to PF00081, Iron/manganese superoxide dismutases, alpha-, score 4.4e-53
529507006596	HMMPfam hit to PF02777, Iron/manganese superoxide dismutases, C-term, score 9.5e-67
529507006597	PS00088 Manganese and iron superoxide dismutases signature.
529507006598	DNA-binding transcriptional repressor PurR; Provisional; Region: PRK10703
529507006599	Helix-turn-helix (HTH) DNA binding domain of the LacI family of transcriptional regulators; Region: HTH_LacI; cd01392
529507006600	DNA binding site [nucleotide binding]
529507006601	domain linker motif; other site
529507006602	Ligand-binding domain of purine repressor, PurR, which functions as the master regulatory protein of de novo purine nucleotide biosynthesis in Escherichia coli; Region: PBP1_PurR; cd06275
529507006603	dimerization interface [polypeptide binding]; other site
529507006604	ligand binding site [chemical binding]; other site
529507006605	HMMPfam hit to PF00356, Bacterial regulatory proteins, lacI fami, score 3.6e-12
529507006606	Predicted helix-turn-helix motif with score 2093.000, SD 6.32 at aa 2-23, sequence ATIKDVAKRAGVSTTTVSHVIN
529507006607	PS00356 Bacterial regulatory proteins, lacI family signature.
529507006608	HMMPfam hit to PF00532, Periplasmic binding proteins and sugar b, score 2.4e-27
529507006609	putative DNA-binding transcriptional regulator; Provisional; Region: PRK11074
529507006610	Bacterial regulatory helix-turn-helix protein, lysR family; Region: HTH_1; pfam00126
529507006611	The substrate binding domain of LysR-type transcriptional regulators (LTTRs), a member of the type 2 periplasmic binding fold protein superfamily; Region: PBP2_LTTR_substrate; cl11398
529507006612	dimerization interface [polypeptide binding]; other site
529507006613	HMMPfam hit to PF03466, LysR substrate binding domain, score 4.9e-28
529507006614	HMMPfam hit to PF00126, Bacterial regulatory helix-turn-helix, score 1.7e-18
529507006615	PS00044 Bacterial regulatory proteins, lysR family signature.
529507006616	Predicted helix-turn-helix motif with score 1104.000, SD 2.95 at aa 17-38, sequence GSFSSAAQELHRVPSAVSYTVR
529507006617	putative transporter; Provisional; Region: PRK11043
529507006618	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507006619	putative substrate translocation pore; other site
529507006620	Signal peptide predicted for PMI1401 by SignalP 2.0 HMM (Signal peptide probability 0.862) with cleavage site probability 0.539 between residues 29 and 30
529507006621	12 probable transmembrane helices predicted for PMI1401 by TMHMM2.0 at aa 13-35, 50-72, 81-100, 105-127, 139-161, 166-188, 218-240, 250-272, 279-298, 308-330, 343-365 and 370-390
529507006622	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 3.9e-51
529507006623	cyclopropane fatty acyl phospholipid synthase; Provisional; Region: PRK11705
529507006624	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cl17173
529507006625	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
529507006626	S-adenosylmethionine binding site [chemical binding]; other site
529507006627	HMMPfam hit to PF02353, Cyclopropane-fatty-acyl-phospholipid synthas, score 1.8e-77
529507006628	riboflavin synthase subunit alpha; Provisional; Region: PRK13020
529507006629	Lumazine binding domain; Region: Lum_binding; pfam00677
529507006630	Lumazine binding domain; Region: Lum_binding; pfam00677
529507006631	HMMPfam hit to PF00677, Lumazine binding domain, score 4.5e-39
529507006632	PS00693 Riboflavin synthase alpha chain family signature.
529507006633	HMMPfam hit to PF00677, Lumazine binding domain, score 8e-35
529507006634	PS00693 Riboflavin synthase alpha chain family signature.
529507006635	multidrug efflux protein; Reviewed; Region: PRK01766
529507006636	Subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins similar to Vibrio cholerae NorM; Region: MATE_NorM_like; cd13131
529507006637	cation binding site [ion binding]; other site
529507006638	Signal peptide predicted for PMI1404 by SignalP 2.0 HMM (Signal peptide probability 0.729) with cleavage site probability 0.347 between residues 41 and 42
529507006639	12 probable transmembrane helices predicted for PMI1404 by TMHMM2.0 at aa 26-48, 63-85, 108-130, 145-164, 177-196, 200-222, 258-280, 295-317, 330-352, 367-384, 404-423 and 438-460
529507006640	HMMPfam hit to PF01554, MatE, score 9.9e-38
529507006641	HMMPfam hit to PF01554, MatE, score 7.7e-49
529507006642	pyruvate kinase; Provisional; Region: PRK09206
529507006643	Pyruvate kinase (PK):  Large allosteric enzyme that regulates glycolysis through binding of the substrate, phosphoenolpyruvate, and one or more allosteric effectors. Like other allosteric enzymes, PK has a high substrate affinity R state and a low...; Region: Pyruvate_Kinase; cd00288
529507006644	domain interfaces; other site
529507006645	active site
529507006646	HMMPfam hit to PF00224, Pyruvate kinase, barrel domain, score 6.1e-209
529507006647	PS00110 Pyruvate kinase active site signature.
529507006648	HMMPfam hit to PF02887, Pyruvate kinase, alpha/beta domain, score 7.4e-27
529507006649	glutamate:gamma-aminobutyrate antiporter; Region: 2A0307_GadC; TIGR00910
529507006650	HMMPfam hit to PF00324, Amino acid permease, score 1.8e-05
529507006651	12 probable transmembrane helices predicted for PMI1406 by TMHMM2.0 at aa 43-60, 70-92, 125-147, 162-181, 188-210, 225-247, 268-290, 318-340, 365-387, 397-419, 440-462 and 477-499
529507006652	Signal peptide predicted for PMI1406 by SignalP 2.0 HMM (Signal peptide probability 0.881) with cleavage site probability 0.778 between residues 28 and 29
529507006653	DOPA decarboxylase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD correspond to DOPA/tyrosine decarboxylase (DDC), histidine decarboxylase (HDC), and...; Region: DOPA_deC_like; cd06450
529507006654	pyridoxal 5'-phosphate binding site [chemical binding]; other site
529507006655	catalytic residue [active]
529507006656	HMMPfam hit to PF00282, Pyridoxal-dependent decarboxylase conse, score 6.7e-108
529507006657	The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid.  N-terminal nucleophile (NTN-) hydrolase superfamily, which contains a...; Region: Ntn_hydrolase; cl00467
529507006658	Linear amide C-N hydrolases, choloylglycine hydrolase family; Region: CBAH; pfam02275
529507006659	active site
529507006660	HMMPfam hit to PF02275, Linear amide C-N hydrolases, choloylglycine, score 1.6e-13
529507006661	Murein lipoprotein [Cell envelope biogenesis, outer membrane]; Region: COG4238; cl11539
529507006662	Signal peptide predicted for PMI1409 by SignalP 2.0 HMM (Signal peptide probability 0.879) with cleavage site probability 0.446 between residues 50 and 51
529507006663	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507006664	HMMPfam hit to PF04728, Repeated sequence found in lipoprotein LPP, score 0.026
529507006665	L,D-transpeptidase; Provisional; Region: PRK10190
529507006666	Lysine Motif is a small domain involved in binding peptidoglycan; Region: LysM; cd00118
529507006667	L,D-transpeptidase catalytic domain; Region: YkuD; pfam03734
529507006668	HMMPfam hit to PF03734, ErfK/YbiS/YcfS/YnhG, score 3.1e-63
529507006669	HMMPfam hit to PF01476, LysM domain, score 0.0012
529507006670	Signal peptide predicted for PMI1410 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.997 between residues 22 and 23
529507006671	Fe-S metabolism associated domain; Region: SufE; cl00951
529507006672	HMMPfam hit to PF02657, Fe-S metabolism associated domain, score 4.4e-39
529507006673	Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones]; Region: csdA; COG0520
529507006674	Cysteine desulfurase (SufS)-like. This family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD correspond to cysteine desulfurase (SufS) and selenocysteine lyase. SufS...; Region: SufS_like; cd06453
529507006675	pyridoxal 5'-phosphate binding pocket [chemical binding]; other site
529507006676	catalytic residue [active]
529507006677	HMMPfam hit to PF00266, Aminotransferase class-V, score 2.2e-13
529507006678	PS00595 Aminotransferases class-V pyridoxal-phosphate attachment site.
529507006679	cysteine desulfurase activator complex subunit SufD; Provisional; Region: PRK10948
529507006680	FeS assembly protein SufD; Region: sufD; TIGR01981
529507006681	HMMPfam hit to PF01458, Uncharacterized protein family (UPF0051), score 9.9e-82
529507006682	cysteine desulfurase ATPase component; Reviewed; Region: sufC; PRK09580
529507006683	ABC-type transport system involved in Fe-S cluster assembly, ATPase component; Region: ABC_FeS_Assembly; cd03217
529507006684	Walker A/P-loop; other site
529507006685	ATP binding site [chemical binding]; other site
529507006686	Q-loop/lid; other site
529507006687	ABC transporter signature motif; other site
529507006688	Walker B; other site
529507006689	D-loop; other site
529507006690	H-loop/switch region; other site
529507006691	HMMPfam hit to PF00005, ABC transporter, score 5.3e-32
529507006692	PS00211 ABC transporters family signature.
529507006693	PS00017 ATP/GTP-binding site motif A (P-loop).
529507006694	cysteine desulfurase activator complex subunit SufB; Provisional; Region: PRK11814
529507006695	putative ABC transporter; Region: ycf24; CHL00085
529507006696	HMMPfam hit to PF01458, Uncharacterized protein family (UPF0051), score 3.1e-140
529507006697	Iron-sulphur cluster biosynthesis; Region: Fe-S_biosyn; cl00400
529507006698	HMMPfam hit to PF01521, HesB-like domain, score 3.3e-39
529507006699	PS01152 Hypothetical hesB/yadR/yfhF family signature.
529507006700	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507006701	Signal peptide predicted for PMI1417 by SignalP 2.0 HMM (Signal peptide probability 0.830) with cleavage site probability 0.752 between residues 22 and 23
529507006702	PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria.  Although orthologs of PaaI exist in archaea and eukaryotes, their function has not...; Region: PaaI_thioesterase; cd03443
529507006703	CoenzymeA binding site [chemical binding]; other site
529507006704	subunit interaction site [polypeptide binding]; other site
529507006705	PHB binding site; other site
529507006706	HMMPfam hit to PF03061, Thioesterase superfamily, score 1.6e-17
529507006707	FAD/FMN-containing dehydrogenases [Energy production and conversion]; Region: GlcD; COG0277
529507006708	FAD binding domain; Region: FAD_binding_4; pfam01565
529507006709	Fe-S oxidoreductase [Energy production and conversion]; Region: GlpC; COG0247
529507006710	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
529507006711	HMMPfam hit to PF02913, FAD linked oxidases, C-terminal domain, score 4.3e-69
529507006712	HMMPfam hit to PF01565, FAD binding domain, score 1.1e-53
529507006713	PS00017 ATP/GTP-binding site motif A (P-loop).
529507006714	Predicted permease, member of the PurR regulon [General function prediction only]; Region: yhhT; cl00465
529507006715	Domain of unknown function DUF20; Region: UPF0118; pfam01594
529507006716	8 probable transmembrane helices predicted for PMI1420 by TMHMM2.0 at aa 13-30, 34-56, 63-85, 160-179, 213-235, 240-271, 278-300 and 315-337
529507006717	HMMPfam hit to PF01594, Domain of unknown function DUF20, score 1.6e-45
529507006718	phosphoenolpyruvate synthase; Validated; Region: PRK06464
529507006719	Pyruvate phosphate dikinase, PEP/pyruvate binding domain; Region: PPDK_N; pfam01326
529507006720	PEP-utilising enzyme, mobile domain; Region: PEP-utilizers; pfam00391
529507006721	PEP-utilising enzyme, TIM barrel domain; Region: PEP-utilizers_C; pfam02896
529507006722	HMMPfam hit to PF02896, PEP-utilising enzyme, TIM barrel doma, score 2.4e-51
529507006723	PS00742 PEP-utilizing enzymes signature 2.
529507006724	HMMPfam hit to PF00391, PEP-utilising enzyme, mobile domain, score 2.8e-42
529507006725	PS00370 PEP-utilizing enzymes phosphorylation site signature.
529507006726	HMMPfam hit to PF01326, Pyruvate phosphate dikinase, PEP/pyru, score 5.9e-157
529507006727	PEP synthetase regulatory protein; Provisional; Region: PRK05339
529507006728	HMMPfam hit to PF03618, Domain of unknown function (DUF299), score 3.8e-137
529507006729	PS00017 ATP/GTP-binding site motif A (P-loop).
529507006730	phospho-2-dehydro-3-deoxyheptonate aldolase; Provisional; Region: PRK12756
529507006731	DAHP synthetase I family; Region: DAHP_synth_1; pfam00793
529507006732	Predicted helix-turn-helix motif with score 1114.000, SD 2.98 at aa 16-37, sequence VTPETLANELPISQEIISNITS
529507006733	HMMPfam hit to PF00793, DAHP synthetase I family, score 3.1e-152
529507006734	Hemin uptake protein hemP; Region: hemP; pfam10636
529507006735	TonB-dependent heme/hemoglobin receptor family protein; Region: TonB-hemin; TIGR01785
529507006736	TonB dependent/Ligand-Gated channels are created by a monomeric 22 strand (22,24) anti-parallel beta-barrel. Ligands apparently bind to the large extracellular loops. The N-terminal 150-200 residues form a plug from the periplasmic end of barrel; Region: ligand_gated_channel; cd01347
529507006737	N-terminal plug; other site
529507006738	ligand-binding site [chemical binding]; other site
529507006739	PS00430 TonB-dependent receptor proteins signature 1.
529507006740	Signal peptide predicted for PMI1425 by SignalP 2.0 HMM (Signal peptide probability 0.996) with cleavage site probability 0.995 between residues 32 and 33
529507006741	HMMPfam hit to PF07715, TonB-dependent Receptor Plug Domain, score 7.8e-17
529507006742	HMMPfam hit to PF00593, TonB dependent receptor, score 1.8e-17
529507006743	TonB-dependent heme/hemoglobin receptor family protein; Region: TonB-hemin; TIGR01785
529507006744	TonB dependent/Ligand-Gated channels are created by a monomeric 22 strand (22,24) anti-parallel beta-barrel. Ligands apparently bind to the large extracellular loops. The N-terminal 150-200 residues form a plug from the periplasmic end of barrel; Region: ligand_gated_channel; cd01347
529507006745	N-terminal plug; other site
529507006746	ligand-binding site [chemical binding]; other site
529507006747	Signal peptide predicted for PMI1426 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.996 between residues 24 and 25
529507006748	HMMPfam hit to PF07715, TonB-dependent Receptor Plug Domain, score 8.8e-24
529507006749	HMMPfam hit to PF00593, TonB dependent receptor, score 3.9e-24
529507006750	Putative heme degradation protein [Inorganic ion transport and metabolism]; Region: HemS; COG3720
529507006751	Haemin-degrading HemS.ChuX domain; Region: HemS; pfam05171
529507006752	Haemin-degrading HemS.ChuX domain; Region: HemS; pfam05171
529507006753	HMMPfam hit to PF05171, Haemin-degrading family, score 1.2e-86
529507006754	Hemin binding protein HutB.  These proteins have been shown to function as initial receptors in ABC transport of hemin and hemoproteins in many eubacterial species.  They belong to the TroA superfamily of periplasmic metal binding proteins that share a...; Region: HutB; cd01149
529507006755	Periplasmic binding protein; Region: Peripla_BP_2; pfam01497
529507006756	putative hemin binding site; other site
529507006757	Signal peptide predicted for PMI1428 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.993 between residues 19 and 20
529507006758	HMMPfam hit to PF01497, Periplasmic binding protein, score 4.4e-43
529507006759	iron-hydroxamate transporter permease subunit; Provisional; Region: PRK10577
529507006760	Transmembrane subunit (TM), of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters involved in the uptake of siderophores, heme, vitamin B12, or the divalent cations Mg2+ and Zn2+. PBP-dependent ABC transporters consist of...; Region: TM_ABC_iron-siderophores_like; cd06550
529507006761	ABC-ATPase subunit  interface; other site
529507006762	dimer interface [polypeptide binding]; other site
529507006763	putative PBP binding regions; other site
529507006764	Signal peptide predicted for PMI1429 by SignalP 2.0 HMM (Signal peptide probability 0.993) with cleavage site probability 0.312 between residues 28 and 29
529507006765	9 probable transmembrane helices predicted for PMI1429 by TMHMM2.0 at aa 10-32, 60-79, 89-111, 116-138, 148-170, 191-210, 237-259, 272-294 and 304-326
529507006766	HMMPfam hit to PF01032, FecCD transport family, score 8.5e-123
529507006767	hemin importer ATP-binding subunit; Provisional; Region: hmuV; PRK13548
529507006768	ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins; Region: ABC_Iron-Siderophores_B12_Hemin; cd03214
529507006769	Walker A/P-loop; other site
529507006770	ATP binding site [chemical binding]; other site
529507006771	Q-loop/lid; other site
529507006772	ABC transporter signature motif; other site
529507006773	Walker B; other site
529507006774	D-loop; other site
529507006775	H-loop/switch region; other site
529507006776	HMMPfam hit to PF00005, ABC transporter, score 7.9e-36
529507006777	PS00017 ATP/GTP-binding site motif A (P-loop).
529507006778	PS00211 ABC transporters family signature.
529507006779	Transcriptional regulators [Transcription]; Region: Lrp; COG1522
529507006780	Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to...; Region: HTH_ARSR; cd00090
529507006781	dimerization interface [polypeptide binding]; other site
529507006782	putative DNA binding site [nucleotide binding]; other site
529507006783	putative Zn2+ binding site [ion binding]; other site
529507006784	AsnC family; Region: AsnC_trans_reg; pfam01037
529507006785	HMMPfam hit to PF01037, AsnC family, score 9.9e-39
529507006786	Predicted helix-turn-helix motif with score 1084.000, SD 2.88 at aa 23-44, sequence IQNIELAKEVGLSPSPCLRRVR
529507006787	Putative threonine efflux protein [Amino acid transport and metabolism]; Region: RhtB; COG1280
529507006788	Signal peptide predicted for PMI1432 by SignalP 2.0 HMM (Signal peptide probability 0.817) with cleavage site probability 0.786 between residues 33 and 34
529507006789	5 probable transmembrane helices predicted for PMI1432 by TMHMM2.0 at aa 13-35, 45-67, 79-101, 121-143 and 156-178
529507006790	HMMPfam hit to PF01810, LysE type translocator, score 1.8e-27
529507006791	Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism]; Region: ARO8; COG1167
529507006792	Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators; Region: WHTH_GntR; cd07377
529507006793	DNA-binding site [nucleotide binding]; DNA binding site
529507006794	Aspartate aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). Pyridoxal phosphate combines with an alpha-amino acid to form a compound called a Schiff base or aldimine...; Region: AAT_like; cd00609
529507006795	pyridoxal 5'-phosphate binding site [chemical binding]; other site
529507006796	homodimer interface [polypeptide binding]; other site
529507006797	catalytic residue [active]
529507006798	HMMPfam hit to PF00392, Bacterial regulatory proteins, gntR family, score 4.6e-14
529507006799	Bacterial Cytochrome Ubiquinol Oxidase; Region: Bac_Ubq_Cox; pfam01654
529507006800	HMMPfam hit to PF01654, Bacterial Cytochrome Ubiquinol Oxidase, score 1.5e-218
529507006801	9 probable transmembrane helices predicted for PMI1434 by TMHMM2.0 at aa 25-47, 60-82, 102-124, 131-153, 190-212, 225-242, 327-349, 361-383 and 412-434
529507006802	Cytochrome oxidase subunit II; Region: Cyto_ox_2; pfam02322
529507006803	cytochrome d ubiquinol oxidase subunit 2; Provisional; Region: PRK15003; cl12219
529507006804	HMMPfam hit to PF02322, Cytochrome oxidase subunit II, score 1.1e-148
529507006805	8 probable transmembrane helices predicted for PMI1435 by TMHMM2.0 at aa 7-26, 74-96, 117-139, 159-181, 194-216, 226-248, 260-282 and 302-324
529507006806	Protein of unknown function (DUF2474); Region: DUF2474; pfam10617
529507006807	Signal peptide predicted for PMI1436 by SignalP 2.0 HMM (Signal peptide probability 0.699) with cleavage site probability 0.233 between residues 46 and 47
529507006808	1 probable transmembrane helix predicted for PMI1436 by TMHMM2.0 at aa 22-44
529507006809	Siderophore-interacting protein [Inorganic ion transport and metabolism]; Region: ViuB; COG2375
529507006810	Siderophore interacting proteins share the domain structure of the ferredoxin reductase like family. Siderophores are produced in various bacteria (and some plants) to extract iron from hosts. Binding constants are high, so iron can be pilfered from...; Region: siderophore_interacting; cd06193
529507006811	FAD binding pocket [chemical binding]; other site
529507006812	FAD binding motif [chemical binding]; other site
529507006813	phosphate binding motif [ion binding]; other site
529507006814	NAD binding pocket [chemical binding]; other site
529507006815	HMMPfam hit to PF04954, Siderophore-interacting protein, score 6.4e-44
529507006816	Protein of unknown function (DUF805); Region: DUF805; pfam05656
529507006817	HMMPfam hit to PF05656, Protein of unknown function (DUF805), score 8.9e-48
529507006818	3 probable transmembrane helices predicted for PMI1438 by TMHMM2.0 at aa 24-46, 56-78 and 90-112
529507006819	hypothetical protein; Provisional; Region: PRK10536
529507006820	HMMPfam hit to PF02562, PhoH-like protein, score 4.7e-129
529507006821	PS00017 ATP/GTP-binding site motif A (P-loop).
529507006822	Putative protein-S-isoprenylcysteine methyltransferase [Posttranslational modification, protein turnover, chaperones]; Region: STE14; COG2020
529507006823	3 probable transmembrane helices predicted for PMI1440 by TMHMM2.0 at aa 6-28, 35-57 and 92-114
529507006824	DNA-specific endonuclease I; Provisional; Region: PRK15137
529507006825	Endonuclease I; Region: Endonuclease_1; pfam04231
529507006826	HMMPfam hit to PF04231, Endonuclease I, score 5.4e-91
529507006827	1 probable transmembrane helix predicted for PMI1441 by TMHMM2.0 at aa 7-26
529507006828	Signal peptide predicted for PMI1441 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.915 between residues 23 and 24
529507006829	hypothetical protein; Provisional; Region: PRK09917
529507006830	4 probable transmembrane helices predicted for PMI1443 by TMHMM2.0 at aa 7-29, 58-80, 92-114 and 134-156
529507006831	Uncharacterized conserved protein [Function unknown]; Region: COG2966
529507006832	Protein of unknown function (DUF1212); Region: DUF1212; pfam06738
529507006833	4 probable transmembrane helices predicted for PMI1444 by TMHMM2.0 at aa 125-147, 173-195, 202-224 and 239-261
529507006834	HMMPfam hit to PF06738, Protein of unknown function (DUF1212), score 1.1e-68
529507006835	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507006836	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
529507006837	AAA domain; Region: AAA_21; pfam13304
529507006838	Walker A/P-loop; other site
529507006839	ATP binding site [chemical binding]; other site
529507006840	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
529507006841	Q-loop/lid; other site
529507006842	ABC transporter signature motif; other site
529507006843	Walker B; other site
529507006844	D-loop; other site
529507006845	H-loop/switch region; other site
529507006846	PS00017 ATP/GTP-binding site motif A (P-loop).
529507006847	hypothetical protein; Provisional; Region: PRK10215
529507006848	Signal peptide predicted for PMI1448 by SignalP 2.0 HMM (Signal peptide probability 0.985) with cleavage site probability 0.400 between residues 34 and 35
529507006849	1 probable transmembrane helix predicted for PMI1448 by TMHMM2.0 at aa 10-32
529507006850	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507006851	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
529507006852	Usp: Universal stress protein family. The universal stress protein Usp is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. Usp enhances the rate of cell survival during prolonged exposure to...; Region: USP_Like; cd00293
529507006853	Ligand Binding Site [chemical binding]; other site
529507006854	HMMPfam hit to PF00582, Universal stress protein family, score 4.4e-20
529507006855	2 probable transmembrane helices predicted for PMI1450 by TMHMM2.0 at aa 21-43 and 75-97
529507006856	Usp: Universal stress protein family. The universal stress protein Usp is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. Usp enhances the rate of cell survival during prolonged exposure to...; Region: USP_Like; cd00293
529507006857	Ligand Binding Site [chemical binding]; other site
529507006858	HMMPfam hit to PF00582, Universal stress protein family, score 3.8e-20
529507006859	B.subtilis YXKO protein of unknown function and related proteins. Based on the conservation of the ATP binding site, the substrate binding site and the Mg2+binding site and structural homology this group is a member of the ribokinase-like superfamily; Region: YXKO-related; cd01171
529507006860	putative substrate binding site [chemical binding]; other site
529507006861	putative ATP binding site [chemical binding]; other site
529507006862	HMMPfam hit to PF01256, Carbohydrate kinase, score 1.8e-52
529507006863	PS01050 Uncharacterized protein family UPF0031 signature 2.
529507006864	PS00017 ATP/GTP-binding site motif A (P-loop).
529507006865	hypothetical protein; Provisional; Region: PRK10613
529507006866	Signal peptide predicted for PMI1454 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.960 between residues 21 and 22
529507006867	Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the...; Region: ALAD_PBGS; cd00384
529507006868	dimer interface [polypeptide binding]; other site
529507006869	active site
529507006870	Schiff base residues; other site
529507006871	HMMPfam hit to PF00490, Delta-aminolevulinic acid dehydratase, score 9.4e-204
529507006872	PS00169 Delta-aminolevulinic acid dehydratase active site.
529507006873	Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases [Nucleotide transport and metabolism / Carbohydrate transport and metabolism / General function prediction only]; Region: Hit; COG0537
529507006874	nucleotide binding site/active site [active]
529507006875	catalytic residue [active]
529507006876	HMMPfam hit to PF01230, HIT domain, score 6e-14
529507006877	cytosine deaminase; Provisional; Region: PRK09230
529507006878	Bacterial cytosine deaminase and related metal-dependent hydrolases. Cytosine deaminases (CDs) catalyze the deamination of cytosine, producing uracil and ammonia. They play an important role in pyrimidine salvage. CDs are present in prokaryotes and fungi; Region: Bact_CD; cd01293
529507006879	active site
529507006880	nucleobase-cation-symport-1 (NCS1) transporter CobB-like; solute-binding domain; Region: SLC-NCS1sbd_CobB-like; cd11484
529507006881	Permease for cytosine/purines, uracil, thiamine, allantoin; Region: Transp_cyt_pur; pfam02133
529507006882	Na binding site [ion binding]; other site
529507006883	putative substrate binding site [chemical binding]; other site
529507006884	12 probable transmembrane helices predicted for PMI1458 by TMHMM2.0 at aa 21-43, 53-75, 96-118, 128-150, 152-174, 194-216, 223-245, 255-277, 289-311, 321-340, 360-379 and 383-402
529507006885	HMMPfam hit to PF02133, Permease for cytosine/purines, uracil,, score 1.2e-96
529507006886	Signal peptide predicted for PMI1458 by SignalP 2.0 HMM (Signal peptide probability 0.695) with cleavage site probability 0.604 between residues 44 and 45
529507006887	choline dehydrogenase; Validated; Region: PRK02106
529507006888	GMC oxidoreductase; Region: GMC_oxred_C; pfam05199
529507006889	HMMPfam hit to PF05199, GMC oxidoreductase, score 2.2e-99
529507006890	HMMPfam hit to PF00732, GMC oxidoreductase, score 6.6e-157
529507006891	PS00624 GMC oxidoreductases signature 2.
529507006892	PS00623 GMC oxidoreductases signature 1.
529507006893	betaine aldehyde dehydrogenase; Provisional; Region: PRK13252
529507006894	NAD+-dependent 4-trimethylaminobutyraldehyde dehydrogenase, ALDH family 9A1; Region: ALDH_F9_TMBADH; cd07090
529507006895	tetrameric interface [polypeptide binding]; other site
529507006896	NAD binding site [chemical binding]; other site
529507006897	catalytic residues [active]
529507006898	HMMPfam hit to PF00171, Aldehyde dehydrogenase family, score 3.5e-239
529507006899	PS00070 Aldehyde dehydrogenases cysteine active site.
529507006900	PS00687 Aldehyde dehydrogenases glutamic acid active site.
529507006901	transcriptional regulator BetI; Validated; Region: PRK00767
529507006902	Bacterial regulatory proteins, tetR family; Region: TetR_N; pfam00440
529507006903	Bacterial transcriptional repressor; Region: TetR_C_6; pfam13977
529507006904	PS00038 Myc-type, 'helix-loop-helix' dimerization domain signature.
529507006905	HMMPfam hit to PF00440, Bacterial regulatory proteins, tetR family, score 1.2e-13
529507006906	PS01081 Bacterial regulatory proteins, tetR family signature.
529507006907	Predicted helix-turn-helix motif with score 1464.000, SD 4.17 at aa 38-59, sequence ASIALIARKAGVSNGIISHYFR
529507006908	choline transport protein BetT; Provisional; Region: PRK09928
529507006909	Signal peptide predicted for PMI1462 by SignalP 2.0 HMM (Signal peptide probability 0.995) with cleavage site probability 0.572 between residues 46 and 47
529507006910	12 probable transmembrane helices predicted for PMI1462 by TMHMM2.0 at aa 23-45, 65-82, 103-125, 153-175, 204-226, 241-263, 270-289, 325-347, 360-379, 410-432, 459-478 and 488-507
529507006911	HMMPfam hit to PF02028, BCCT family transporter, score 5.7e-279
529507006912	PS00343 Gram-positive cocci surface proteins 'anchoring' hexapeptide.
529507006913	PS01303 BCCT family of transporters signature.
529507006914	histidinol-phosphate aminotransferase; Region: hisC; TIGR01141
529507006915	Aspartate aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). Pyridoxal phosphate combines with an alpha-amino acid to form a compound called a Schiff base or aldimine...; Region: AAT_like; cd00609
529507006916	pyridoxal 5'-phosphate binding site [chemical binding]; other site
529507006917	homodimer interface [polypeptide binding]; other site
529507006918	catalytic residue [active]
529507006919	Signal peptide predicted for PMI1463 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.987 between residues 28 and 29
529507006920	1 probable transmembrane helix predicted for PMI1463 by TMHMM2.0 at aa 7-29
529507006921	HMMPfam hit to PF00155, Aminotransferase class I and II, score 4.3e-17
529507006922	fimbrial operon 8
529507006923	Fimbrial protein; Region: Fimbrial; cl01416
529507006924	HMMPfam hit to PF00419, Fimbrial protein, score 5.8e-31
529507006925	Signal peptide predicted for PMI1464 by SignalP 2.0 HMM (Signal peptide probability 0.856) with cleavage site probability 0.545 between residues 37 and 38
529507006926	1 probable transmembrane helix predicted for PMI1464 by TMHMM2.0 at aa 12-29
529507006927	Fimbrial protein; Region: Fimbrial; cl01416
529507006928	Fimbrial protein; Region: Fimbrial; cl01416
529507006929	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507006930	1 probable transmembrane helix predicted for PMI1465 by TMHMM2.0 at aa 12-34
529507006931	Signal peptide predicted for PMI1465 by SignalP 2.0 HMM (Signal peptide probability 0.948) with cleavage site probability 0.876 between residues 32 and 33
529507006932	outer membrane usher protein; Provisional; Region: PRK15193
529507006933	PapC N-terminal domain; Region: PapC_N; pfam13954
529507006934	Type VII secretion system (T7SS), usher protein; Region: Usher; pfam00577
529507006935	PapC C-terminal domain; Region: PapC_C; pfam13953
529507006936	HMMPfam hit to PF00577, Fimbrial Usher protein, score 0
529507006937	1 probable transmembrane helix predicted for PMI1466 by TMHMM2.0 at aa 7-29
529507006938	Signal peptide predicted for PMI1466 by SignalP 2.0 HMM (Signal peptide probability 0.998) with cleavage site probability 0.998 between residues 25 and 26
529507006939	long polar fimbrial chaperone LpfB; Provisional; Region: PRK15208
529507006940	Gram-negative pili assembly chaperone, N-terminal domain; Region: Pili_assembly_N; pfam00345
529507006941	Gram-negative pili assembly chaperone, C-terminal domain; Region: Pili_assembly_C; pfam02753
529507006942	HMMPfam hit to PF02753, Gram-negative pili assembly chaperone, score 4.4e-16
529507006943	HMMPfam hit to PF00345, Gram-negative pili assembly chaperone, score 1.7e-47
529507006944	Signal peptide predicted for PMI1467 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.694 between residues 29 and 30
529507006945	1 probable transmembrane helix predicted for PMI1467 by TMHMM2.0 at aa 7-29
529507006946	Fimbrial protein; Region: Fimbrial; cl01416
529507006947	HMMPfam hit to PF00419, Fimbrial protein, score 5.1e-31
529507006948	Signal peptide predicted for PMI1468 by SignalP 2.0 HMM (Signal peptide probability 0.989) with cleavage site probability 0.898 between residues 21 and 22
529507006949	Fimbrial protein; Region: Fimbrial; cl01416
529507006950	HMMPfam hit to PF00419, Fimbrial protein, score 2e-54
529507006951	1 probable transmembrane helix predicted for PMI1469 by TMHMM2.0 at aa 7-29
529507006952	Signal peptide predicted for PMI1469 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.998 between residues 25 and 26
529507006953	Predicted transcriptional regulators [Transcription]; Region: HipB; COG1396
529507006954	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
529507006955	salt bridge; other site
529507006956	non-specific DNA binding site [nucleotide binding]; other site
529507006957	sequence-specific DNA binding site [nucleotide binding]; other site
529507006958	HMMPfam hit to PF01381, Helix-turn-helix, score 1.2e-10
529507006959	Predicted helix-turn-helix motif with score 2244.000, SD 6.83 at aa 36-57, sequence MTGAELGKLLNISQQQISRYER
529507006960	oligopeptide ABC transporter ATP-binding protein OppF; Provisional; Region: PRK15079
529507006961	ATP-binding cassette domain of nickel/oligopeptides specific transporters; Region: ABC_NikE_OppD_transporters; cd03257
529507006962	Walker A/P-loop; other site
529507006963	ATP binding site [chemical binding]; other site
529507006964	Q-loop/lid; other site
529507006965	ABC transporter signature motif; other site
529507006966	Walker B; other site
529507006967	D-loop; other site
529507006968	H-loop/switch region; other site
529507006969	oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain; Region: oligo_HPY; TIGR01727
529507006970	HMMPfam hit to PF00005, ABC transporter, score 9.3e-64
529507006971	PS00211 ABC transporters family signature.
529507006972	PS00017 ATP/GTP-binding site motif A (P-loop).
529507006973	oligopeptide transporter ATP-binding component; Provisional; Region: oppD; PRK09473
529507006974	ATP-binding cassette domain of nickel/oligopeptides specific transporters; Region: ABC_NikE_OppD_transporters; cd03257
529507006975	Walker A/P-loop; other site
529507006976	ATP binding site [chemical binding]; other site
529507006977	Q-loop/lid; other site
529507006978	ABC transporter signature motif; other site
529507006979	Walker B; other site
529507006980	D-loop; other site
529507006981	H-loop/switch region; other site
529507006982	oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain; Region: oligo_HPY; TIGR01727
529507006983	HMMPfam hit to PF00005, ABC transporter, score 1.3e-57
529507006984	PS00211 ABC transporters family signature.
529507006985	PS00017 ATP/GTP-binding site motif A (P-loop).
529507006986	oligopeptide ABC transporter permease OppC; Provisional; Region: PRK15406
529507006987	N-terminal TM domain of oligopeptide transport permease C; Region: OppC_N; pfam12911
529507006988	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
529507006989	dimer interface [polypeptide binding]; other site
529507006990	conserved gate region; other site
529507006991	ABC-ATPase subunit interface; other site
529507006992	HMMPfam hit to PF00528, Binding-protein-dependent transport syst, score 1.2e-43
529507006993	6 probable transmembrane helices predicted for PMI1473 by TMHMM2.0 at aa 42-64, 109-131, 143-160, 164-183, 214-236 and 268-290
529507006994	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
529507006995	oligopeptide transporter permease; Reviewed; Region: oppB; PRK09471
529507006996	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
529507006997	dimer interface [polypeptide binding]; other site
529507006998	conserved gate region; other site
529507006999	putative PBP binding loops; other site
529507007000	ABC-ATPase subunit interface; other site
529507007001	HMMPfam hit to PF00528, Binding-protein-dependent transport syst, score 1.4e-58
529507007002	6 probable transmembrane helices predicted for PMI1474 by TMHMM2.0 at aa 5-27, 100-122, 134-156, 171-189, 228-250 and 278-300
529507007003	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
529507007004	Signal peptide predicted for PMI1474 by SignalP 2.0 HMM (Signal peptide probability 0.889) with cleavage site probability 0.461 between residues 32 and 33
529507007005	oligopeptide ABC transporter substrate-binding protein OppA; Provisional; Region: PRK15104
529507007006	The substrate-binding component of an ABC-type oligopetide import system contains the type 2 periplasmic binding fold; Region: PBP2_OppA; cd08504
529507007007	peptide binding site [polypeptide binding]; other site
529507007008	HMMPfam hit to PF00496, Bacterial extracellular solute-binding prot, score 5.5e-84
529507007009	PS01040 Bacterial extracellular solute-binding proteins, family 5 signature.
529507007010	1 probable transmembrane helix predicted for PMI1475 by TMHMM2.0 at aa 9-31
529507007011	Signal peptide predicted for PMI1475 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.945 between residues 27 and 28
529507007012	oligopeptide ABC transporter substrate-binding protein OppA; Provisional; Region: PRK15104
529507007013	The substrate-binding component of an ABC-type oligopetide import system contains the type 2 periplasmic binding fold; Region: PBP2_OppA; cd08504
529507007014	peptide binding site [polypeptide binding]; other site
529507007015	HMMPfam hit to PF00496, Bacterial extracellular solute-binding prot, score 1.4e-88
529507007016	PS01040 Bacterial extracellular solute-binding proteins, family 5 signature.
529507007017	1 probable transmembrane helix predicted for PMI1476 by TMHMM2.0 at aa 26-45
529507007018	Signal peptide predicted for PMI1476 by SignalP 2.0 HMM (Signal peptide probability 0.621) with cleavage site probability 0.621 between residues 27 and 28
529507007019	siroheme synthase; Provisional; Region: cysG; PRK10637
529507007020	Putative NAD(P)-binding; Region: NAD_binding_7; pfam13241
529507007021	Sirohaem synthase dimerisation region; Region: CysG_dimeriser; pfam10414
529507007022	Uroporphyrin-III C-methyltransferase (S-Adenosyl-L-methionine:uroporphyrinogen III methyltransferase, SUMT); Region: SUMT; cd11642
529507007023	active site
529507007024	SAM binding site [chemical binding]; other site
529507007025	homodimer interface [polypeptide binding]; other site
529507007026	HMMPfam hit to PF00590, Tetrapyrrole (Corrin/Porphyrin) Methylas, score 2.2e-83
529507007027	PS00840 Uroporphyrin-III C-methyltransferase signature 2.
529507007028	PS00839 Uroporphyrin-III C-methyltransferase signature 1.
529507007029	Predicted helix-turn-helix motif with score 1085.000, SD 2.88 at aa 149-170, sequence NSLGALAQLAGKLREQVKQRFA
529507007030	Assimilatory nitrite reductase (NirD) family, Rieske domain; Assimilatory nitrate and nitrite reductases convert nitrate through nitrite to ammonium. Members include bacterial and fungal proteins. The bacterial NirD contains a single Rieske domain while...; Region: Rieske_NirD; cd03529
529507007031	nitrite reductase subunit NirD; Provisional; Region: PRK14989
529507007032	Pyridine nucleotide-disulphide oxidoreductase; Region: Pyr_redox; pfam00070
529507007033	BFD-like [2Fe-2S] binding domain; Region: Fer2_BFD; pfam04324
529507007034	Nitrite/Sulfite reductase ferredoxin-like half domain; Region: NIR_SIR_ferr; pfam03460
529507007035	HMMPfam hit to PF01077, Nitrite and sulphite reductase 4Fe-4S do, score 3e-43
529507007036	PS00365 Nitrite and sulfite reductases iron-sulfur/siroheme-binding site.
529507007037	HMMPfam hit to PF03460, Nitrite/Sulfite reductase ferredoxin-lik, score 2.9e-19
529507007038	HMMPfam hit to PF04324, BFD-like [2Fe-2S] binding domain, score 5.2e-26
529507007039	HMMPfam hit to PF00070, Pyridine nucleotide-disulphide oxidoredu, score 8.9e-76
529507007040	ABC-type dipeptide transport system, periplasmic component [Amino acid transport and metabolism]; Region: DdpA; COG0747
529507007041	The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold; Region: PBP2_NikA_DppA_OppA_like_7; cd08512
529507007042	Signal peptide predicted for PMI1480 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.998 between residues 22 and 23
529507007043	1 probable transmembrane helix predicted for PMI1480 by TMHMM2.0 at aa 7-29
529507007044	HMMPfam hit to PF00496, Bacterial extracellular solute-binding prot, score 9.3e-52
529507007045	ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism]; Region: DppB; COG0601
529507007046	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
529507007047	dimer interface [polypeptide binding]; other site
529507007048	conserved gate region; other site
529507007049	putative PBP binding loops; other site
529507007050	ABC-ATPase subunit interface; other site
529507007051	Signal peptide predicted for PMI1481 by SignalP 2.0 HMM (Signal peptide probability 0.878) with cleavage site probability 0.412 between residues 42 and 43
529507007052	6 probable transmembrane helices predicted for PMI1481 by TMHMM2.0 at aa 26-48, 126-148, 161-183, 220-242, 283-305 and 320-342
529507007053	HMMPfam hit to PF00528, Binding-protein-dependent transport syst, score 2e-41
529507007054	ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism]; Region: DppC; COG1173
529507007055	N-terminal TM domain of oligopeptide transport permease C; Region: OppC_N; pfam12911
529507007056	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
529507007057	dimer interface [polypeptide binding]; other site
529507007058	conserved gate region; other site
529507007059	ABC-ATPase subunit interface; other site
529507007060	Signal peptide predicted for PMI1482 by SignalP 2.0 HMM (Signal peptide probability 0.967) with cleavage site probability 0.499 between residues 35 and 36
529507007061	6 probable transmembrane helices predicted for PMI1482 by TMHMM2.0 at aa 13-35, 81-103, 124-146, 171-193, 200-222 and 242-264
529507007062	HMMPfam hit to PF00528, Binding-protein-dependent transport syst, score 4.2e-40
529507007063	ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]; Region: DppF; COG1124
529507007064	ATP-binding cassette domain of nickel/oligopeptides specific transporters; Region: ABC_NikE_OppD_transporters; cd03257
529507007065	Walker A/P-loop; other site
529507007066	ATP binding site [chemical binding]; other site
529507007067	Q-loop/lid; other site
529507007068	ABC transporter signature motif; other site
529507007069	Walker B; other site
529507007070	D-loop; other site
529507007071	H-loop/switch region; other site
529507007072	HMMPfam hit to PF00005, ABC transporter, score 5.6e-51
529507007073	PS00017 ATP/GTP-binding site motif A (P-loop).
529507007074	ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]; Region: DppF; COG1124
529507007075	ATP-binding cassette domain of nickel/oligopeptides specific transporters; Region: ABC_NikE_OppD_transporters; cd03257
529507007076	Walker A/P-loop; other site
529507007077	ATP binding site [chemical binding]; other site
529507007078	Q-loop/lid; other site
529507007079	ABC transporter signature motif; other site
529507007080	Walker B; other site
529507007081	D-loop; other site
529507007082	H-loop/switch region; other site
529507007083	HMMPfam hit to PF00005, ABC transporter, score 2.3e-60
529507007084	PS00017 ATP/GTP-binding site motif A (P-loop).
529507007085	PS00211 ABC transporters family signature.
529507007086	hypothetical protein; Provisional; Region: PRK11111
529507007087	6 probable transmembrane helices predicted for PMI1485 by TMHMM2.0 at aa 10-32, 53-75, 80-99, 119-141, 145-167 and 188-210
529507007088	HMMPfam hit to PF01914, MarC family integral membrane protein, score 5e-80
529507007089	bifunctional acetaldehyde-CoA/alcohol dehydrogenase; Provisional; Region: PRK13805
529507007090	Coenzyme A acylating aldehyde dehydrogenase (ACDH), ALDH family 20-like; Region: ALDH_F20_ACDH; cd07122
529507007091	putative catalytic cysteine [active]
529507007092	C-terminal alcohol dehydrogenase domain of the acetaldehyde dehydrogenase-alcohol dehydrogenase bifunctional two-domain protein (AAD); Region: AAD_C; cd08178
529507007093	putative active site [active]
529507007094	metal binding site [ion binding]; metal-binding site
529507007095	HMMPfam hit to PF00465, Iron-containing alcohol dehydrogenase, score 6.1e-229
529507007096	PS00913 Iron-containing alcohol dehydrogenases signature 1.
529507007097	PS00060 Iron-containing alcohol dehydrogenases signature 2.
529507007098	thymidine kinase; Provisional; Region: PRK04296
529507007099	HMMPfam hit to PF00265, Thymidine kinase, score 2.9e-86
529507007100	PS00603 Thymidine kinase cellular-type signature.
529507007101	global DNA-binding transcriptional dual regulator H-NS; Provisional; Region: PRK10947
529507007102	Domain in histone-like proteins of HNS family; Region: HNS; smart00528
529507007103	HMMPfam hit to PF00816, H-NS histone family, score 2.5e-49
529507007104	PS00017 ATP/GTP-binding site motif A (P-loop).
529507007105	Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]; Region: WcaG; COG0451
529507007106	UDP glucuronic acid epimerase, extended (e) SDRs; Region: UDP_GE_SDE_e; cd05253
529507007107	putative NAD(P) binding site [chemical binding]; other site
529507007108	active site
529507007109	putative substrate binding site [chemical binding]; other site
529507007110	HMMPfam hit to PF01370, NAD dependent epimerase/dehydratase family, score 1.9e-121
529507007111	Prokaryotic UGPase catalyses the synthesis of UDP-glucose; Region: UGPase_prokaryotic; cd02541
529507007112	active site
529507007113	tetramer interface; other site
529507007114	HMMPfam hit to PF00483, Nucleotidyl transferase, score 3.4e-12
529507007115	PS00017 ATP/GTP-binding site motif A (P-loop).
529507007116	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
529507007117	active site
529507007118	response regulator of RpoS; Provisional; Region: PRK10693
529507007119	phosphorylation site [posttranslational modification]
529507007120	intermolecular recognition site; other site
529507007121	dimerization interface [polypeptide binding]; other site
529507007122	HMMPfam hit to PF00072, Response regulator receiver domain, score 1.1e-17
529507007123	hypothetical protein; Provisional; Region: PRK01617
529507007124	SEC-C motif; Region: SEC-C; pfam02810
529507007125	HMMPfam hit to PF02810, SEC-C motif, score 7.7e-09
529507007126	formyltetrahydrofolate deformylase; Reviewed; Region: purU; PRK06027
529507007127	N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase); Region: ACT_F4HF-DF; cd04875
529507007128	Formyltetrahydrofolate deformylase (Formyl-FH4 hydrolase), C-terminal hydrolase domain; Region: FMT_core_Formyl-FH4-Hydrolase_C; cd08648
529507007129	putative active site [active]
529507007130	putative substrate binding site [chemical binding]; other site
529507007131	putative cosubstrate binding site; other site
529507007132	catalytic site [active]
529507007133	HMMPfam hit to PF01842, ACT domain, score 1e-05
529507007134	HMMPfam hit to PF00551, Formyl transferase, score 5.7e-69
529507007135	Transcriptional regulator [Transcription]; Region: LysR; COG0583
529507007136	Bacterial regulatory helix-turn-helix protein, lysR family; Region: HTH_1; pfam00126
529507007137	HMMPfam hit to PF00126, Bacterial regulatory helix-turn-helix protei, score 3.4e-15
529507007138	PS00044 Bacterial regulatory proteins, lysR family signature.
529507007139	Escherichia coli exonuclease III (ExoIII) and Neisseria meningitides NExo-like subfamily of the ExoIII family purinic/apyrimidinic (AP) endonucleases; Region: ExoIII-like_AP-endo; cd09086
529507007140	putative catalytic site [active]
529507007141	putative phosphate binding site [ion binding]; other site
529507007142	active site
529507007143	metal binding site A [ion binding]; metal-binding site
529507007144	DNA binding site [nucleotide binding]
529507007145	putative AP binding site [nucleotide binding]; other site
529507007146	putative metal binding site B [ion binding]; other site
529507007147	HMMPfam hit to PF03372, Endonuclease/Exonuclease/phosphatase fa, score 3.4e-48
529507007148	PS00726 AP endonucleases family 1 signature 1.
529507007149	PS00728 AP endonucleases family 1 signature 3.
529507007150	DNA topoisomerase III; Provisional; Region: PRK07726
529507007151	TOPRIM_TopoIA_TopoIII: The topoisomerase-primase (TORPIM) domain found in members of the type IA family of DNA topoisomerases (Topo IA) similar to topoisomerase III. Type IA DNA topoisomerases remove (relax) negative supercoils in the DNA by: cleaving...; Region: TOPRIM_TopoIA_TopoIII; cd03362
529507007152	active site
529507007153	putative interdomain interaction site [polypeptide binding]; other site
529507007154	putative metal-binding site [ion binding]; other site
529507007155	putative nucleotide binding site [chemical binding]; other site
529507007156	DNA Topoisomerase, subtype IA; DNA-binding, ATP-binding and catalytic domain of bacterial DNA topoisomerases I and III, and eukaryotic DNA topoisomerase III and eubacterial and archael reverse gyrases. Topoisomerases clevage single or double stranded DNA...; Region: TOP1Ac; cd00186
529507007157	domain I; other site
529507007158	DNA binding groove [nucleotide binding]
529507007159	phosphate binding site [ion binding]; other site
529507007160	domain II; other site
529507007161	domain III; other site
529507007162	nucleotide binding site [chemical binding]; other site
529507007163	catalytic site [active]
529507007164	domain IV; other site
529507007165	HMMPfam hit to PF01131, DNA topoisomerase, score 2.2e-176
529507007166	PS00396 Prokaryotic DNA topoisomerase I active site.
529507007167	HMMPfam hit to PF01751, Toprim domain, score 1.2e-35
529507007168	selenophosphate synthetase; Provisional; Region: PRK00943
529507007169	Selenophosphate synthetase  (SelD) catalyzes the conversion of selenium to selenophosphate which is required by a number of bacterial, archaeal and eukaryotic organisms for synthesis of Secys-tRNA, the precursor of selenocysteine in selenoenzymes. The...; Region: SelD; cd02195
529507007170	dimerization interface [polypeptide binding]; other site
529507007171	putative ATP binding site [chemical binding]; other site
529507007172	HMMPfam hit to PF02769, AIR synthase related protein, C-terminal dom, score 3.5e-22
529507007173	HMMPfam hit to PF00586, AIR synthase related protein, N-terminal dom, score 7.9e-27
529507007174	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507007175	Nitroreductase-like family which includes NADH oxidase and arsenite oxidiase. NADH oxidase catalyses the oxidation of NAD(P)H and accepts a wide broad range of compounds as electron acceptors, such as nitrocompound. Arsenite oxidase in a...; Region: Arsenite_oxidase; cd02135
529507007176	putative FMN binding site [chemical binding]; other site
529507007177	HMMPfam hit to PF00881, Nitroreductase family, score 2.8e-28
529507007178	protease 4; Provisional; Region: PRK10949
529507007179	Signal peptide peptidase A (SppA) 67K type, a serine protease, has catalytic Ser-Lys dyad; Region: S49_SppA_67K_type; cd07018
529507007180	tandem repeat interface [polypeptide binding]; other site
529507007181	oligomer interface [polypeptide binding]; other site
529507007182	active site residues [active]
529507007183	Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad; Region: S49_Sppa_N_C; cd07023
529507007184	tandem repeat interface [polypeptide binding]; other site
529507007185	oligomer interface [polypeptide binding]; other site
529507007186	active site residues [active]
529507007187	1 probable transmembrane helix predicted for PMI1499 by TMHMM2.0 at aa 21-43
529507007188	HMMPfam hit to PF01343, Peptidase family S49, score 2.6e-36
529507007189	HMMPfam hit to PF01343, Peptidase family S49, score 5.3e-58
529507007190	Type I (cytosolic) bacterial L-asparaginase; Region: L-asparaginase_I; cd08963
529507007191	active site
529507007192	homodimer interface [polypeptide binding]; other site
529507007193	PS00144 Asparaginase / glutaminase active site signature 1.
529507007194	HMMPfam hit to PF00710, Asparaginase, score 1.9e-102
529507007195	PS00917 Asparaginase / glutaminase active site signature 2.
529507007196	Nicotinamidase/pyrazinamidase (PZase). Nicotinamidase, a ubiquitous enzyme in prokaryotes, converts nicotinamide to nicotinic acid (niacin) and ammonia, which in turn can be recycled to make nicotinamide adenine dinucleotide (NAD). The same enzyme is...; Region: nicotinamidase; cd01011
529507007197	Isochorismatase family; Region: Isochorismatase; pfam00857
529507007198	catalytic triad [active]
529507007199	metal binding site [ion binding]; metal-binding site
529507007200	conserved cis-peptide bond; other site
529507007201	HMMPfam hit to PF00857, Isochorismatase family, score 4.2e-48
529507007202	Protein of unknown function (DUF1315); Region: DUF1315; pfam07023
529507007203	HMMPfam hit to PF07023, Protein of unknown function (DUF1315), score 6.9e-50
529507007204	SelR domain; Region: SelR; pfam01641
529507007205	methionine sulfoxide reductase B; Provisional; Region: PRK00222
529507007206	HMMPfam hit to PF01641, SelR domain, score 8.6e-73
529507007207	glyceraldehyde-3-phosphate dehydrogenase A; Provisional; Region: gapA; PRK15425
529507007208	Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; Region: Gp_dh_N; smart00846
529507007209	Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain; Region: Gp_dh_C; pfam02800
529507007210	HMMPfam hit to PF00044, Glyceraldehyde 3-phosphate dehydrogenase, NA, score 6.9e-100
529507007211	PS00071 Glyceraldehyde 3-phosphate dehydrogenase active site.
529507007212	HMMPfam hit to PF02800, Glyceraldehyde 3-phosphate dehydrogenase, C-, score 2.7e-122
529507007213	D-hexose-6-phosphate epimerase-like; Region: D-hex-6-P-epi_like; cd09020
529507007214	active site
529507007215	phosphate binding residues; other site
529507007216	catalytic residues [active]
529507007217	HMMPfam hit to PF01263, Aldose 1-epimerase, score 4.7e-47
529507007218	Outer membrane protein V [Cell envelope biogenesis, outer membrane]; Region: OmpV; COG3713
529507007219	HMMPfam hit to PF06629, MltA-interacting protein MipA, score 7.7e-68
529507007220	Signal peptide predicted for PMI1506 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.999 between residues 44 and 45
529507007221	Acylphosphatase; Region: Acylphosphatase; pfam00708
529507007222	Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]; Region: HypF; COG0068
529507007223	HypF finger; Region: zf-HYPF; pfam07503
529507007224	HypF finger; Region: zf-HYPF; pfam07503
529507007225	Telomere recombination; Region: Sua5_yciO_yrdC; pfam01300
529507007226	Fumble; Region: Fumble; cl17357
529507007227	HMMPfam hit to PF00814, Glycoprotease family, score 8.8e-11
529507007228	HMMPfam hit to PF01300, yrdC domain, score 2.6e-59
529507007229	HMMPfam hit to PF07503, HypF finger, score 8.8e-17
529507007230	HMMPfam hit to PF07503, HypF finger, score 7.6e-19
529507007231	HMMPfam hit to PF00708, Acylphosphatase, score 5e-08
529507007232	PS00150 Acylphosphatase signature 1.
529507007233	alanine racemase; Reviewed; Region: dadX; PRK03646
529507007234	Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, Proteobacterial Alanine Racemases; Region: PLPDE_III_AR_proteobact; cd06827
529507007235	active site
529507007236	pyridoxal 5'-phosphate (PLP) binding site [chemical binding]; other site
529507007237	substrate binding site [chemical binding]; other site
529507007238	catalytic residues [active]
529507007239	dimer interface [polypeptide binding]; other site
529507007240	HMMPfam hit to PF00842, Alanine racemase, C-terminal domain, score 2.9e-65
529507007241	HMMPfam hit to PF01168, Alanine racemase, N-terminal domain, score 2.6e-63
529507007242	PS00395 Alanine racemase pyridoxal-phosphate attachment site.
529507007243	D-amino acid dehydrogenase small subunit; Validated; Region: PRK00711
529507007244	hydroxyglutarate oxidase; Provisional; Region: PRK11728
529507007245	HMMPfam hit to PF01266, FAD dependent oxidoreductase, score 2.8e-106
529507007246	fatty acid metabolism regulator; Provisional; Region: PRK04984
529507007247	Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators; Region: WHTH_GntR; cd07377
529507007248	DNA-binding site [nucleotide binding]; DNA binding site
529507007249	FadR C-terminal domain; Region: FadR_C; pfam07840
529507007250	HMMPfam hit to PF07840, FadR C-terminal domain, score 7.8e-109
529507007251	HMMPfam hit to PF00392, Bacterial regulatory proteins, gntR family, score 3.3e-24
529507007252	PS00043 Bacterial regulatory proteins, gntR family signature.
529507007253	sodium/proton antiporter; Reviewed; Region: nhaB; PRK09547
529507007254	HMMPfam hit to PF06450, Bacterial Na+/H+ antiporter B (NhaB), score 0
529507007255	11 probable transmembrane helices predicted for PMI1511 by TMHMM2.0 at aa 20-39, 43-65, 96-118, 144-166, 199-221, 239-261, 301-332, 347-369, 390-412, 454-473 and 480-499
529507007256	disulfide bond formation protein B; Provisional; Region: PRK01749
529507007257	HMMPfam hit to PF02600, Disulfide bond formation protein DsbB, score 2.4e-51
529507007258	3 probable transmembrane helices predicted for PMI1512 by TMHMM2.0 at aa 17-39, 49-66 and 150-172
529507007259	Putative hemolysin [General function prediction only]; Region: Hlx; COG3042
529507007260	Domain of unknown function (DUF333); Region: DUF333; pfam03891
529507007261	Signal peptide predicted for PMI1513 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.766 between residues 29 and 30
529507007262	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507007263	Small Multidrug Resistance protein; Region: Multi_Drug_Res; cl00910
529507007264	4 probable transmembrane helices predicted for PMI1514 by TMHMM2.0 at aa 4-23, 30-47, 57-79 and 86-105
529507007265	HMMPfam hit to PF00893, Small Multidrug Resistance protein, score 3.6e-40
529507007266	putative arabinose transporter; Provisional; Region: PRK03545
529507007267	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507007268	putative substrate translocation pore; other site
529507007269	12 probable transmembrane helices predicted for PMI1515 by TMHMM2.0 at aa 20-42, 57-79, 86-105, 110-132, 145-167, 172-194, 215-237, 252-274, 281-300, 305-327, 339-361 and 371-390
529507007270	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 7.5e-45
529507007271	1 probable transmembrane helix predicted for PMI1516 by TMHMM2.0 at aa 13-35
529507007272	Domain of unknown function (DUF305); Region: DUF305; cl17794
529507007273	Signal peptide predicted for PMI1517 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.865 between residues 22 and 23
529507007274	HMMPfam hit to PF03713, Domain of unknown function (DUF305), score 5.9e-23
529507007275	ABC-type uncharacterized transport system, permease component [General function prediction only]; Region: COG2215
529507007276	HMMPfam hit to PF03824, High-affinity nickel-transport protein, score 6.8e-46
529507007277	7 probable transmembrane helices predicted for PMI1518 by TMHMM2.0 at aa 12-31, 62-84, 105-127, 147-166, 223-245, 255-277 and 298-320
529507007278	Signal peptide predicted for PMI1518 by SignalP 2.0 HMM (Signal peptide probability 0.868) with cleavage site probability 0.448 between residues 27 and 28
529507007279	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507007280	Protein of unknown function (DUF1007); Region: DUF1007; pfam06226
529507007281	HMMPfam hit to PF06226, Protein of unknown function (DUF1007), score 3.5e-47
529507007282	Signal peptide predicted for PMI1519 by SignalP 2.0 HMM (Signal peptide probability 0.971) with cleavage site probability 0.968 between residues 31 and 32
529507007283	phosphatidylglycerophosphate synthetase; Provisional; Region: PRK10832
529507007284	HMMPfam hit to PF01066, CDP-alcohol phosphatidyltransferase, score 1.3e-42
529507007285	3 probable transmembrane helices predicted for PMI1520 by TMHMM2.0 at aa 5-27, 31-53 and 151-173
529507007286	PS00379 CDP-alcohol phosphatidyltransferases signature.
529507007287	excinuclease ABC subunit C; Validated; Region: uvrC; PRK00558
529507007288	Catalytic GIY-YIG domain of nucleotide excision repair endonucleases UvrC, Cho, and similar proteins; Region: GIY-YIG_UvrC_Cho; cd10434
529507007289	GIY-YIG motif/motif A; other site
529507007290	active site
529507007291	catalytic site [active]
529507007292	putative DNA binding site [nucleotide binding]; other site
529507007293	metal binding site [ion binding]; metal-binding site
529507007294	UvrB/uvrC motif; Region: UVR; pfam02151
529507007295	UvrC Helix-hairpin-helix N-terminal; Region: UvrC_HhH_N; pfam08459
529507007296	HMMPfam hit to PF00633, Helix-hairpin-helix motif, score 0.059
529507007297	HMMPfam hit to PF00633, Helix-hairpin-helix motif, score 0.00056
529507007298	HMMPfam hit to PF02151, UvrB/uvrC motif, score 2.1e-12
529507007299	HMMPfam hit to PF01541, GIY-YIG catalytic domain, score 4.5e-32
529507007300	response regulator; Provisional; Region: PRK09483
529507007301	C-terminal DNA-binding domain of LuxR-like proteins. This domain contains a helix-turn-helix motif and binds DNA. Proteins belonging to this group are response regulators; some act as transcriptional activators, others as transcriptional repressors. Many...; Region: LuxR_C_like; cd06170
529507007302	DNA binding residues [nucleotide binding]
529507007303	dimerization interface [polypeptide binding]; other site
529507007304	HMMPfam hit to PF00196, Bacterial regulatory proteins, luxR fami, score 3.7e-21
529507007305	Predicted helix-turn-helix motif with score 1292.000, SD 3.59 at aa 165-186, sequence KKIAQIAQELNISTKTVNSYRY
529507007306	HMMPfam hit to PF00072, Response regulator receiver domain, score 4.7e-05
529507007307	Nitroreductase-like family 1. A subfamily of the nitroreductase family containing uncharacterized proteins that are similar to nitroreductase. Nitroreductase catalyzes the reduction of nitroaromatic compounds such as nitrotoluenes, nitrofurans and...; Region: Nitroreductase_1; cd02137
529507007308	dimer interface [polypeptide binding]; other site
529507007309	FMN binding site [chemical binding]; other site
529507007310	HMMPfam hit to PF00881, Nitroreductase family, score 5.7e-40
529507007311	Bacterial fructose-1,6-bisphosphatase, glpX-encoded; Region: FBPase_glpX; pfam03320
529507007312	Bacterial fructose-1,6-bisphosphatase, glpX-encoded. A dimeric enzyme dependent on Mg(2+). glpX-encoded FPBase (FBPase class II) differs from other members of the inositol-phosphatase superfamily by permutation of secondary structure elements. The core...; Region: FBPase_glpX; cd01516
529507007313	putative active site [active]
529507007314	HMMPfam hit to PF03320, Bacterial fructose-1,6-bisphosphatase, gl, score 2.6e-156
529507007315	Phosphotriesterase (PTE) catalyzes the hydrolysis of organophosphate nerve agents, including the chemical warfare agents VX, soman, and sarin as well as the insecticide paraoxon. PTE exists as a homodimer with one active site per monomer. The active site...; Region: PTE; cd00530
529507007316	active site
529507007317	substrate binding pocket [chemical binding]; other site
529507007318	homodimer interaction site [polypeptide binding]; other site
529507007319	HMMPfam hit to PF02126, Phosphotriesterase family, score 2.3e-43
529507007320	PS01322 Phosphotriesterase family signature 1.
529507007321	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG3238
529507007322	Protein of unknown function, DUF606; Region: DUF606; pfam04657
529507007323	10 probable transmembrane helices predicted for PMI1526 by TMHMM2.0 at aa 5-27, 42-59, 80-97, 102-124, 137-159, 164-186, 199-221, 231-253, 258-280 and 285-307
529507007324	HMMPfam hit to PF04657, Protein of unknown function, DUF606, score 2.4e-08
529507007325	Signal peptide predicted for PMI1526 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.717 between residues 27 and 28
529507007326	A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain; Region: A4_beta-galactosidase_middle_domain; cd03143
529507007327	HMMPfam hit to PF07090, Protein of unknown function (DUF1355), score 5.1e-169
529507007328	PS00017 ATP/GTP-binding site motif A (P-loop).
529507007329	Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism]; Region: GlpR; COG1349
529507007330	helix_turn_helix, Deoxyribose operon repressor; Region: HTH_DEOR; smart00420
529507007331	Sugar kinases, ribokinase family [Carbohydrate transport and metabolism]; Region: RbsK; COG0524
529507007332	Ribokinase catalyses the phosphorylation of ribose to ribose-5-phosphate using ATP. This reaction is the first step in the ribose metabolism. It traps ribose within the cell after uptake and also prepares the sugar for use in the synthesis of nucleotides...; Region: ribokinase; cd01174
529507007333	substrate binding site [chemical binding]; other site
529507007334	dimer interface [polypeptide binding]; other site
529507007335	ATP binding site [chemical binding]; other site
529507007336	HMMPfam hit to PF00294, pfkB family carbohydrate kinase, score 1.9e-72
529507007337	PS00584 pfkB family of carbohydrate kinases signature 2.
529507007338	Predicted helix-turn-helix motif with score 1194.000, SD 3.25 at aa 19-40, sequence VKVSVLAKELSVTKETIRSDLN
529507007339	Signal peptide predicted for PMI1529 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.994 between residues 20 and 21
529507007340	PS00017 ATP/GTP-binding site motif A (P-loop).
529507007341	Metal dependent phosphohydrolases with conserved 'HD' motif; Region: HDc; cd00077
529507007342	Zn2+ binding site [ion binding]; other site
529507007343	Mg2+ binding site [ion binding]; other site
529507007344	AAA domain; Region: AAA_33; pfam13671
529507007345	RNA ligase; Region: RNA_ligase; pfam09414
529507007346	glucose-1-dehydrogenase; Provisional; Region: PRK08936
529507007347	glucose 1 dehydrogenase (GlcDH), classical (c) SDRs; Region: GlcDH_SDR_c; cd05358
529507007348	NAD binding site [chemical binding]; other site
529507007349	homodimer interface [polypeptide binding]; other site
529507007350	active site
529507007351	HMMPfam hit to PF00106, short chain dehydrogenase, score 7.7e-88
529507007352	PS00061 Short-chain dehydrogenases/reductases family signature.
529507007353	Orthopoxvirus protein of unknown function (DUF830); Region: DUF830; cl13998
529507007354	1 probable transmembrane helix predicted for PMI1533 by TMHMM2.0 at aa 5-24
529507007355	Signal peptide predicted for PMI1533 by SignalP 2.0 HMM (Signal peptide probability 0.981) with cleavage site probability 0.793 between residues 21 and 22
529507007356	Lumazine-binding domain; Region: Lumazine_bd; pfam12870
529507007357	Signal peptide predicted for PMI1534 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.664 between residues 22 and 23
529507007358	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507007359	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
529507007360	non-specific DNA binding site [nucleotide binding]; other site
529507007361	salt bridge; other site
529507007362	Predicted transcriptional regulator [Transcription]; Region: COG2932
529507007363	sequence-specific DNA binding site [nucleotide binding]; other site
529507007364	Peptidase S24 LexA-like proteins are involved in the SOS response leading to the repair of single-stranded DNA within the bacterial cell. This family includes: the lambda repressor CI/C2 family and related bacterial prophage repressor proteins; LexA (EC...; Region: S24_LexA-like; cd06529
529507007365	Catalytic site [active]
529507007366	HMMPfam hit to PF01381, Helix-turn-helix, score 6.7e-10
529507007367	Predicted helix-turn-helix motif with score 1711.000, SD 5.01 at aa 16-37, sequence LTQSELATLAGTTQQSIEQLES
529507007368	HMMPfam hit to PF00717, Peptidase S24-like, score 7.6e-12
529507007369	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
529507007370	ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]; Region: SalX; COG1136
529507007371	Walker A/P-loop; other site
529507007372	ATP binding site [chemical binding]; other site
529507007373	Q-loop/lid; other site
529507007374	ABC transporter signature motif; other site
529507007375	Walker B; other site
529507007376	D-loop; other site
529507007377	H-loop/switch region; other site
529507007378	HMMPfam hit to PF00005, ABC transporter, score 2.8e-56
529507007379	PS00211 ABC transporters family signature.
529507007380	PS00017 ATP/GTP-binding site motif A (P-loop).
529507007381	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
529507007382	ABC-type sulfate transport system, permease component [Posttranslational modification, protein turnover, chaperones]; Region: CysU; COG0555
529507007383	putative PBP binding loops; other site
529507007384	ABC-ATPase subunit interface; other site
529507007385	HMMPfam hit to PF00528, Binding-protein-dependent transport syst, score 4.7e-15
529507007386	6 probable transmembrane helices predicted for PMI1538 by TMHMM2.0 at aa 7-29, 49-71, 83-105, 120-139, 169-191 and 226-248
529507007387	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
529507007388	Signal peptide predicted for PMI1538 by SignalP 2.0 HMM (Signal peptide probability 0.990) with cleavage site probability 0.592 between residues 22 and 23
529507007389	Bacterial extracellular solute-binding protein; Region: SBP_bac_11; pfam13531
529507007390	Bacterial extracellular solute-binding protein; Region: SBP_bac_1; cl17199
529507007391	1 probable transmembrane helix predicted for PMI1539 by TMHMM2.0 at aa 5-27
529507007392	Signal peptide predicted for PMI1539 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 1.000 between residues 22 and 23
529507007393	Transcriptional regulator, contains sigma factor-related N-terminal domain [Transcription]; Region: DeoR; COG2390
529507007394	Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs). A SF is a dissociable subunit of RNA polymerase, it directs bacterial or...; Region: Sigma70_r4; cd06171
529507007395	DNA binding residues [nucleotide binding]
529507007396	Putative sugar-binding domain; Region: Sugar-bind; pfam04198
529507007397	HMMPfam hit to PF04198, sugar-binding domain, score 7.4e-81
529507007398	Predicted helix-turn-helix motif with score 1687.000, SD 4.93 at aa 33-54, sequence LSQSEVANIMSVSRVTVVKYLH
529507007399	CutA1 divalent ion tolerance protein; Region: CutA1; pfam03091
529507007400	HMMPfam hit to PF03091, CutA1 divalent ion tolerance protein, score 1.4e-47
529507007401	PS00142 Neutral zinc metallopeptidases, zinc-binding region signature.
529507007402	30S ribosomal protein subunit S22 family; Region: Ribosomal_S22; cl11579
529507007403	Predicted nucleotidyltransferase; Region: Nuc-transf; cl01417
529507007404	Predicted nucleotidyltransferase; Region: Nuc-transf; pfam10127
529507007405	GMP synthase; Reviewed; Region: guaA; PRK00074
529507007406	Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase; Region: GATase1_GMP_Synthase; cd01742
529507007407	AMP/PPi binding site [chemical binding]; other site
529507007408	candidate oxyanion hole; other site
529507007409	catalytic triad [active]
529507007410	potential glutamine specificity residues [chemical binding]; other site
529507007411	The C-terminal domain of GMP synthetase. It contains two subdomains; the ATP pyrophosphatase domain which closes to the N-termial and the dimerization domain at C-terminal end. The ATP-PPase is a twisted, five-stranded parallel beta-sheet sandwiched...; Region: GMP_synthase_C; cd01997
529507007412	ATP Binding subdomain [chemical binding]; other site
529507007413	Ligand Binding sites [chemical binding]; other site
529507007414	Dimerization subdomain; other site
529507007415	HMMPfam hit to PF00958, GMP synthase C terminal domain, score 6.6e-73
529507007416	HMMPfam hit to PF00117, Glutamine amidotransferase class-I, score 1.1e-49
529507007417	PS00442 Glutamine amidotransferases class-I active site.
529507007418	inosine 5'-monophosphate dehydrogenase; Reviewed; Region: PRK05567
529507007419	TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure. Specific for this family is the conserved phosphate binding site at the edges of strands 7 and 8. The phosphate...; Region: TIM_phosphate_binding; cl17186
529507007420	This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein.  IMPDH is an essential enzyme that catalyzes the first step unique to GTP synthesis, playing a...; Region: CBS_pair_IMPDH; cd04601
529507007421	IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase. IMPDH catalyzes the NAD-dependent oxidation of inosine 5'-monophosphate (IMP) to xanthosine 5' monophosphate (XMP). It is a rate-limiting step in the de novo synthesis of...; Region: IMPDH; cd00381
529507007422	active site
529507007423	HMMPfam hit to PF00478, IMP dehydrogenase / GMP reductase domain, score 4.5e-203
529507007424	PS00487 IMP dehydrogenase / GMP reductase signature.
529507007425	HMMPfam hit to PF00571, CBS domain, score 3.2e-10
529507007426	HMMPfam hit to PF00571, CBS domain, score 4.7e-12
529507007427	exodeoxyribonuclease VII large subunit; Reviewed; Region: xseA; PRK00286
529507007428	ExoVII_LU_OBF: A subfamily of OB folds corresponding to the N-terminal OB-fold domain of Escherichia coli exodeoxyribonuclease VII (ExoVII) large subunit. E. coli ExoVII is composed of two non-identical subunits. E. coli ExoVII is a...; Region: ExoVII_LU_OBF; cd04489
529507007429	generic binding surface II; other site
529507007430	generic binding surface I; other site
529507007431	HMMPfam hit to PF01336, OB-fold nucleic acid binding domain, score 1.6e-11
529507007432	HMMPfam hit to PF02601, Exonuclease VII, large subunit, score 4.3e-74
529507007433	TonB-dependent hemoglobin/transferrin/lactoferrin receptor family protein; Region: TonB-hemlactrns; TIGR01786
529507007434	Porin superfamily.  These outer membrane channels share a beta-barrel structure that differ in strand and shear number.  Classical (gram-negative ) porins are non-specific channels for small hydrophillic molecules and form 16 beta-stranded barrels (16,20)...; Region: OM_channels; cl17244
529507007435	HMMPfam hit to PF00593, TonB dependent receptor, score 1.2e-22
529507007436	This hit extended beyond the end of the feature by 1 aa and was clipped.; PS01156 TonB-dependent receptor proteins signature 2.
529507007437	HMMPfam hit to PF07715, TonB-dependent Receptor Plug Domain, score 4.8e-12
529507007438	Signal peptide predicted for PMI1548 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.988 between residues 25 and 26
529507007439	Protease II [Amino acid transport and metabolism]; Region: PtrB; COG1770
529507007440	Prolyl oligopeptidase family; Region: Peptidase_S9; pfam00326
529507007441	HMMPfam hit to PF00326, Prolyl oligopeptidase family, score 1.1e-102
529507007442	PS00708 Prolyl endopeptidase family serine active site.
529507007443	HMMPfam hit to PF02897, Prolyl oligopeptidase, N-terminal beta, score 1.2e-111
529507007444	Signal peptide predicted for PMI1549 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.998 between residues 29 and 30
529507007445	1 probable transmembrane helix predicted for PMI1549 by TMHMM2.0 at aa 12-29
529507007446	Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane]; Region: TonB; COG0810
529507007447	Gram-negative bacterial tonB protein; Region: TonB; pfam03544
529507007448	1 probable transmembrane helix predicted for PMI1550 by TMHMM2.0 at aa 20-39
529507007449	Protein of unknown function, DUF399; Region: DUF399; cl01139
529507007450	HMMPfam hit to PF04187, Protein of unknown function, DUF399, score 1.2e-49
529507007451	Signal peptide predicted for PMI1551 by SignalP 2.0 HMM (Signal peptide probability 0.998) with cleavage site probability 0.629 between residues 26 and 27
529507007452	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507007453	bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed; Region: PRK07232
529507007454	Malic enzyme, N-terminal domain; Region: malic; pfam00390
529507007455	NAD(P) binding domain of malic enzyme (ME), subgroup 2; Region: NAD_bind_2_malic_enz; cd05311
529507007456	putative NAD(P) binding site [chemical binding]; other site
529507007457	Phosphotransacetylase [Energy production and conversion]; Region: Pta; COG0280
529507007458	HMMPfam hit to PF01515, Phosphate acetyl/butaryl transferase, score 1.1e-117
529507007459	Predicted helix-turn-helix motif with score 1016.000, SD 2.65 at aa 514-535, sequence QEYYQIMKRRGVSQEQARRAVI
529507007460	HMMPfam hit to PF03949, Malic enzyme, NAD binding domain, score 1.7e-128
529507007461	HMMPfam hit to PF00390, Malic enzyme, N-terminal domain, score 1.2e-76
529507007462	transcriptional regulator NarP; Provisional; Region: PRK10403
529507007463	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
529507007464	active site
529507007465	phosphorylation site [posttranslational modification]
529507007466	intermolecular recognition site; other site
529507007467	C-terminal DNA-binding domain of LuxR-like proteins. This domain contains a helix-turn-helix motif and binds DNA. Proteins belonging to this group are response regulators; some act as transcriptional activators, others as transcriptional repressors. Many...; Region: LuxR_C_like; cd06170
529507007468	DNA binding residues [nucleotide binding]
529507007469	dimerization interface [polypeptide binding]; other site
529507007470	HMMPfam hit to PF00072, Response regulator receiver domain, score 6.9e-31
529507007471	HMMPfam hit to PF00196, Bacterial regulatory proteins, luxR fami, score 4e-24
529507007472	PS00622 Bacterial regulatory proteins, luxR family signature.
529507007473	Predicted helix-turn-helix motif with score 1585.000, SD 4.59 at aa 163-184, sequence MKNKQIAENLFISEETVKVHIR
529507007474	Signal peptide predicted for PMI1554 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.999 between residues 19 and 20
529507007475	Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC. The structure of Yffb and the conservation of the catalytic cysteine...; Region: ArsC_Yffb; cd03035
529507007476	ArsC family; Region: ArsC; pfam03960
529507007477	putative catalytic residues [active]
529507007478	HMMPfam hit to PF03960, ArsC family, score 3.8e-42
529507007479	succinyl-diaminopimelate desuccinylase; Reviewed; Region: PRK13009
529507007480	M20 Peptidase proteobacterial DapE encoded N-succinyl-L,L-diaminopimelic acid desuccinylase; Region: M20_DapE_proteobac; cd03891
529507007481	metal binding site [ion binding]; metal-binding site
529507007482	dimer interface [polypeptide binding]; other site
529507007483	PS00758 ArgE / dapE / ACY1 / CPG2 / yscS family signature 1.
529507007484	HMMPfam hit to PF01546, Peptidase family M20/M25/M40, score 1e-39
529507007485	PS00092 N-6 Adenine-specific DNA methylases signature.
529507007486	HMMPfam hit to PF07687, Peptidase dimerisation domain, score 1.9e-32
529507007487	D-alanyl-D-alanine carboxypeptidase [Cell envelope biogenesis, outer membrane]; Region: VanY; COG1876
529507007488	D-alanyl-D-alanine carboxypeptidase; Region: VanY; pfam02557
529507007489	HMMPfam hit to PF02557, D-alanyl-D-alanine carboxypeptidase, score 4.1e-08
529507007490	hypothetical protein; Provisional; Region: PRK10527
529507007491	HMMPfam hit to PF04304, Protein of unknown function (DUF454), score 7.7e-27
529507007492	3 probable transmembrane helices predicted for PMI1558 by TMHMM2.0 at aa 5-27, 78-97 and 99-118
529507007493	Signal peptide predicted for PMI1558 by SignalP 2.0 HMM (Signal peptide probability 0.968) with cleavage site probability 0.619 between residues 20 and 21
529507007494	Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only]; Region: COG1444
529507007495	Domain of unknown function (DUF1726); Region: DUF1726; pfam08351
529507007496	Helicase; Region: Helicase_RecD; pfam05127
529507007497	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cd04301
529507007498	Coenzyme A binding pocket [chemical binding]; other site
529507007499	Possible tRNA binding domain; Region: tRNA_bind_2; pfam13725
529507007500	HMMPfam hit to PF00583, Acetyltransferase (GNAT) family, score 6.8e-05
529507007501	HMMPfam hit to PF05127, ATPase (DUF699), score 3e-42
529507007502	PS00017 ATP/GTP-binding site motif A (P-loop).
529507007503	Protein of unknown function (DUF441); Region: DUF441; pfam04284
529507007504	HMMPfam hit to PF04284, Protein of unknown function (DUF441), score 1.2e-72
529507007505	4 probable transmembrane helices predicted for PMI1560 by TMHMM2.0 at aa 7-36, 51-73, 80-102 and 126-148
529507007506	Signal peptide predicted for PMI1560 by SignalP 2.0 HMM (Signal peptide probability 0.853) with cleavage site probability 0.542 between residues 29 and 30
529507007507	Predicted metalloprotease [General function prediction only]; Region: COG2321
529507007508	Putative neutral zinc metallopeptidase; Region: Zn_peptidase; pfam04228
529507007509	HMMPfam hit to PF04228, neutral zinc metallopeptidase, score 3e-140
529507007510	PS00142 Neutral zinc metallopeptidases, zinc-binding region signature.
529507007511	1 probable transmembrane helix predicted for PMI1561 by TMHMM2.0 at aa 41-63
529507007512	phosphoribosylaminoimidazole-succinocarboxamide synthase; Reviewed; Region: PRK09362
529507007513	bacterial and archaeal 5-aminoimidazole-4-(N-succinylcarboxamide) ribonucleotide (SAICAR) synthase; Region: SAICAR_synt_PurC; cd01415
529507007514	ATP binding site [chemical binding]; other site
529507007515	active site
529507007516	substrate binding site [chemical binding]; other site
529507007517	HMMPfam hit to PF01259, SAICAR synthetase, score 6.3e-110
529507007518	PS01058 SAICAR synthetase signature 2.
529507007519	PS01057 SAICAR synthetase signature 1.
529507007520	lipoprotein; Provisional; Region: PRK11679
529507007521	NlpB/DapX lipoprotein; Region: Lipoprotein_18; pfam06804
529507007522	HMMPfam hit to PF06804, NlpB/DapX lipoprotein, score 2e-131
529507007523	Signal peptide predicted for PMI1563 by SignalP 2.0 HMM (Signal peptide probability 0.973) with cleavage site probability 0.293 between residues 26 and 27
529507007524	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507007525	Dihydrodipicolinate synthase (DHDPS); Region: DHDPS; cd00950
529507007526	dihydrodipicolinate synthase; Region: dapA; TIGR00674
529507007527	dimer interface [polypeptide binding]; other site
529507007528	active site
529507007529	catalytic residue [active]
529507007530	HMMPfam hit to PF00701, Dihydrodipicolinate synthetase family, score 2.6e-153
529507007531	PS00666 Dihydrodipicolinate synthetase signature 2.
529507007532	PS00665 Dihydrodipicolinate synthetase signature 1.
529507007533	glycine cleavage system transcriptional repressor; Provisional; Region: gcvR; PRK11589
529507007534	ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains; Region: ACT_GcvR_1; cd04893
529507007535	ACT domain; Region: ACT_5; pfam13710
529507007536	HMMPfam hit to PF01842, ACT domain, score 0.00026
529507007537	HMMPfam hit to PF01842, ACT domain, score 0.00061
529507007538	Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing...; Region: PRX_BCP; cd03017
529507007539	Thioredoxin-like; Region: Thioredoxin_8; pfam13905
529507007540	catalytic triad [active]
529507007541	HMMPfam hit to PF00578, AhpC/TSA family, score 8.9e-63
529507007542	Predicted permease, member of the PurR regulon [General function prediction only]; Region: yhhT; COG0628
529507007543	Domain of unknown function DUF20; Region: UPF0118; pfam01594
529507007544	HMMPfam hit to PF01594, Domain of unknown function DUF20, score 6e-87
529507007545	7 probable transmembrane helices predicted for PMI1567 by TMHMM2.0 at aa 21-52, 67-89, 153-175, 217-234, 241-263, 278-297 and 310-332
529507007546	Putative Zn-dependent protease, contains TPR repeats [General function prediction only]; Region: COG4783
529507007547	Peptidase family M48; Region: Peptidase_M48; pfam01435
529507007548	Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi; Region: TPR; cd00189
529507007549	TPR motif; other site
529507007550	binding surface
529507007551	Signal peptide predicted for PMI1568 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.999 between residues 27 and 28
529507007552	HMMPfam hit to PF01435, Peptidase family M48, score 2e-30
529507007553	HMMPfam hit to PF07719, no description, score 2.1
529507007554	Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli. E. coli ArsC catalyzes the reduction of arsenate [As(V)] to arsenite [As(III)], the first step in the...; Region: ArsC_ArsC; cd03034
529507007555	ArsC family; Region: ArsC; pfam03960
529507007556	catalytic residues [active]
529507007557	HMMPfam hit to PF03960, ArsC family, score 1.6e-40
529507007558	nucleoside transporter; Region: 2A0110; TIGR00889
529507007559	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507007560	putative substrate translocation pore; other site
529507007561	HMMPfam hit to PF03825, Nucleoside H+ symporter, score 4.3e-131
529507007562	HMMPfam hit to PF01306, LacY proton/sugar symporter, score 3.2e-05
529507007563	12 probable transmembrane helices predicted for PMI1570 by TMHMM2.0 at aa 12-34, 49-71, 78-100, 105-127, 144-166, 171-190, 221-243, 263-285, 292-311, 321-343, 356-378 and 393-415
529507007564	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 1.3e-16
529507007565	DNA replication initiation factor; Provisional; Region: PRK08084
529507007566	ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]; Region: DnaA; COG0593
529507007567	Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane]; Region: MscS; COG0668
529507007568	Mechanosensitive ion channel; Region: MS_channel; pfam00924
529507007569	HMMPfam hit to PF00924, Mechanosensitive ion channel, score 7.9e-24
529507007570	4 probable transmembrane helices predicted for PMI1572 by TMHMM2.0 at aa 15-37, 94-116, 131-153 and 158-180
529507007571	uracil transporter; Provisional; Region: PRK10720
529507007572	12 probable transmembrane helices predicted for PMI1573 by TMHMM2.0 at aa 20-39, 44-61, 68-85, 89-111, 116-138, 158-180, 185-207, 227-249, 304-326, 331-353, 365-387 and 392-411
529507007573	HMMPfam hit to PF00860, Permease family, score 1e-128
529507007574	PS01116 Xanthine/uracil permeases family signature.
529507007575	Phosphoribosyl transferase (PRT)-type I domain; Region: PRTases_typeI; cd06223
529507007576	active site
529507007577	HMMPfam hit to PF00156, Phosphoribosyl transferase domain, score 1.3e-13
529507007578	phosphoribosylaminoimidazole synthetase; Provisional; Region: PRK05385
529507007579	PurM (Aminoimidazole Ribonucleotide [AIR] synthetase), one of eleven enzymes required for purine biosynthesis, catalyzes the conversion of formylglycinamide ribonucleotide (FGAM) and ATP to AIR, ADP, and Pi, the fifth step in de novo purine biosynthesis; Region: PurM; cd02196
529507007580	dimerization interface [polypeptide binding]; other site
529507007581	putative ATP binding site [chemical binding]; other site
529507007582	HMMPfam hit to PF00586, AIR synthase related protein, N-terminal dom, score 6.1e-75
529507007583	HMMPfam hit to PF02769, AIR synthase related protein, C-terminal dom, score 1.7e-45
529507007584	phosphoribosylglycinamide formyltransferase; Reviewed; Region: purN; PRK05647
529507007585	Phosphoribosylglycinamide formyltransferase (GAR transformylase, GART); Region: FMT_core_GART; cd08645
529507007586	active site
529507007587	substrate binding site [chemical binding]; other site
529507007588	cosubstrate binding site; other site
529507007589	catalytic site [active]
529507007590	HMMPfam hit to PF00551, Formyl transferase, score 4.2e-80
529507007591	PS00373 Phosphoribosylglycinamide formyltransferase active site.
529507007592	spermidine N1-acetyltransferase; Provisional; Region: PRK15130
529507007593	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cd04301
529507007594	Coenzyme A binding pocket [chemical binding]; other site
529507007595	HMMPfam hit to PF00583, Acetyltransferase (GNAT) family, score 6.2e-20
529507007596	polyphosphate kinase; Provisional; Region: PRK05443
529507007597	Polyphosphate kinase N-terminal domain; Region: PP_kinase_N; pfam13089
529507007598	Polyphosphate kinase middle domain; Region: PP_kinase; pfam02503
529507007599	Catalytic C-terminal domain, first repeat, of Escherichia coli polyphosphate kinase 1 and similar proteins; Region: PLDc_EcPPK1_C1_like; cd09164
529507007600	domain interface [polypeptide binding]; other site
529507007601	active site
529507007602	catalytic site [active]
529507007603	Catalytic C-terminal domain, second repeat, of Escherichia coli polyphosphate kinase 1 and similar proteins; Region: PLDc_EcPPK1_C2_like; cd09167
529507007604	domain interface [polypeptide binding]; other site
529507007605	active site
529507007606	catalytic site [active]
529507007607	HMMPfam hit to PF02503, Polyphosphate kinase, score 0
529507007608	exopolyphosphatase; Provisional; Region: PRK10854
529507007609	Ppx/GppA phosphatase family; Region: Ppx-GppA; pfam02541
529507007610	HMMPfam hit to PF02541, Ppx/GppA phosphatase family, score 3.1e-114
529507007611	Predicted helix-turn-helix motif with score 1191.000, SD 3.24 at aa 320-341, sequence RTAKSLAEHYNIDREQAKRVLT
529507007612	Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism]; Region: MgtE; COG2239
529507007613	MgtE intracellular N domain; Region: MgtE_N; smart00924
529507007614	This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE.  MgtE and its homologs are found in eubacteria, archaebacteria, and eukaryota. Members of this family transport Mg2+ or other...; Region: CBS_pair_Mg_transporter; cd04606
529507007615	Divalent cation transporter; Region: MgtE; cl00786
529507007616	HMMPfam hit to PF03448, MgtE intracellular domain, score 2.3e-33
529507007617	HMMPfam hit to PF00571, CBS domain, score 0.22
529507007618	HMMPfam hit to PF00571, CBS domain, score 8.4e-06
529507007619	HMMPfam hit to PF01769, Divalent cation transporter, score 4.4e-13
529507007620	3 probable transmembrane helices predicted for PMI1580 by TMHMM2.0 at aa 398-420, 427-449 and 464-486
529507007621	metabolite-proton symporter; Region: 2A0106; TIGR00883
529507007622	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507007623	HMMPfam hit to PF00083, Sugar (and other) transporter, score 1.1e-19
529507007624	12 probable transmembrane helices predicted for PMI1581 by TMHMM2.0 at aa 26-48, 63-85, 98-120, 130-152, 164-186, 199-221, 253-275, 290-312, 319-338, 348-370, 383-405 and 415-437
529507007625	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 3.6e-12
529507007626	RES domain; Region: RES; pfam08808
529507007627	PS00017 ATP/GTP-binding site motif A (P-loop).
529507007628	Predicted helix-turn-helix motif with score 1534.000, SD 4.41 at aa 96-117, sequence CRASQAAAILGVKRQTINNRLK
529507007629	dipeptide/tripeptide permease B; Provisional; Region: PRK10207
529507007630	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507007631	putative substrate translocation pore; other site
529507007632	POT family; Region: PTR2; pfam00854
529507007633	13 probable transmembrane helices predicted for PMI1584 by TMHMM2.0 at aa 60-82, 91-108, 118-140, 153-175, 179-201, 222-241, 245-263, 276-293, 328-345, 352-374, 384-406, 419-441 and 461-483
529507007634	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 6.2e-13
529507007635	HMMPfam hit to PF00854, POT family, score 1.7e-104
529507007636	PS01023 PTR2 family proton/oligopeptide symporters signature 2.
529507007637	PS01022 PTR2 family proton/oligopeptide symporters signature 1.
529507007638	multidrug efflux system subunit MdtA; Provisional; Region: PRK11556
529507007639	Biotin-lipoyl like; Region: Biotin_lipoyl_2; pfam13533
529507007640	HlyD family secretion protein; Region: HlyD_3; pfam13437
529507007641	Signal peptide predicted for PMI1585 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.613 between residues 26 and 27
529507007642	1 probable transmembrane helix predicted for PMI1585 by TMHMM2.0 at aa 13-30
529507007643	HMMPfam hit to PF00529, HlyD family secretion protein, score 8.5e-20
529507007644	multidrug efflux system subunit MdtB; Provisional; Region: PRK10503
529507007645	Protein export membrane protein; Region: SecD_SecF; cl14618
529507007646	HMMPfam hit to PF00873, AcrB/AcrD/AcrF family, score 0
529507007647	11 probable transmembrane helices predicted for PMI1586 by TMHMM2.0 at aa 15-37, 343-362, 366-388, 395-417, 437-459, 472-494, 535-557, 867-889, 909-931, 968-990 and 1000-1022
529507007648	multidrug efflux system subunit MdtC; Provisional; Region: PRK10614
529507007649	Protein export membrane protein; Region: SecD_SecF; cl14618
529507007650	Signal peptide predicted for PMI1587 by SignalP 2.0 HMM (Signal peptide probability 0.917) with cleavage site probability 0.201 between residues 35 and 36
529507007651	HMMPfam hit to PF00873, AcrB/AcrD/AcrF family, score 0
529507007652	10 probable transmembrane helices predicted for PMI1587 by TMHMM2.0 at aa 12-34, 336-353, 360-382, 428-450, 463-485, 528-547, 853-875, 895-917, 949-971 and 986-1008
529507007653	signal transduction histidine-protein kinase BaeS; Provisional; Region: PRK10549
529507007654	Histidine kinase, Adenylyl cyclase, Methyl-accepting protein, and Phosphatase (HAMP) domain. HAMP is a signaling domain which occurs in a wide variety of signaling proteins, many of which are bacterial. The HAMP domain consists of two alpha helices...; Region: HAMP; cd06225
529507007655	dimerization interface [polypeptide binding]; other site
529507007656	Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via...; Region: HisKA; cd00082
529507007657	dimer interface [polypeptide binding]; other site
529507007658	phosphorylation site [posttranslational modification]
529507007659	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
529507007660	ATP binding site [chemical binding]; other site
529507007661	Mg2+ binding site [ion binding]; other site
529507007662	G-X-G motif; other site
529507007663	Signal peptide predicted for PMI1588 by SignalP 2.0 HMM (Signal peptide probability 0.996) with cleavage site probability 0.806 between residues 31 and 32
529507007664	2 probable transmembrane helices predicted for PMI1588 by TMHMM2.0 at aa 7-26 and 160-182
529507007665	HMMPfam hit to PF00672, HAMP domain, score 7.6e-20
529507007666	HMMPfam hit to PF00512, His Kinase A (phosphoacceptor) domain, score 3.5e-14
529507007667	HMMPfam hit to PF02518, Histidine kinase-, DNA gyrase B-, and HSP90, score 3.8e-30
529507007668	DNA-binding transcriptional regulator BaeR; Provisional; Region: PRK10710
529507007669	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
529507007670	active site
529507007671	phosphorylation site [posttranslational modification]
529507007672	intermolecular recognition site; other site
529507007673	dimerization interface [polypeptide binding]; other site
529507007674	Effector domain of response regulator. Bacteria and certain eukaryotes like protozoa and higher plants use two-component signal transduction systems to detect and respond to changes in the environment. The system consists of a sensor histidine kinase and...; Region: trans_reg_C; cd00383
529507007675	DNA binding site [nucleotide binding]
529507007676	HMMPfam hit to PF00072, Response regulator receiver domain, score 4.1e-33
529507007677	HMMPfam hit to PF00486, Transcriptional regulatory protein, C te, score 1.3e-21
529507007678	putative protease; Provisional; Region: PRK15452
529507007679	Peptidase family U32; Region: Peptidase_U32; pfam01136
529507007680	HMMPfam hit to PF01136, Peptidase family U32, score 5.8e-148
529507007681	PS01276 Peptidase family U32 signature.
529507007682	lipid kinase; Reviewed; Region: PRK13054
529507007683	Diacylglycerol kinase catalytic domain; Region: DAGK_cat; pfam00781
529507007684	HMMPfam hit to PF00781, Diacylglycerol kinase catalytic domain (pres, score 1.1e-28
529507007685	PS00217 Sugar transport proteins signature 2.
529507007686	fructose-bisphosphate aldolase; Provisional; Region: PRK09250
529507007687	Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs); Region: DhnA; cd00958
529507007688	putative active site; other site
529507007689	catalytic residue [active]
529507007690	HMMPfam hit to PF01791, Deoxyribose-phosphate aldolase, score 3.3e-120
529507007691	4-amino-5-hydroxymethyl-2-methyl-pyrimidine phosphate kinase (HMPP-kinase) catalyzes two consecutive phosphorylation steps in the thiamine phosphate biosynthesis pathway, leading to the synthesis of vitamin B1. The first step is the phosphorylation of...; Region: HMPP_kinase; cd01169
529507007692	dimer interface [polypeptide binding]; other site
529507007693	substrate binding site [chemical binding]; other site
529507007694	ATP binding site [chemical binding]; other site
529507007695	phospholipid:lipid A palmitoyltransferase; Provisional; Region: pagP; PRK11045
529507007696	Signal peptide predicted for PMI1595 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.999 between residues 33 and 34
529507007697	HMMPfam hit to PF07017, Antimicrobial peptide resistance and lipid A, score 3.6e-93
529507007698	aromatic amino acid transporter; Provisional; Region: PRK10238
529507007699	HMMPfam hit to PF00324, Amino acid permease, score 1.6e-147
529507007700	12 probable transmembrane helices predicted for PMI1596 by TMHMM2.0 at aa 27-46, 50-72, 92-114, 129-151, 160-182, 202-224, 245-267, 287-309, 336-358, 362-384, 404-426 and 430-448
529507007701	PS00218 Amino acid permeases signature.
529507007702	DNA-binding transcriptional regulator SoxS; Provisional; Region: PRK10219
529507007703	Bacterial regulatory helix-turn-helix proteins, AraC family; Region: HTH_AraC; pfam00165
529507007704	HMMPfam hit to PF00165, Bacterial regulatory helix-turn-helix protei, score 1.7e-08
529507007705	Predicted helix-turn-helix motif with score 1080.000, SD 2.87 at aa 25-46, sequence IHLEELAAYSGYSLWHMQKIFK
529507007706	PS00041 Bacterial regulatory proteins, araC family signature.
529507007707	HMMPfam hit to PF00165, Bacterial regulatory helix-turn-helix protei, score 4.9e-12
529507007708	sugar phosphate phosphatase; Provisional; Region: PRK10513
529507007709	Haloacid dehalogenase-like hydrolases. The haloacid dehalogenase-like (HAD) superfamily includes L-2-haloacid dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, and many others; Region: HAD_like; cd01427
529507007710	active site
529507007711	motif I; other site
529507007712	motif II; other site
529507007713	Haloacid dehalogenase-like hydrolases. The haloacid dehalogenase-like (HAD) superfamily includes L-2-haloacid dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, and many others; Region: HAD_like; cd01427
529507007714	HMMPfam hit to PF00702, haloacid dehalogenase-like hydrolase, score 2.6e-09
529507007715	PS01228 Hypothetical cof family signature 1.
529507007716	PS01229 Hypothetical cof family signature 2.
529507007717	Branched-chain amino acid transport protein; Region: Branch_AA_trans; pfam05525
529507007718	Signal peptide predicted for PMI1599 by SignalP 2.0 HMM (Signal peptide probability 0.928) with cleavage site probability 0.418 between residues 21 and 22
529507007719	HMMPfam hit to PF05525, Branched-chain amino acid transport p, score 3.7e-167
529507007720	12 probable transmembrane helices predicted for PMI1599 by TMHMM2.0 at aa 7-29, 39-61, 73-95, 117-136, 143-165, 191-213, 234-256, 282-304, 317-336, 340-362, 374-392 and 414-436
529507007721	N-acetyl-anhydromuramyl-L-alanine amidase [Cell envelope biogenesis, outer membrane]; Region: ampD; COG3023
529507007722	Peptidoglycan recognition proteins (PGRPs) are pattern recognition receptors that bind, and in certain cases, hydrolyze peptidoglycans (PGNs) of bacterial cell walls. PGRPs have been divided into three classes: short PGRPs (PGRP-S), that are small (20...; Region: PGRP; cd06583
529507007723	amidase catalytic site [active]
529507007724	Zn binding residues [ion binding]; other site
529507007725	substrate binding site [chemical binding]; other site
529507007726	Putative peptidoglycan binding domain; Region: PG_binding_1; pfam01471
529507007727	HMMPfam hit to PF01510, N-acetylmuramoyl-L-alanine amidase, score 8.1e-31
529507007728	Signal peptide predicted for PMI1600 by SignalP 2.0 HMM (Signal peptide probability 0.804) with cleavage site probability 0.460 between residues 22 and 23
529507007729	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507007730	Na+/alanine symporter [Amino acid transport and metabolism]; Region: AlsT; COG1115
529507007731	Sodium:alanine symporter family; Region: Na_Ala_symp; pfam01235
529507007732	HMMPfam hit to PF01235, Sodium:alanine symporter family, score 2.9e-218
529507007733	10 probable transmembrane helices predicted for PMI1601 by TMHMM2.0 at aa 13-35, 80-102, 141-163, 178-200, 207-224, 234-256, 302-324, 344-366, 387-409 and 419-436
529507007734	PS00873 Sodium:alanine symporter family signature.
529507007735	DNA polymerase III subunit theta; Reviewed; Region: PRK10969
529507007736	HMMPfam hit to PF06440, DNA polymerase III, theta subunit, score 9.3e-37
529507007737	YebF-like protein; Region: YebF; pfam13995
529507007738	Signal peptide predicted for PMI1603 by SignalP 2.0 HMM (Signal peptide probability 0.718) with cleavage site probability 0.708 between residues 27 and 28
529507007739	hypothetical protein; Provisional; Region: PRK05114
529507007740	HMMPfam hit to PF03701, Uncharacterised protein family (UPF0181), score 1.1e-29
529507007741	aminodeoxychorismate synthase subunit I; Provisional; Region: pabB; PRK15465
529507007742	Anthranilate synthase component I, N terminal region; Region: Anth_synt_I_N; pfam04715
529507007743	chorismate binding enzyme; Region: Chorismate_bind; cl10555
529507007744	HMMPfam hit to PF04715, Anthranilate synthase component I, N, score 1.1e-26
529507007745	HMMPfam hit to PF00425, chorismate binding enzyme, score 1e-124
529507007746	Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes. The need of CoAses mainly arises under conditions of oxidative...; Region: CoAse; cd03426
529507007747	putative active site [active]
529507007748	putative CoA binding site [chemical binding]; other site
529507007749	nudix motif; other site
529507007750	metal binding site [ion binding]; metal-binding site
529507007751	HMMPfam hit to PF00293, NUDIX domain, score 1.3e-13
529507007752	L-serine dehydratase, iron-sulfur-dependent, single chain form; Region: sda_mono; TIGR00720
529507007753	Serine dehydratase beta chain; Region: SDH_beta; pfam03315
529507007754	Serine dehydratase alpha chain; Region: SDH_alpha; pfam03313
529507007755	HMMPfam hit to PF03315, Serine dehydratase beta chain, score 6.7e-94
529507007756	HMMPfam hit to PF03313, Serine dehydratase alpha chain, score 1.2e-194
529507007757	hypothetical protein; Provisional; Region: PRK11469
529507007758	Domain of unknown function DUF; Region: DUF204; pfam02659
529507007759	Domain of unknown function DUF; Region: DUF204; pfam02659
529507007760	6 probable transmembrane helices predicted for PMI1608 by TMHMM2.0 at aa 20-42, 55-77, 82-104, 125-147, 152-174 and 187-209
529507007761	HMMPfam hit to PF02659, Domain of unknown function DUF, score 2.8e-26
529507007762	HMMPfam hit to PF02659, Domain of unknown function DUF, score 1.7e-21
529507007763	23S rRNA methyltransferase A; Provisional; Region: rrmA; PRK11088
529507007764	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
529507007765	S-adenosylmethionine binding site [chemical binding]; other site
529507007766	phosphate-starvation-inducible protein PsiE; Provisional; Region: PRK02833
529507007767	HMMPfam hit to PF06146, Phosphate-starvation-inducible E, score 2.3e-58
529507007768	4 probable transmembrane helices predicted for PMI1610 by TMHMM2.0 at aa 21-43, 66-88, 95-112 and 122-139
529507007769	Usp: Universal stress protein family. The universal stress protein Usp is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. Usp enhances the rate of cell survival during prolonged exposure to...; Region: USP_Like; cd00293
529507007770	Ligand Binding Site [chemical binding]; other site
529507007771	HMMPfam hit to PF00582, Universal stress protein family, score 3e-12
529507007772	Metal-dependent hydrolases of the beta-lactamase superfamily II [General function prediction only]; Region: COG1237
529507007773	HMMPfam hit to PF00753, Metallo-beta-lactamase superfamily, score 4.6e-09
529507007774	Usp: Universal stress protein family. The universal stress protein Usp is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. Usp enhances the rate of cell survival during prolonged exposure to...; Region: USP_Like; cd00293
529507007775	Ligand Binding Site [chemical binding]; other site
529507007776	HMMPfam hit to PF00582, Universal stress protein family, score 2.5e-11
529507007777	D-alanine/D-serine/glycine permease; Provisional; Region: PRK11049
529507007778	HMMPfam hit to PF00324, Amino acid permease, score 5.3e-151
529507007779	12 probable transmembrane helices predicted for PMI1614 by TMHMM2.0 at aa 21-43, 47-69, 93-115, 135-157, 162-184, 213-235, 248-270, 285-307, 342-364, 374-396, 409-431 and 441-459
529507007780	PS00218 Amino acid permeases signature.
529507007781	Predicted symporter [General function prediction only]; Region: DhlC; COG4147
529507007782	Na(+)/proline cotransporter PutP and related proteins; solute binding domain; Region: SLC5sbd_PutP; cd11475
529507007783	Na binding site [ion binding]; other site
529507007784	12 probable transmembrane helices predicted for PMI1615 by TMHMM2.0 at aa 13-35, 77-99, 138-160, 175-197, 202-224, 244-266, 287-309, 324-346, 382-401, 411-433, 440-458 and 462-484
529507007785	PS00457 Sodium:solute symporter family signature 2.
529507007786	HMMPfam hit to PF00474, Sodium:solute symporter family, score 3.9e-183
529507007787	PS00456 Sodium:solute symporter family signature 1.
529507007788	trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed; Region: putA; PRK11809
529507007789	Predicted transcriptional regulator [Transcription]; Region: COG3905
529507007790	Proline dehydrogenase [Amino acid transport and metabolism]; Region: PutA; COG0506
529507007791	Delta(1)-pyrroline-5-carboxylate dehydrogenase, PutA; Region: ALDH_PutA-P5CDH; cd07125
529507007792	Glutamate binding site [chemical binding]; other site
529507007793	NAD binding site [chemical binding]; other site
529507007794	catalytic residues [active]
529507007795	HMMPfam hit to PF01619, Proline dehydrogenase, score 4.5e-186
529507007796	HMMPfam hit to PF00171, Aldehyde dehydrogenase family, score 5e-75
529507007797	PS00687 Aldehyde dehydrogenases glutamic acid active site.
529507007798	PS00070 Aldehyde dehydrogenases cysteine active site.
529507007799	flagellar locus
529507007800	flagella biosynthesis protein FliZ; Provisional; Region: PRK11582
529507007801	HMMPfam hit to PF02899, Phage integrase, N-terminal SAM-like d, score 0.023
529507007802	PS00190 Cytochrome c family heme-binding site signature.
529507007803	flagellar biosynthesis sigma factor; Validated; Region: fliA; PRK06986
529507007804	Sigma-70 region 2; Region: Sigma70_r2; pfam04542
529507007805	Sigma-70 region 3; Region: Sigma70_r3; pfam04539
529507007806	Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs). A SF is a dissociable subunit of RNA polymerase, it directs bacterial or...; Region: Sigma70_r4; cd06171
529507007807	DNA binding residues [nucleotide binding]
529507007808	HMMPfam hit to PF04545, Sigma-70, region, score 1.1e-19
529507007809	PS00716 Sigma-70 factors family signature 2.
529507007810	Predicted helix-turn-helix motif with score 1451.000, SD 4.13 at aa 209-230, sequence LNLKEIGAVLNVGESRVSQLHS
529507007811	HMMPfam hit to PF04539, Sigma-70 region, score 1.3e-20
529507007812	HMMPfam hit to PF04542, Sigma-70 region, score 2.5e-18
529507007813	PS00715 Sigma-70 factors family signature 1.
529507007814	flagellin; Validated; Region: PRK06819
529507007815	Bacterial flagellin N-terminal helical region; Region: Flagellin_N; pfam00669
529507007816	Bacterial flagellin C-terminal helical region; Region: Flagellin_C; pfam00700
529507007817	HMMPfam hit to PF00700, Bacterial flagellin C-terminus, score 2.3e-39
529507007818	Predicted helix-turn-helix motif with score 1004.000, SD 2.61 at aa 323-344, sequence ESRSKLGAIQNRFQSTINNLNN
529507007819	HMMPfam hit to PF00669, Bacterial flagellin N-terminus, score 1.4e-80
529507007820	flagellin; Validated; Region: PRK06819
529507007821	Bacterial flagellin N-terminal helical region; Region: Flagellin_N; pfam00669
529507007822	Bacterial flagellin C-terminal helical region; Region: Flagellin_C; pfam00700
529507007823	HMMPfam hit to PF00700, Bacterial flagellin C-terminus, score 1.1e-39
529507007824	HMMPfam hit to PF00669, Bacterial flagellin N-terminus, score 6e-82
529507007825	flagellar capping protein; Reviewed; Region: fliD; PRK08032
529507007826	Flagellar hook-associated protein 2 C-terminus; Region: FliD_N; pfam02465
529507007827	Flagellar hook-associated protein 2 C-terminus; Region: FliD_C; pfam07195
529507007828	HMMPfam hit to PF02465, Flagellar hook-associated protein, score 4.5e-35
529507007829	HMMPfam hit to PF07196, Flagellin hook IN motif, score 1.4e-10
529507007830	HMMPfam hit to PF07195, Flagellar hook-associated protein, score 2.3e-73
529507007831	flagellar protein FliS; Validated; Region: fliS; PRK05685
529507007832	HMMPfam hit to PF02561, Flagellar protein FliS, score 6.8e-38
529507007833	Flagellar protein FliT; Region: FliT; cl05125
529507007834	HMMPfam hit to PF05400, Flagellar protein FliT, score 6.9e-26
529507007835	PS00120 Lipases, serine active site.
529507007836	Signal peptide predicted for PMI1627 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 1.000 between residues 20 and 21
529507007837	PS00017 ATP/GTP-binding site motif A (P-loop).
529507007838	flagellar hook-basal body protein FliE; Reviewed; Region: fliE; PRK00253
529507007839	HMMPfam hit to PF02049, Flagellar hook-basal body complex protein Fl, score 4.5e-27
529507007840	flagellar MS-ring protein; Reviewed; Region: fliF; PRK06007
529507007841	Secretory protein of YscJ/FliF family; Region: YscJ_FliF; pfam01514
529507007842	Flagellar M-ring protein C-terminal; Region: YscJ_FliF_C; pfam08345
529507007843	HMMPfam hit to PF01514, Secretory protein of YscJ/FliF family, score 3.3e-89
529507007844	1 probable transmembrane helix predicted for PMI1630 by TMHMM2.0 at aa 28-50
529507007845	flagellar motor switch protein G; Validated; Region: fliG; PRK05686
529507007846	FliG C-terminal domain; Region: FliG_C; pfam01706
529507007847	HMMPfam hit to PF01706, FliG C-terminal domain, score 6.9e-57
529507007848	flagellar assembly protein H; Validated; Region: fliH; PRK05687
529507007849	Essential protein Yae1, N terminal; Region: Yae1_N; pfam09811
529507007850	Flagellar assembly protein FliH; Region: FliH; pfam02108
529507007851	HMMPfam hit to PF02108, Flagellar assembly protein FliH, score 7.8e-40
529507007852	flagellum-specific ATP synthase; Validated; Region: fliI; PRK07960
529507007853	Flagellum-specific ATPase/type III secretory pathway virulence-related protein. This group of ATPases are responsible for the export of flagellum and virulence-related proteins. The bacterial flagellar motor is similar to the F0F1-ATPase, in that they...; Region: ATPase_flagellum-secretory_path_III; cd01136
529507007854	Walker A motif/ATP binding site; other site
529507007855	Walker B motif; other site
529507007856	HMMPfam hit to PF00006, ATP synthase alpha/beta family, nucleotid, score 3.3e-110
529507007857	PS00017 ATP/GTP-binding site motif A (P-loop).
529507007858	PS00152 ATP synthase alpha and beta subunits signature.
529507007859	flagellar biosynthesis chaperone; Validated; Region: fliJ; PRK05689
529507007860	Flagellar biosynthesis chaperone [Cell motility and secretion / Intracellular trafficking and secretion / Posttranslational modification, protein turnover, chaperones]; Region: FliJ; COG2882
529507007861	HMMPfam hit to PF02050, Flagellar FliJ protein, score 3e-38
529507007862	Flagellar hook-length control protein FliK; Region: Flg_hook; cl17777
529507007863	Flagellar hook-length control protein [Cell motility and secretion]; Region: FliK; COG3144
529507007864	HMMPfam hit to PF02120, Flagellar hook-length control protein, score 1.9e-25
529507007865	flagellar basal body-associated protein FliL; Reviewed; Region: fliL; PRK07021
529507007866	Signal peptide predicted for PMI1636 by SignalP 2.0 HMM (Signal peptide probability 0.998) with cleavage site probability 0.622 between residues 30 and 31
529507007867	HMMPfam hit to PF03748, Flagellar basal body-associated protein FliL, score 2.9e-25
529507007868	1 probable transmembrane helix predicted for PMI1636 by TMHMM2.0 at aa 13-35
529507007869	flagellar motor switch protein FliM; Validated; Region: fliM; PRK06666
529507007870	Surface presentation of antigens (SPOA); Region: SpoA; pfam01052
529507007871	HMMPfam hit to PF02154, Flagellar motor switch protein FliM, score 7.1e-108
529507007872	flagellar motor switch protein FliN; Validated; Region: fliN; PRK07963
529507007873	flagellar motor switch protein; Validated; Region: fliN; PRK05698
529507007874	HMMPfam hit to PF01052, Surface presentation of antigens (SPOA) prot, score 2.4e-34
529507007875	Flagellar biosynthesis protein, FliO; Region: FliO; pfam04347
529507007876	1 probable transmembrane helix predicted for PMI1639 by TMHMM2.0 at aa 36-58
529507007877	HMMPfam hit to PF04347, Flagellar biosynthesis protein, FliO, score 2.3e-24
529507007878	flagellar biosynthesis protein FliP; Reviewed; Region: fliP; PRK05699
529507007879	Signal peptide predicted for PMI1640 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.972 between residues 32 and 33
529507007880	5 probable transmembrane helices predicted for PMI1640 by TMHMM2.0 at aa 13-32, 56-78, 99-116, 196-218 and 225-247
529507007881	HMMPfam hit to PF00813, FliP family, score 3.5e-119
529507007882	PS01060 Flagella transport protein fliP family signature 1.
529507007883	PS01061 Flagella transport protein fliP family signature 2.
529507007884	flagellar biosynthesis protein FliQ; Validated; Region: fliQ; PRK05700
529507007885	Signal peptide predicted for PMI1641 by SignalP 2.0 HMM (Signal peptide probability 0.876) with cleavage site probability 0.862 between residues 40 and 41
529507007886	HMMPfam hit to PF01313, Bacterial export proteins, family, score 1.5e-36
529507007887	2 probable transmembrane helices predicted for PMI1641 by TMHMM2.0 at aa 20-42 and 55-77
529507007888	flagellar biosynthesis protein FliR; Reviewed; Region: fliR; PRK05701
529507007889	HMMPfam hit to PF01311, Bacterial export proteins, family, score 2.3e-76
529507007890	6 probable transmembrane helices predicted for PMI1642 by TMHMM2.0 at aa 15-34, 41-58, 68-87, 135-157, 177-199 and 211-233
529507007891	Signal peptide predicted for PMI1643 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.988 between residues 20 and 21
529507007892	flagellar hook-associated protein FlgL; Reviewed; Region: flgL; PRK08027
529507007893	Bacterial flagellin N-terminal helical region; Region: Flagellin_N; pfam00669
529507007894	HMMPfam hit to PF00669, Bacterial flagellin N-terminus, score 3.3e-09
529507007895	flagellar hook-associated protein FlgK; Validated; Region: flgK; PRK08147
529507007896	Flagella basal body rod protein; Region: Flg_bb_rod; pfam00460
529507007897	Flagellar basal body rod FlgEFG protein C-terminal; Region: Flg_bbr_C; pfam06429
529507007898	HMMPfam hit to PF06429, Domain of unknown function (DUF1078), score 6.5e-14
529507007899	HMMPfam hit to PF00460, Flagella basal body rod protein, score 8.3e-06
529507007900	Signal peptide predicted for PMI1645 by SignalP 2.0 HMM (Signal peptide probability 0.923) with cleavage site probability 0.589 between residues 18 and 19
529507007901	flagellar rod assembly protein/muramidase FlgJ; Validated; Region: flgJ; PRK05684
529507007902	Rod binding protein [Cell envelope biogenesis, outer membrane / Cell motility and secretion / Posttranslational modification, protein turnover, chaperones]; Region: COG3951
529507007903	Muramidase (flagellum-specific) [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FlgJ; COG1705
529507007904	HMMPfam hit to PF01832, Mannosyl-glycoprotein endo-beta-N-ace, score 4.4e-43
529507007905	PS00030 Eukaryotic RNA-binding region RNP-1 signature.
529507007906	flagellar basal body P-ring protein; Provisional; Region: flgI; PRK05303
529507007907	flagellar basal body P-ring protein; Reviewed; Region: flgI; cl14622
529507007908	HMMPfam hit to PF02119, Flagellar P-ring protein, score 3.2e-204
529507007909	Signal peptide predicted for PMI1647 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.994 between residues 22 and 23
529507007910	flagellar basal body L-ring protein; Reviewed; Region: flgH; PRK00249
529507007911	Flagellar basal body L-ring protein [Cell motility and secretion]; Region: FlgH; COG2063
529507007912	HMMPfam hit to PF02107, Flagellar L-ring protein, score 2.1e-85
529507007913	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507007914	flagellar basal body rod protein FlgG; Provisional; Region: flgG; PRK12693
529507007915	Flagella basal body rod protein; Region: Flg_bb_rod; pfam00460
529507007916	Flagellar basal body rod FlgEFG protein C-terminal; Region: Flg_bbr_C; pfam06429
529507007917	HMMPfam hit to PF06429, Domain of unknown function (DUF1078), score 2e-21
529507007918	HMMPfam hit to PF00460, Flagella basal body rod protein, score 4.5e-15
529507007919	PS00588 Flagella basal body rod proteins signature.
529507007920	flagellar basal body rod protein FlgF; Reviewed; Region: flgF; PRK12640
529507007921	flagellar basal-body rod protein FlgF; Region: flgF; TIGR02490
529507007922	HMMPfam hit to PF06429, Domain of unknown function (DUF1078), score 0.00056
529507007923	HMMPfam hit to PF00460, Flagella basal body rod protein, score 6.4e-10
529507007924	PS00588 Flagella basal body rod proteins signature.
529507007925	flagellar hook protein FlgE; Validated; Region: flgE; PRK05682
529507007926	Flagella basal body rod protein; Region: Flg_bb_rod; pfam00460
529507007927	Flagellar basal body protein FlaE; Region: FlaE; pfam07559
529507007928	Flagellar basal body rod FlgEFG protein C-terminal; Region: Flg_bbr_C; pfam06429
529507007929	HMMPfam hit to PF06429, Domain of unknown function (DUF1078), score 2.5e-18
529507007930	HMMPfam hit to PF07559, Flagellar basal body protein FlaE, score 3.2e-28
529507007931	HMMPfam hit to PF00460, Flagella basal body rod protein, score 3.3e-11
529507007932	PS00588 Flagella basal body rod proteins signature.
529507007933	flagellar basal body rod modification protein; Reviewed; Region: flgD; PRK06655
529507007934	Flagellar hook capping protein - N-terminal region; Region: FlgD; pfam03963
529507007935	FlgD Tudor-like domain; Region: FLgD_tudor; pfam13861
529507007936	HMMPfam hit to PF03963, Flagellar hook capping protein, score 6.1e-20
529507007937	flagellar basal body rod protein FlgC; Reviewed; Region: flgC; PRK05681
529507007938	Flagella basal body rod protein; Region: Flg_bb_rod; pfam00460
529507007939	Flagellar basal body rod FlgEFG protein C-terminal; Region: Flg_bbr_C; pfam06429
529507007940	HMMPfam hit to PF06429, Domain of unknown function (DUF1078), score 3.5e-08
529507007941	HMMPfam hit to PF00460, Flagella basal body rod protein, score 4.5e-09
529507007942	PS00588 Flagella basal body rod proteins signature.
529507007943	flagellar basal body rod protein FlgB; Reviewed; Region: flgB; PRK05680
529507007944	flagellar basal body rod protein FlgB; Reviewed; Region: flgB; PRK07182
529507007945	HMMPfam hit to PF00460, Flagella basal body rod protein, score 6.9e-10
529507007946	PS00588 Flagella basal body rod proteins signature.
529507007947	SAF-like; Region: SAF_2; pfam13144
529507007948	SAF domains of the flagella basal body P-ring formation protein FlgA and the flp pilus assembly CpaB; Region: SAF_CpaB_FlgA_like; cd11614
529507007949	Domains similar to fish antifreeze type III protein; Region: SAF; cl00555
529507007950	Signal peptide predicted for PMI1655 by SignalP 2.0 HMM (Signal peptide probability 0.707) with cleavage site probability 0.673 between residues 21 and 22
529507007951	HMMPfam hit to PF03240, FlgA family, score 8.4e-77
529507007952	anti-sigma28 factor FlgM; Provisional; Region: PRK10810
529507007953	HMMPfam hit to PF04316, Anti-sigma-28 factor, FlgM, score 8.7e-34
529507007954	FlgN protein; Region: FlgN; cl09176
529507007955	HMMPfam hit to PF05130, FlgN protein, score 1.8e-19
529507007956	haemagglutination activity domain; Region: Haemagg_act; pfam05860
529507007957	HMMPfam hit to PF05860, haemagglutination activity domain, score 8.2e-40
529507007958	1 probable transmembrane helix predicted for PMI1658 by TMHMM2.0 at aa 7-29
529507007959	Signal peptide predicted for PMI1658 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.975 between residues 24 and 25
529507007960	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507007961	flagellar biosynthesis protein FlhA; Validated; Region: flhA; PRK06012
529507007962	FHIPEP family; Region: FHIPEP; pfam00771
529507007963	HMMPfam hit to PF00771, FHIPEP family, score 0
529507007964	7 probable transmembrane helices predicted for PMI1659 by TMHMM2.0 at aa 21-38, 42-64, 76-98, 118-140, 209-231, 251-273 and 294-316
529507007965	PS00994 Bacterial export FHIPEP family signature.
529507007966	flagellar biosynthesis protein FlhB; Reviewed; Region: flhB; PRK12468
529507007967	Sec-independent protein translocase protein (TatC); Region: TatC; cl00521
529507007968	Uncharacterized homolog of the cytoplasmic domain of flagellar protein FhlB [Function unknown]; Region: COG2257; cl15822
529507007969	HMMPfam hit to PF01312, FlhB HrpN YscU SpaS Family, score 5.4e-149
529507007970	4 probable transmembrane helices predicted for PMI1660 by TMHMM2.0 at aa 33-55, 90-112, 143-165 and 189-211
529507007971	chemotaxis regulator CheZ; Provisional; Region: PRK11166
529507007972	HMMPfam hit to PF04344, Chemotaxis phosphatase, CheZ, score 1.9e-102
529507007973	chemotaxis regulatory protein CheY; Provisional; Region: PRK10610
529507007974	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
529507007975	active site
529507007976	phosphorylation site [posttranslational modification]
529507007977	intermolecular recognition site; other site
529507007978	dimerization interface [polypeptide binding]; other site
529507007979	HMMPfam hit to PF00072, Response regulator receiver domain, score 3.4e-39
529507007980	chemotaxis-specific methylesterase; Provisional; Region: PRK00742
529507007981	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
529507007982	active site
529507007983	phosphorylation site [posttranslational modification]
529507007984	intermolecular recognition site; other site
529507007985	dimerization interface [polypeptide binding]; other site
529507007986	CheB methylesterase; Region: CheB_methylest; pfam01339
529507007987	HMMPfam hit to PF01339, CheB methylesterase, score 1.6e-115
529507007988	HMMPfam hit to PF00072, Response regulator receiver domain, score 5.7e-32
529507007989	chemotaxis methyltransferase CheR; Provisional; Region: PRK10611
529507007990	CheR methyltransferase, all-alpha domain; Region: CheR_N; pfam03705
529507007991	CheR methyltransferase, SAM binding domain; Region: CheR; pfam01739
529507007992	HMMPfam hit to PF01739, CheR methyltransferase, SAM binding domain, score 9.3e-80
529507007993	HMMPfam hit to PF03705, CheR methyltransferase, all-alpha domain, score 2.2e-12
529507007994	methyl-accepting chemotaxis protein I; Provisional; Region: PRK15041
529507007995	ligand binding domain of Tar- and Tsr-related chemoreceptors; Region: Tar_Tsr_LBD; cd00181
529507007996	dimer interface [polypeptide binding]; other site
529507007997	ligand binding site [chemical binding]; other site
529507007998	Histidine kinase, Adenylyl cyclase, Methyl-accepting protein, and Phosphatase (HAMP) domain. HAMP is a signaling domain which occurs in a wide variety of signaling proteins, many of which are bacterial. The HAMP domain consists of two alpha helices...; Region: HAMP; cd06225
529507007999	dimerization interface [polypeptide binding]; other site
529507008000	Methyl-accepting chemotaxis protein (MCP), signaling domain; Region: MCP_signal; cd11386
529507008001	dimer interface [polypeptide binding]; other site
529507008002	putative CheW interface [polypeptide binding]; other site
529507008003	HMMPfam hit to PF00015, Methyl-accepting chemotaxis protein (MCP) s, score 4.8e-103
529507008004	PS00538 Bacterial chemotaxis sensory transducers signature.
529507008005	HMMPfam hit to PF00672, HAMP domain, score 1.1e-09
529507008006	2 probable transmembrane helices predicted for PMI1665 by TMHMM2.0 at aa 15-37 and 189-211
529507008007	HMMPfam hit to PF02203, Tar ligand binding domain homologue, score 5.6e-09
529507008008	Signal peptide predicted for PMI1665 by SignalP 2.0 HMM (Signal peptide probability 0.998) with cleavage site probability 0.468 between residues 27 and 28
529507008009	methyl-accepting chemotaxis protein I; Provisional; Region: PRK15041
529507008010	ligand binding domain of Tar- and Tsr-related chemoreceptors; Region: Tar_Tsr_LBD; cd00181
529507008011	dimer interface [polypeptide binding]; other site
529507008012	ligand binding site [chemical binding]; other site
529507008013	Histidine kinase, Adenylyl cyclase, Methyl-accepting protein, and Phosphatase (HAMP) domain. HAMP is a signaling domain which occurs in a wide variety of signaling proteins, many of which are bacterial. The HAMP domain consists of two alpha helices...; Region: HAMP; cd06225
529507008014	dimerization interface [polypeptide binding]; other site
529507008015	Methyl-accepting chemotaxis protein (MCP), signaling domain; Region: MCP_signal; cd11386
529507008016	dimer interface [polypeptide binding]; other site
529507008017	putative CheW interface [polypeptide binding]; other site
529507008018	HMMPfam hit to PF00015, Methyl-accepting chemotaxis protein (MCP) s, score 9.4e-114
529507008019	PS00538 Bacterial chemotaxis sensory transducers signature.
529507008020	HMMPfam hit to PF00672, HAMP domain, score 3.2e-13
529507008021	2 probable transmembrane helices predicted for PMI1666 by TMHMM2.0 at aa 10-32 and 196-218
529507008022	HMMPfam hit to PF02203, Tar ligand binding domain homologue, score 4.9e-09
529507008023	Signal peptide predicted for PMI1666 by SignalP 2.0 HMM (Signal peptide probability 0.962) with cleavage site probability 0.298 between residues 33 and 34
529507008024	CheW, a small regulator protein, unique to the chemotaxis signalling in prokaryotes and archea. CheW interacts with the histidine kinase CheA, most likely with the related regulatory domain of CheA. CheW is proposed to form signalling arrays together...; Region: CheW; cd00732
529507008025	putative CheA interaction surface; other site
529507008026	HMMPfam hit to PF01584, CheW-like domain, score 9.4e-32
529507008027	chemotaxis protein CheA; Provisional; Region: PRK10547
529507008028	Histidine Phosphotransfer domain, involved in signalling through a two part component systems in which an autophosphorylating histidine protein kinase serves as a phosphoryl donor to a response regulator protein; the response regulator protein is...; Region: HPT; cd00088
529507008029	putative binding surface; other site
529507008030	active site
529507008031	CheY binding; Region: CheY-binding; pfam09078
529507008032	Signal transducing histidine kinase, homodimeric domain; Region: H-kinase_dim; pfam02895
529507008033	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
529507008034	ATP binding site [chemical binding]; other site
529507008035	Mg2+ binding site [ion binding]; other site
529507008036	G-X-G motif; other site
529507008037	CheA regulatory domain; CheA is a histidine protein kinase present in bacteria and archea. Activated by the chemotaxis receptor a histidine phosphoryl group from CheA is passed directly to an aspartate in the response regulator CheY. This signalling...; Region: CheA_reg; cd00731
529507008038	HMMPfam hit to PF01584, CheW-like domain, score 4.4e-28
529507008039	HMMPfam hit to PF02518, Histidine kinase-, DNA gyrase B-, and HS, score 7.8e-26
529507008040	HMMPfam hit to PF02895, Signal transducing histidine kinase, hom, score 7.1e-25
529507008041	HMMPfam hit to PF01627, Hpt domain, score 8.4e-17
529507008042	PS00039 DEAD-box subfamily ATP-dependent helicases signature.
529507008043	Membrane MotB of proton-channel complex MotA/MotB; Region: MotB_plug; pfam13677
529507008044	Flagellar motor protein [Cell motility and secretion]; Region: MotB; COG1360
529507008045	Peptidoglycan binding domains similar to the C-terminal domain of outer-membrane protein OmpA; Region: OmpA_C-like; cd07185
529507008046	ligand binding site [chemical binding]; other site
529507008047	HMMPfam hit to PF00691, OmpA family, score 1.4e-20
529507008048	Signal peptide predicted for PMI1669 by SignalP 2.0 HMM (Signal peptide probability 0.842) with cleavage site probability 0.800 between residues 49 and 50
529507008049	1 probable transmembrane helix predicted for PMI1669 by TMHMM2.0 at aa 23-45
529507008050	Flagellar motor component [Cell motility and secretion]; Region: MotA; COG1291
529507008051	flagellar motor protein MotA; Validated; Region: PRK09110
529507008052	4 probable transmembrane helices predicted for PMI1670 by TMHMM2.0 at aa 2-24, 34-56, 172-191 and 201-223
529507008053	PS01307 Flagellar motor protein motA family signature.
529507008054	transcriptional activator FlhC; Provisional; Region: PRK12722
529507008055	HMMPfam hit to PF05280, Flagellar transcriptional activator (FlhC), score 4.2e-163
529507008056	transcriptional activator FlhD; Provisional; Region: PRK02909
529507008057	HMMPfam hit to PF05247, Flagellar transcriptional activator (FlhD), score 3.6e-67
529507008058	magnesium transport protein MgtC; Provisional; Region: PRK15385
529507008059	MgtC family; Region: MgtC; pfam02308
529507008060	HMMPfam hit to PF02308, MgtC family, score 4.8e-73
529507008061	4 probable transmembrane helices predicted for PMI1674 by TMHMM2.0 at aa 10-27, 39-58, 68-85 and 98-120
529507008062	hypothetical protein; Provisional; Region: PRK10708
529507008063	Cold-Shock Protein (CSP) contains an S1-like cold-shock domain (CSD) that is found in eukaryotes, prokaryotes, and archaea.  CSP's include the major cold-shock proteins CspA and CspB in bacteria and the eukaryotic gene regulatory factor Y-box...; Region: CSP_CDS; cd04458
529507008064	DNA-binding site [nucleotide binding]; DNA binding site
529507008065	RNA-binding motif; other site
529507008066	HMMPfam hit to PF00313, 'Cold-shock' DNA-binding domain, score 5.5e-44
529507008067	PS00352 'Cold-shock' DNA-binding domain signature.
529507008068	sigma70 family sigma factor YlaC; Region: YlaC; pfam10777
529507008069	2 probable transmembrane helices predicted for PMI1677 by TMHMM2.0 at aa 36-54 and 58-80
529507008070	Dihydroorotase (DHOase) catalyzes the reversible interconversion of carbamoyl aspartate to dihydroorotate, a key reaction in the pyrimidine biosynthesis. In contrast to the large polyfunctional CAD proteins of higher organisms, this group of DHOases is...; Region: DHOase; cd01294
529507008071	active site
529507008072	substrate binding pocket [chemical binding]; other site
529507008073	dimer interface [polypeptide binding]; other site
529507008074	HMMPfam hit to PF01979, Amidohydrolase family, score 2.1e-64
529507008075	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507008076	PS00483 Dihydroorotase signature 2.
529507008077	biofilm formation regulatory protein BssS; Reviewed; Region: bssS; PRK12301
529507008078	Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription]; Region: CitB; COG2197
529507008079	cheY-homologous receiver domain; Region: REC; smart00448
529507008080	C-terminal DNA-binding domain of LuxR-like proteins. This domain contains a helix-turn-helix motif and binds DNA. Proteins belonging to this group are response regulators; some act as transcriptional activators, others as transcriptional repressors. Many...; Region: LuxR_C_like; cd06170
529507008081	DNA binding residues [nucleotide binding]
529507008082	dimerization interface [polypeptide binding]; other site
529507008083	HMMPfam hit to PF00196, Bacterial regulatory proteins, luxR family, score 1.6e-08
529507008084	Predicted helix-turn-helix motif with score 1801.000, SD 5.32 at aa 152-173, sequence LPNYQIAKKLKISNSTVYSHKR
529507008085	tetrathionate reductase subunit A; Provisional; Region: PRK14991
529507008086	The MopB_Tetrathionate-Ra CD contains tetrathionate reductase, subunit A, (TtrA) and other related proteins. The Salmonella enterica tetrathionate reductase catalyses the reduction of trithionate but not sulfur or thiosulfate. Members of this CD belong...; Region: MopB_Tetrathionate-Ra; cd02758
529507008087	putative [Fe4-S4] binding site [ion binding]; other site
529507008088	putative molybdopterin cofactor binding site [chemical binding]; other site
529507008089	This CD contains the molybdopterin_binding C-terminal (MopB_CT) region of tetrathionate reductase, subunit A, (TtrA); respiratory arsenate As(V) reductase, catalytic subunit (ArrA); and other related proteins; Region: MopB_CT_Tetrathionate_Arsenate-R; cd02780
529507008090	putative molybdopterin cofactor binding site; other site
529507008091	Predicted helix-turn-helix motif with score 1094.000, SD 2.91 at aa 473-494, sequence MSLAEYSERCKVPESTIIALAR
529507008092	HMMPfam hit to PF04879, Molybdopterin oxidoreductase Fe4S4 dom, score 6.9e-05
529507008093	Signal peptide predicted for PMI1681 by SignalP 2.0 HMM (Signal peptide probability 0.989) with cleavage site probability 0.946 between residues 23 and 24
529507008094	tetrathionate reductase subunit C; Provisional; Region: PRK14992
529507008095	Polysulphide reductase, NrfD; Region: NrfD; pfam03916
529507008096	9 probable transmembrane helices predicted for PMI1682 by TMHMM2.0 at aa 20-42, 54-76, 96-118, 130-149, 164-186, 198-220, 235-257, 264-286 and 306-328
529507008097	HMMPfam hit to PF03916, Polysulphide reductase, NrfD, score 1.2e-21
529507008098	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507008099	tetrathionate reductase subunit B; Provisional; Region: PRK14993
529507008100	4Fe-4S binding domain; Region: Fer4; pfam00037
529507008101	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 7.5e-08
529507008102	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
529507008103	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 0.0096
529507008104	ABC transporter, phosphonate, periplasmic substrate-binding protein; Region: Phosphonate-bd; pfam12974
529507008105	TRAP transporter solute receptor, TAXI family; Region: TRAP_TAXI; TIGR02122
529507008106	Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via...; Region: HisKA; cd00082
529507008107	dimer interface [polypeptide binding]; other site
529507008108	phosphorylation site [posttranslational modification]
529507008109	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
529507008110	ATP binding site [chemical binding]; other site
529507008111	Mg2+ binding site [ion binding]; other site
529507008112	G-X-G motif; other site
529507008113	Signal peptide predicted for PMI1684 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.999 between residues 30 and 31
529507008114	2 probable transmembrane helices predicted for PMI1684 by TMHMM2.0 at aa 12-30 and 311-333
529507008115	HMMPfam hit to PF00512, His Kinase A (phosphoacceptor) domain, score 5.8e-06
529507008116	HMMPfam hit to PF02518, Histidine kinase-, DNA gyrase B-, and HSP90, score 1.3e-20
529507008117	Response regulator [Signal transduction mechanisms]; Region: TtrR; COG4566
529507008118	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
529507008119	active site
529507008120	phosphorylation site [posttranslational modification]
529507008121	intermolecular recognition site; other site
529507008122	dimerization interface [polypeptide binding]; other site
529507008123	C-terminal DNA-binding domain of LuxR-like proteins. This domain contains a helix-turn-helix motif and binds DNA. Proteins belonging to this group are response regulators; some act as transcriptional activators, others as transcriptional repressors. Many...; Region: LuxR_C_like; cd06170
529507008124	DNA binding residues [nucleotide binding]
529507008125	dimerization interface [polypeptide binding]; other site
529507008126	HMMPfam hit to PF00072, Response regulator receiver domain, score 1.3e-24
529507008127	HMMPfam hit to PF00196, Bacterial regulatory proteins, luxR fami, score 7e-17
529507008128	Bacterial lipid A biosynthesis acyltransferase; Region: Lip_A_acyltrans; pfam03279
529507008129	Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: LABLAT-like; Region: LPLAT_LABLAT-like; cd07984
529507008130	putative acyl-acceptor binding pocket; other site
529507008131	HMMPfam hit to PF03279, Bacterial lipid A biosynthesis acyltr, score 1.8e-130
529507008132	1 probable transmembrane helix predicted for PMI1686 by TMHMM2.0 at aa 20-42
529507008133	drug efflux system protein MdtG; Provisional; Region: PRK09874
529507008134	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507008135	putative substrate translocation pore; other site
529507008136	Signal peptide predicted for PMI1687 by SignalP 2.0 HMM (Signal peptide probability 0.856) with cleavage site probability 0.793 between residues 39 and 40
529507008137	HMMPfam hit to PF00083, Sugar (and other) transporter, score 0.00014
529507008138	10 probable transmembrane helices predicted for PMI1687 by TMHMM2.0 at aa 13-35, 50-72, 84-106, 140-162, 169-191, 222-244, 251-273, 288-310, 317-339 and 372-394
529507008139	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 4.6e-51
529507008140	POT family; Region: PTR2; cl17359
529507008141	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 7.9e-16
529507008142	14 probable transmembrane helices predicted for PMI1688 by TMHMM2.0 at aa 31-49, 59-81, 90-112, 117-139, 152-174, 179-201, 233-255, 259-281, 293-310, 336-358, 374-391, 406-428, 441-463 and 478-500
529507008143	PS01022 PTR2 family proton/oligopeptide symporters signature 1.
529507008144	HMMPfam hit to PF00854, POT family, score 1.5e-44
529507008145	PS01023 PTR2 family proton/oligopeptide symporters signature 2.
529507008146	2 probable transmembrane helices predicted for PMI1689 by TMHMM2.0 at aa 30-52 and 57-76
529507008147	Predicted epimerase, PhzC/PhzF homolog [General function prediction only]; Region: COG0384
529507008148	HMMPfam hit to PF02567, Phenazine biosynthesis-like protein, score 3.2e-50
529507008149	Brown fat-inducible thioesterase (BFIT).  Brain acyl-CoA hydrolase (BACH).  These enzymes deacylate long-chain fatty acids by hydrolyzing acyl-CoA thioesters to free fatty acids and CoA-SH. Eukaryotic members of this family are expressed in brain, testis; Region: BFIT_BACH; cd03442
529507008150	HMMPfam hit to PF03061, Thioesterase superfamily, score 8.6e-13
529507008151	Acetyltransferase (isoleucine patch superfamily) [General function prediction only]; Region: WbbJ; COG0110
529507008152	Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and...; Region: LbH_XAT; cd03349
529507008153	trimer interface [polypeptide binding]; other site
529507008154	active site
529507008155	substrate binding site [chemical binding]; other site
529507008156	CoA binding site [chemical binding]; other site
529507008157	PS00101 Hexapeptide-repeat containing-transferases signature.
529507008158	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 0.00018
529507008159	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 35
529507008160	NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion]; Region: NemA; COG1902
529507008161	Old yellow enzyme (OYE) YqjM-like FMN binding domain. YqjM is involved in the oxidative stress response of Bacillus subtilis.  Like the other OYE members, each monomer of YqjM contains FMN as a non-covalently bound cofactor and uses NADPH as a reducing...; Region: OYE_YqiM_FMN; cd02932
529507008162	active site
529507008163	FMN binding site [chemical binding]; other site
529507008164	substrate binding site [chemical binding]; other site
529507008165	homotetramer interface [polypeptide binding]; other site
529507008166	catalytic residue [active]
529507008167	HMMPfam hit to PF00724, NADH:flavin oxidoreductase / NADH oxidas, score 2e-80
529507008168	Protein of unknown function (DUF2798); Region: DUF2798; pfam11391
529507008169	3 probable transmembrane helices predicted for PMI1695 by TMHMM2.0 at aa 5-27, 42-64 and 77-99
529507008170	Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription]; Region: OmpR; COG0745
529507008171	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
529507008172	active site
529507008173	phosphorylation site [posttranslational modification]
529507008174	intermolecular recognition site; other site
529507008175	dimerization interface [polypeptide binding]; other site
529507008176	Effector domain of response regulator. Bacteria and certain eukaryotes like protozoa and higher plants use two-component signal transduction systems to detect and respond to changes in the environment. The system consists of a sensor histidine kinase and...; Region: trans_reg_C; cd00383
529507008177	DNA binding site [nucleotide binding]
529507008178	HMMPfam hit to PF00072, Response regulator receiver domain, score 4.3e-23
529507008179	HMMPfam hit to PF00486, Transcriptional regulatory protein, C te, score 2.2e-19
529507008180	Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via...; Region: HisKA; cd00082
529507008181	dimer interface [polypeptide binding]; other site
529507008182	phosphorylation site [posttranslational modification]
529507008183	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
529507008184	ATP binding site [chemical binding]; other site
529507008185	Mg2+ binding site [ion binding]; other site
529507008186	G-X-G motif; other site
529507008187	2 probable transmembrane helices predicted for PMI1697 by TMHMM2.0 at aa 7-29 and 168-190
529507008188	HMMPfam hit to PF00512, His Kinase A (phosphoacceptor) domain, score 6.2e-12
529507008189	HMMPfam hit to PF02518, Histidine kinase-, DNA gyrase B-, and HSP90, score 5.8e-29
529507008190	Branched-chain amino acid transport protein (AzlD); Region: AzlD; pfam05437
529507008191	4 probable transmembrane helices predicted for PMI1698 by TMHMM2.0 at aa 6-28, 41-60, 65-82 and 87-106
529507008192	Signal peptide predicted for PMI1698 by SignalP 2.0 HMM (Signal peptide probability 0.951) with cleavage site probability 0.527 between residues 20 and 21
529507008193	AzlC protein; Region: AzlC; cl00570
529507008194	5 probable transmembrane helices predicted for PMI1699 by TMHMM2.0 at aa 16-38, 58-80, 126-148, 158-177 and 186-208
529507008195	HMMPfam hit to PF03591, AzlC protein, score 5.4e-13
529507008196	Predicted transcriptional regulators [Transcription]; Region: HipB; COG1396
529507008197	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
529507008198	non-specific DNA binding site [nucleotide binding]; other site
529507008199	salt bridge; other site
529507008200	sequence-specific DNA binding site [nucleotide binding]; other site
529507008201	Cupin domain; Region: Cupin_2; cl17218
529507008202	HMMPfam hit to PF01381, Helix-turn-helix, score 7.6e-17
529507008203	Predicted helix-turn-helix motif with score 2052.000, SD 6.18 at aa 24-45, sequence LSLAEIARRAGIAKSTLSQLEA
529507008204	HMMPfam hit to PF07883, Cupin domain, score 0.001
529507008205	Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase [Amino acid transport and metabolism / Coenzyme metabolism]; Region: IlvE; COG0115
529507008206	D-Alanine aminotransferase (D-AAT_like): D-amino acid aminotransferase catalyzes transamination between D-amino acids and their respective alpha-keto acids. It plays a major role in the synthesis of bacterial cell wall components like D-alanine and...; Region: D-AAT_like; cd01558
529507008207	homodimer interface [polypeptide binding]; other site
529507008208	substrate-cofactor binding pocket; other site
529507008209	pyridoxal 5'-phosphate binding site [chemical binding]; other site
529507008210	catalytic residue [active]
529507008211	HMMPfam hit to PF01063, Aminotransferase class IV, score 4.4e-74
529507008212	PS00770 Aminotransferases class-IV signature.
529507008213	acid-resistance membrane protein; Provisional; Region: PRK10209
529507008214	Uncharacterized conserved protein [Function unknown]; Region: HdeD; COG3247
529507008215	Signal peptide predicted for PMI1702 by SignalP 2.0 HMM (Signal peptide probability 0.843) with cleavage site probability 0.300 between residues 61 and 62
529507008216	6 probable transmembrane helices predicted for PMI1702 by TMHMM2.0 at aa 21-43, 47-69, 76-98, 104-126, 133-155 and 165-187
529507008217	PS00211 ABC transporters family signature.
529507008218	Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane]; Region: MscS; COG0668
529507008219	Mechanosensitive ion channel; Region: MS_channel; pfam00924
529507008220	5 probable transmembrane helices predicted for PMI1704 by TMHMM2.0 at aa 21-40, 68-90, 103-125, 138-160 and 165-182
529507008221	HMMPfam hit to PF00924, Mechanosensitive ion channel, score 1.2e-41
529507008222	anaerobic dimethyl sulfoxide reductase, A subunit, DmsA/YnfE family; Region: dmsA_ynfE; TIGR02166
529507008223	This CD (MopB_DmsA-EC) includes the DmsA enzyme of the dmsABC operon encoding the anaerobic dimethylsulfoxide reductase (DMSOR) of Escherichia coli and other related DMSOR-like enzymes. Unlike other DMSOR-like enzymes, this group has a  predicted...; Region: MopB_DmsA-EC; cd02770
529507008224	putative [Fe4-S4] binding site [ion binding]; other site
529507008225	putative molybdopterin cofactor binding site [chemical binding]; other site
529507008226	The MopB_CT_DmsA-EC CD includes the DmsA enzyme of the dmsABC operon encoding the anaerobic dimethylsulfoxide reductase (DMSOR) of Escherichia coli and other related DMSOR-like enzymes. Unlike other DMSOR-like enzymes, this group has a  predicted...; Region: MopB_CT_DmsA-EC; cd02794
529507008227	putative molybdopterin cofactor binding site; other site
529507008228	Signal peptide predicted for PMI1705 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.988 between residues 45 and 46
529507008229	HMMPfam hit to PF04879, Molybdopterin oxidoreductase Fe4S4 do, score 8.8e-06
529507008230	PS00551 Prokaryotic molybdopterin oxidoreductases signature 1.
529507008231	HMMPfam hit to PF00384, Molybdopterin oxidoreductase, score 5.5e-108
529507008232	HMMPfam hit to PF01568, Molydopterin dinucleotide binding dom, score 1.5e-29
529507008233	DMSO reductase, iron-sulfur subunit; Region: DMSO_dmsB; TIGR02951
529507008234	RPB11 and RPB3 subunits of RNA polymerase; Region: RNAP_RPB11_RPB3; cl11409
529507008235	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507008236	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 1.7e-06
529507008237	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
529507008238	DMSO reductase anchor subunit (DmsC); Region: DmsC; cl17519
529507008239	8 probable transmembrane helices predicted for PMI1707 by TMHMM2.0 at aa 4-26, 39-61, 81-100, 109-131, 141-160, 167-186, 201-223 and 230-251
529507008240	Bacterial protein of unknown function (DUF924); Region: DUF924; pfam06041
529507008241	HMMPfam hit to PF06041, Bacterial protein of unknown function (DUF92, score 2.2e-76
529507008242	Protein of unknown function (DUF2566); Region: DUF2566; pfam10753
529507008243	2 probable transmembrane helices predicted for PMI1709 by TMHMM2.0 at aa 4-26 and 35-57
529507008244	prophage
529507008245	Protein of unknown function (DUF2612); Region: DUF2612; pfam11041
529507008246	Baseplate J-like protein; Region: Baseplate_J; cl01294
529507008247	PS00189 2-oxo acid dehydrogenases acyltransferase component lipoyl binding site.
529507008248	Phage Connector (GP10); Region: Phage_connector; cl11526
529507008249	Phage-related baseplate assembly protein; Region: Phage_base_V; cl17812
529507008250	Signal peptide predicted for PMI1714 by SignalP 2.0 HMM (Signal peptide probability 0.700) with cleavage site probability 0.300 between residues 23 and 24
529507008251	PS00559 Eukaryotic molybdopterin oxidoreductases signature.
529507008252	PS00678 Trp-Asp (WD) repeats signature.
529507008253	2 probable transmembrane helices predicted for PMI1718 by TMHMM2.0 at aa 460-479 and 486-508
529507008254	Protein of unknown function (DUF3383); Region: DUF3383; pfam11863
529507008255	Bacteriophage lysis protein; Region: Phage_lysis; pfam03245
529507008256	HMMPfam hit to PF03245, Bacteriophage lysis protein, score 9e-11
529507008257	1 probable transmembrane helix predicted for PMI1723 by TMHMM2.0 at aa 4-23
529507008258	virion protein; Provisional; Region: V; PHA02564
529507008259	Phage holin family (Lysis protein S); Region: Phage_holin_3; pfam05106
529507008260	HMMPfam hit to PF05106, Phage holin family (Lysis protein S), score 1.2e-29
529507008261	2 probable transmembrane helices predicted for PMI1725 by TMHMM2.0 at aa 21-43 and 63-85
529507008262	Antitermination protein; Region: Antiterm; pfam03589
529507008263	Zinc finger domain of DnaJ and HSP40; Region: DnaJ_zf; cd10719
529507008264	HMMPfam hit to PF03589, Antitermination protein, score 2.4e-07
529507008265	Predicted transcriptional regulator [Transcription]; Region: COG2932
529507008266	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
529507008267	non-specific DNA binding site [nucleotide binding]; other site
529507008268	salt bridge; other site
529507008269	sequence-specific DNA binding site [nucleotide binding]; other site
529507008270	Peptidase S24 LexA-like proteins are involved in the SOS response leading to the repair of single-stranded DNA within the bacterial cell. This family includes: the lambda repressor CI/C2 family and related bacterial prophage repressor proteins; LexA (EC...; Region: S24_LexA-like; cd06529
529507008271	Catalytic site [active]
529507008272	HMMPfam hit to PF00717, Peptidase S24-like, score 1.3e-07
529507008273	tryptophanyl-tRNA synthetase II; Reviewed; Region: PRK12282
529507008274	catalytic core domain of tryptophanyl-tRNA synthetase; Region: TrpRS_core; cd00806
529507008275	active site
529507008276	HIGH motif; other site
529507008277	dimer interface [polypeptide binding]; other site
529507008278	KMSKS motif; other site
529507008279	HMMPfam hit to PF00579, tRNA synthetases class I (W and Y), score 3.1e-73
529507008280	phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional; Region: PRK10618
529507008281	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
529507008282	ATP binding site [chemical binding]; other site
529507008283	Mg2+ binding site [ion binding]; other site
529507008284	G-X-G motif; other site
529507008285	Histidine Phosphotransfer domain, involved in signalling through a two part component systems in which an autophosphorylating histidine protein kinase serves as a phosphoryl donor to a response regulator protein; the response regulator protein is...; Region: HPT; cd00088
529507008286	putative binding surface; other site
529507008287	active site
529507008288	Signal peptide predicted for PMI1729 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.872 between residues 31 and 32
529507008289	2 probable transmembrane helices predicted for PMI1729 by TMHMM2.0 at aa 15-34 and 298-320
529507008290	HMMPfam hit to PF02518, Histidine kinase-, DNA gyrase B-, and HSP90, score 5.2e-14
529507008291	HMMPfam hit to PF01627, Hpt domain, score 1.9e-13
529507008292	transcriptional regulator RcsB; Provisional; Region: PRK10840
529507008293	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
529507008294	active site
529507008295	phosphorylation site [posttranslational modification]
529507008296	intermolecular recognition site; other site
529507008297	C-terminal DNA-binding domain of LuxR-like proteins. This domain contains a helix-turn-helix motif and binds DNA. Proteins belonging to this group are response regulators; some act as transcriptional activators, others as transcriptional repressors. Many...; Region: LuxR_C_like; cd06170
529507008298	DNA binding residues [nucleotide binding]
529507008299	dimerization interface [polypeptide binding]; other site
529507008300	HMMPfam hit to PF00072, Response regulator receiver domain, score 9.9e-31
529507008301	HMMPfam hit to PF00196, Bacterial regulatory proteins, luxR fami, score 4.2e-21
529507008302	PS00622 Bacterial regulatory proteins, luxR family signature.
529507008303	Predicted helix-turn-helix motif with score 1130.000, SD 3.04 at aa 166-187, sequence FLVTEIAKKLNRSIKTISSQKK
529507008304	hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional; Region: PRK10841
529507008305	Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via...; Region: HisKA; cd00082
529507008306	dimer interface [polypeptide binding]; other site
529507008307	phosphorylation site [posttranslational modification]
529507008308	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
529507008309	ATP binding site [chemical binding]; other site
529507008310	Mg2+ binding site [ion binding]; other site
529507008311	G-X-G motif; other site
529507008312	RcsC Alpha-Beta-Loop (ABL); Region: RcsC; pfam09456
529507008313	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
529507008314	active site
529507008315	phosphorylation site [posttranslational modification]
529507008316	intermolecular recognition site; other site
529507008317	dimerization interface [polypeptide binding]; other site
529507008318	HMMPfam hit to PF00072, Response regulator receiver domain, score 1.5e-36
529507008319	HMMPfam hit to PF02518, Histidine kinase-, DNA gyrase B-, and HS, score 1.6e-41
529507008320	HMMPfam hit to PF00512, His Kinase A (phosphoacceptor) domain, score 8.5e-24
529507008321	2 probable transmembrane helices predicted for PMI1731 by TMHMM2.0 at aa 20-42 and 314-336
529507008322	Signal peptide predicted for PMI1731 by SignalP 2.0 HMM (Signal peptide probability 0.920) with cleavage site probability 0.357 between residues 29 and 30
529507008323	DNA gyrase subunit A; Validated; Region: PRK05560
529507008324	DNA Topoisomerase, subtype IIA; domain A'; bacterial DNA topoisomerase IV (C subunit, ParC), bacterial DNA gyrases (A subunit, GyrA),mammalian DNA toposiomerases II. DNA topoisomerases are essential enzymes that regulate the conformational changes...; Region: TOP4c; cd00187
529507008325	CAP-like domain; other site
529507008326	active site
529507008327	primary dimer interface [polypeptide binding]; other site
529507008328	DNA gyrase C-terminal domain, beta-propeller; Region: DNA_gyraseA_C; pfam03989
529507008329	DNA gyrase C-terminal domain, beta-propeller; Region: DNA_gyraseA_C; pfam03989
529507008330	DNA gyrase C-terminal domain, beta-propeller; Region: DNA_gyraseA_C; pfam03989
529507008331	DNA gyrase C-terminal domain, beta-propeller; Region: DNA_gyraseA_C; pfam03989
529507008332	DNA gyrase C-terminal domain, beta-propeller; Region: DNA_gyraseA_C; pfam03989
529507008333	DNA gyrase C-terminal domain, beta-propeller; Region: DNA_gyraseA_C; pfam03989
529507008334	HMMPfam hit to PF03989, DNA gyrase C-terminal domain, beta-prop, score 2.4e-15
529507008335	HMMPfam hit to PF03989, DNA gyrase C-terminal domain, beta-prop, score 1.2e-15
529507008336	HMMPfam hit to PF03989, DNA gyrase C-terminal domain, beta-prop, score 1.8e-13
529507008337	HMMPfam hit to PF03989, DNA gyrase C-terminal domain, beta-prop, score 8e-12
529507008338	HMMPfam hit to PF03989, DNA gyrase C-terminal domain, beta-prop, score 6.1e-16
529507008339	HMMPfam hit to PF03989, DNA gyrase C-terminal domain, beta-prop, score 2.1e-12
529507008340	HMMPfam hit to PF00521, DNA gyrase/topoisomerase IV, subunit A, score 0
529507008341	bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional; Region: PRK05134
529507008342	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
529507008343	S-adenosylmethionine binding site [chemical binding]; other site
529507008344	ribonucleotide-diphosphate reductase subunit alpha; Validated; Region: PRK09103
529507008345	ATP cone domain; Region: ATP-cone; pfam03477
529507008346	Class I ribonucleotide reductase; Region: RNR_I; cd01679
529507008347	active site
529507008348	dimer interface [polypeptide binding]; other site
529507008349	catalytic residues [active]
529507008350	effector binding site; other site
529507008351	R2 peptide binding site; other site
529507008352	HMMPfam hit to PF03477, ATP cone domain, score 2.8e-21
529507008353	HMMPfam hit to PF00317, Ribonucleotide reductase, all-alpha d, score 4.3e-23
529507008354	HMMPfam hit to PF02867, Ribonucleotide reductase, barrel doma, score 2e-257
529507008355	PS00089 Ribonucleotide reductase large subunit signature.
529507008356	Ribonucleotide Reductase, R2/beta subunit, ferritin-like diiron-binding domain; Region: RNRR2; cd01049
529507008357	dimer interface [polypeptide binding]; other site
529507008358	putative radical transfer pathway; other site
529507008359	diiron center [ion binding]; other site
529507008360	tyrosyl radical; other site
529507008361	HMMPfam hit to PF00268, Ribonucleotide reductase, small chain, score 7.6e-156
529507008362	PS00368 Ribonucleotide reductase small subunit signature.
529507008363	Ferredoxin [Energy production and conversion]; Region: Fdx; COG0633
529507008364	2Fe-2S iron-sulfur cluster binding domain. Iron-sulfur proteins play an important role in electron transfer processes and in various enzymatic reactions. The family includes plant and algal ferredoxins, which act as electron carriers in photosynthesis...; Region: fer2; cd00207
529507008365	catalytic loop [active]
529507008366	iron binding site [ion binding]; other site
529507008367	HMMPfam hit to PF00111, 2Fe-2S iron-sulfur cluster binding domain, score 1.5e-09
529507008368	PS00197 2Fe-2S ferredoxins, iron-sulfur binding region signature.
529507008369	Bacterial protein of unknown function (DUF903); Region: DUF903; pfam06004
529507008370	Signal peptide predicted for PMI1737 by SignalP 2.0 HMM (Signal peptide probability 0.996) with cleavage site probability 0.484 between residues 27 and 28
529507008371	HMMPfam hit to PF06004, Bacterial protein of unknown function (DUF90, score 1.5e-23
529507008372	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507008373	tyrosine transporter TyrP; Provisional; Region: PRK15132
529507008374	aromatic amino acid transport protein; Region: araaP; TIGR00837
529507008375	Signal peptide predicted for PMI1738 by SignalP 2.0 HMM (Signal peptide probability 0.995) with cleavage site probability 0.453 between residues 28 and 29
529507008376	HMMPfam hit to PF03222, Tryptophan/tyrosine permease family, score 1.3e-161
529507008377	11 probable transmembrane helices predicted for PMI1738 by TMHMM2.0 at aa 7-29, 33-55, 76-98, 118-137, 144-166, 181-203, 216-238, 273-295, 308-330, 334-356 and 377-399
529507008378	YfaZ precursor; Region: YfaZ; pfam07437
529507008379	outer membrane protein; Region: OMP_w_GlyGly; TIGR04219
529507008380	HMMPfam hit to PF07437, YfaZ precursor, score 6.4e-63
529507008381	Signal peptide predicted for PMI1739 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.903 between residues 21 and 22
529507008382	Catalase [Inorganic ion transport and metabolism]; Region: KatE; COG0753
529507008383	Clade 3 of the heme-binding enzyme catalase; Region: catalase_clade_3; cd08156
529507008384	tetramer interface [polypeptide binding]; other site
529507008385	heme binding pocket [chemical binding]; other site
529507008386	NADPH binding site [chemical binding]; other site
529507008387	HMMPfam hit to PF00199, Catalase, score 2.9e-296
529507008388	PS00438 Catalase proximal active site signature.
529507008389	PS00437 Catalase proximal heme-ligand signature.
529507008390	O-succinylbenzoic acid--CoA ligase; Provisional; Region: PRK09029
529507008391	O-succinylbenzoate-CoA ligase (also known as O-succinylbenzoate-CoA synthase, OSB-CoA synthetase, or MenE); Region: OSB_CoA_lg; cd05912
529507008392	acyl-activating enzyme (AAE) consensus motif; other site
529507008393	putative AMP binding site [chemical binding]; other site
529507008394	putative active site [active]
529507008395	putative CoA binding site [chemical binding]; other site
529507008396	HMMPfam hit to PF00501, AMP-binding enzyme, score 1.7e-59
529507008397	PS00455 AMP-binding domain signature.
529507008398	O-succinylbenzoate synthase; Provisional; Region: PRK05105
529507008399	o-Succinylbenzoate synthase (OSBS) catalyzes the conversion of 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate (SHCHC) to 4-(2'-carboxyphenyl)-4-oxobutyrate (o-succinylbenzoate or OSB), a reaction in the menaquinone biosynthetic pathway; Region: OSBS; cd03320
529507008400	active site
529507008401	Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily. This superfamily contains a diverse set of enzymes including enoyl-CoA hydratase, napthoate synthase, methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA dehydratase, and dienoyl-CoA isomerase; Region: crotonase-like; cd06558
529507008402	Enoyl-CoA hydratase/isomerase family; Region: ECH; pfam00378
529507008403	substrate binding site [chemical binding]; other site
529507008404	oxyanion hole (OAH) forming residues; other site
529507008405	trimer interface [polypeptide binding]; other site
529507008406	HMMPfam hit to PF00378, Enoyl-CoA hydratase/isomerase family, score 7.7e-74
529507008407	PS00166 Enoyl-CoA hydratase/isomerase signature.
529507008408	PS00018 EF-hand calcium-binding domain.
529507008409	2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylate synthase; Provisional; Region: PRK11126
529507008410	HMMPfam hit to PF00561, alpha/beta hydrolase fold, score 0.0015
529507008411	2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1- carboxylate synthase; Validated; Region: PRK07449
529507008412	Pyrimidine (PYR) binding domain of 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexadiene-1- carboxylate synthase (MenD) and related proteins; Region: TPP_PYR_MenD; cd07037
529507008413	dimer interface [polypeptide binding]; other site
529507008414	tetramer interface [polypeptide binding]; other site
529507008415	PYR/PP interface [polypeptide binding]; other site
529507008416	TPP binding site [chemical binding]; other site
529507008417	Thiamine pyrophosphate (TPP) family, SHCHC synthase subfamily, TPP-binding module; composed of proteins similar to Escherichia coli 2-succinyl-6-hydroxyl-2,4-cyclohexadiene-1-carboxylic acid (SHCHC) synthase (also called MenD). SHCHC synthase plays a key...; Region: TPP_SHCHC_synthase; cd02009
529507008418	TPP-binding site; other site
529507008419	menaquinone-specific isochorismate synthase; Provisional; Region: PRK15012
529507008420	chorismate binding enzyme; Region: Chorismate_bind; cl10555
529507008421	HMMPfam hit to PF00425, chorismate binding enzyme, score 3.7e-72
529507008422	1 probable transmembrane helix predicted for PMI1747 by TMHMM2.0 at aa 257-279
529507008423	transposase (fragment)
529507008424	NADH:ubiquinone oxidoreductase subunit N; Provisional; Region: PRK05777
529507008425	NADH-Ubiquinone/plastoquinone (complex I), various chains; Region: Oxidored_q1; pfam00361
529507008426	14 probable transmembrane helices predicted for PMI1750 by TMHMM2.0 at aa 10-29, 36-58, 73-95, 104-121, 125-147, 159-181, 201-223, 236-258, 268-290, 297-319, 329-351, 372-394, 409-431 and 452-471
529507008427	HMMPfam hit to PF00361, NADH-Ubiquinone/plastoquinone (complex I), score 1.8e-74
529507008428	NADH:ubiquinone oxidoreductase subunit M; Reviewed; Region: PRK05846
529507008429	NADH-Ubiquinone/plastoquinone (complex I), various chains; Region: Oxidored_q1; pfam00361
529507008430	12 probable transmembrane helices predicted for PMI1751 by TMHMM2.0 at aa 4-18, 30-49, 85-107, 120-142, 174-196, 216-235, 286-308, 317-339, 343-365, 385-407, 422-439 and 459-481
529507008431	HMMPfam hit to PF00361, NADH-Ubiquinone/plastoquinone (complex I), score 3.2e-74
529507008432	NADH:ubiquinone oxidoreductase subunit L; Reviewed; Region: PRK06590
529507008433	NADH-Ubiquinone oxidoreductase (complex I), chain 5 N-terminus; Region: Oxidored_q1_N; pfam00662
529507008434	NADH-Ubiquinone/plastoquinone (complex I), various chains; Region: Oxidored_q1; pfam00361
529507008435	17 probable transmembrane helices predicted for PMI1752 by TMHMM2.0 at aa 4-21, 28-50, 77-99, 112-131, 136-158, 171-193, 208-227, 248-267, 282-300, 307-328, 332-354, 375-397, 412-434, 455-475, 490-512, 532-549 and 588-610
529507008436	HMMPfam hit to PF00361, NADH-Ubiquinone/plastoquinone (complex, score 3e-112
529507008437	HMMPfam hit to PF00662, NADH-Ubiquinone oxidoreductase (complex, score 1.2e-25
529507008438	Signal peptide predicted for PMI1752 by SignalP 2.0 HMM (Signal peptide probability 0.997) with cleavage site probability 0.958 between residues 26 and 27
529507008439	NADH:ubiquinone oxidoreductase subunit K; Validated; Region: PRK05715
529507008440	HMMPfam hit to PF00420, NADH-ubiquinone/plastoquinone oxidoreduct, score 1.9e-30
529507008441	3 probable transmembrane helices predicted for PMI1753 by TMHMM2.0 at aa 4-23, 28-50 and 60-82
529507008442	Signal peptide predicted for PMI1753 by SignalP 2.0 HMM (Signal peptide probability 0.650) with cleavage site probability 0.275 between residues 25 and 26
529507008443	NADH:ubiquinone oxidoreductase subunit J; Provisional; Region: PRK06638
529507008444	NADH dehydrogenase subunit J; Provisional; Region: PRK06433
529507008445	HMMPfam hit to PF00499, NADH-ubiquinone/plastoquinone oxidoreduct, score 7.8e-11
529507008446	5 probable transmembrane helices predicted for PMI1754 by TMHMM2.0 at aa 4-21, 28-50, 55-77, 90-112 and 132-154
529507008447	NADH dehydrogenase subunit I; Provisional; Region: PRK05888
529507008448	4Fe-4S binding domain; Region: Fer4; pfam00037
529507008449	4Fe-4S binding domain; Region: Fer4; pfam00037
529507008450	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 9.4e-08
529507008451	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
529507008452	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 8.6e-05
529507008453	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
529507008454	NADH:ubiquinone oxidoreductase subunit H; Provisional; Region: PRK06076
529507008455	8 probable transmembrane helices predicted for PMI1756 by TMHMM2.0 at aa 10-32, 81-103, 113-135, 155-174, 184-206, 236-258, 268-290 and 299-321
529507008456	HMMPfam hit to PF00146, NADH dehydrogenase, score 3.5e-169
529507008457	PS00668 Respiratory-chain NADH dehydrogenase subunit 1 signature 2.
529507008458	PS00667 Respiratory-chain NADH dehydrogenase subunit 1 signature 1.
529507008459	NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion]; Region: NuoG; COG1034
529507008460	2Fe-2S iron-sulfur cluster binding domain. Iron-sulfur proteins play an important role in electron transfer processes and in various enzymatic reactions. The family includes plant and algal ferredoxins, which act as electron carriers in photosynthesis...; Region: fer2; cd00207
529507008461	catalytic loop [active]
529507008462	iron binding site [ion binding]; other site
529507008463	NADH-ubiquinone oxidoreductase-G iron-sulfur binding region; Region: NADH-G_4Fe-4S_3; pfam10588
529507008464	MopB_NDH-1_NuoG2-N7: The second domain of the NuoG subunit (with a [4Fe-4S] cluster, N7) of the NADH-quinone oxidoreductase/NADH dehydrogenase-1 (NDH-1) found in various bacteria. The NDH-1 is the first energy-transducting complex in the respiratory...; Region: MopB_NDH-1_NuoG2-N7; cd02771
529507008465	[4Fe-4S] binding site [ion binding]; other site
529507008466	MopB_CT_NDH-1_NuoG2-N7: C-terminal region of the NuoG-like subunit (of the variant with a [4Fe-4S] cluster, N7) of the NADH-quinone oxidoreductase/NADH dehydrogenase-1 (NDH-1) found in various bacteria. The NDH-1 is the first energy-transducting complex...; Region: MopB_CT_NDH-1_NuoG2-N7; cd02788
529507008467	HMMPfam hit to PF00384, Molybdopterin oxidoreductase, score 1.3e-06
529507008468	HMMPfam hit to PF04879, Molybdopterin oxidoreductase Fe4S4 dom, score 1.3e-16
529507008469	PS00643 Respiratory-chain NADH dehydrogenase 75 Kd subunit signature 3.
529507008470	PS00642 Respiratory-chain NADH dehydrogenase 75 Kd subunit signature 2.
529507008471	HMMPfam hit to PF00111, 2Fe-2S iron-sulfur cluster binding dom, score 3e-13
529507008472	PS00641 Respiratory-chain NADH dehydrogenase 75 Kd subunit signature 1.
529507008473	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507008474	NADH dehydrogenase I subunit F; Provisional; Region: PRK11278
529507008475	SLBB domain; Region: SLBB; pfam10531
529507008476	NADH-ubiquinone oxidoreductase-F iron-sulfur binding region; Region: NADH_4Fe-4S; pfam10589
529507008477	PS00645 Respiratory-chain NADH dehydrogenase 51 Kd subunit signature 2.
529507008478	HMMPfam hit to PF01512, Respiratory-chain NADH dehydrogenase, score 9.7e-168
529507008479	PS00644 Respiratory-chain NADH dehydrogenase 51 Kd subunit signature 1.
529507008480	NADH dehydrogenase subunit E; Validated; Region: PRK07539
529507008481	TRX-like [2Fe-2S] Ferredoxin (Fd) family, NADH:ubiquinone oxidoreductase (Nuo) subunit E subfamily; Nuo, also called respiratory chain Complex 1, is the entry point for electrons into the respiratory chains of bacteria and the mitochondria of eukaryotes; Region: TRX_Fd_NuoE; cd03064
529507008482	putative dimer interface [polypeptide binding]; other site
529507008483	[2Fe-2S] cluster binding site [ion binding]; other site
529507008484	HMMPfam hit to PF01257, Respiratory-chain NADH dehydrogenase, score 3e-85
529507008485	PS01099 Respiratory-chain NADH dehydrogenase 24 Kd subunit signature.
529507008486	bifunctional NADH:ubiquinone oxidoreductase subunit C/D; Provisional; Region: PRK11742
529507008487	NADH (or F420H2) dehydrogenase, subunit C; Region: NuoC_fam; TIGR01961
529507008488	NADH dehydrogenase subunit D; Validated; Region: PRK06075
529507008489	HMMPfam hit to PF00346, Respiratory-chain NADH dehydrogenase,, score 6.7e-176
529507008490	PS00535 Respiratory chain NADH dehydrogenase 49 Kd subunit signature.
529507008491	HMMPfam hit to PF00329, Respiratory-chain NADH dehydrogenase,, score 5.7e-40
529507008492	PS00542 Respiratory chain NADH dehydrogenase 30 Kd subunit signature.
529507008493	NADH:ubiquinone oxidoreductase 20 kD subunit and related Fe-S oxidoreductases [Energy production and conversion]; Region: NuoB; COG0377
529507008494	HMMPfam hit to PF01058, NADH ubiquinone oxidoreductase, 20 Kd sub, score 8.1e-56
529507008495	PS01150 Respiratory-chain NADH dehydrogenase 20 Kd subunit signature.
529507008496	NADH:ubiquinone oxidoreductase subunit A; Validated; Region: PRK06602
529507008497	HMMPfam hit to PF00507, NADH-ubiquinone/plastoquinone oxidoreduct, score 5e-40
529507008498	3 probable transmembrane helices predicted for PMI1762 by TMHMM2.0 at aa 10-32, 68-90 and 100-122
529507008499	PS00012 Phosphopantetheine attachment site.
529507008500	Signal peptide predicted for PMI1762 by SignalP 2.0 HMM (Signal peptide probability 0.621) with cleavage site probability 0.484 between residues 33 and 34
529507008501	DNA-binding transcriptional repressor LrhA; Provisional; Region: PRK15092
529507008502	Bacterial regulatory helix-turn-helix protein, lysR family; Region: HTH_1; pfam00126
529507008503	The C-terminal substrate domain of LysR-like regulator LrhA (LysR homologue A) and that of closely related homologs, contains the type 2 periplasmic binding fold; Region: PBP2_LrhA_like; cd08439
529507008504	putative dimerization interface [polypeptide binding]; other site
529507008505	HMMPfam hit to PF03466, LysR substrate binding domain, score 3.2e-24
529507008506	PS00639 Eukaryotic thiol (cysteine) proteases histidine active site.
529507008507	HMMPfam hit to PF00126, Bacterial regulatory helix-turn-helix, score 4.9e-16
529507008508	PS00044 Bacterial regulatory proteins, lysR family signature.
529507008509	Predicted helix-turn-helix motif with score 1312.000, SD 3.66 at aa 26-47, sequence NTFAAAAAAVCRTQSAVSQQMQ
529507008510	aminotransferase AlaT; Validated; Region: PRK09265
529507008511	Aspartate aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). Pyridoxal phosphate combines with an alpha-amino acid to form a compound called a Schiff base or aldimine...; Region: AAT_like; cd00609
529507008512	pyridoxal 5'-phosphate binding site [chemical binding]; other site
529507008513	homodimer interface [polypeptide binding]; other site
529507008514	catalytic residue [active]
529507008515	HMMPfam hit to PF00155, Aminotransferase class I and II, score 1.1e-33
529507008516	5'-nucleotidase; Provisional; Region: PRK03826
529507008517	HMMPfam hit to PF01966, HD domain, score 3.3e-10
529507008518	Permease SLC13 (solute carrier 13).  The sodium/dicarboxylate cotransporter NaDC-1 has been shown to translocate Krebs cycle intermediates such as succinate, citrate, and alpha-ketoglutarate across plasma membranes rabbit, human, and rat kidney. It is...; Region: SLC13_permease; cd01115
529507008519	transmembrane helices; other site
529507008520	Di- and tricarboxylate transporters [Inorganic ion transport and metabolism]; Region: CitT; COG0471
529507008521	TrkA-C domain; Region: TrkA_C; pfam02080
529507008522	TrkA-C domain; Region: TrkA_C; pfam02080
529507008523	Permease SLC13 (solute carrier 13).  The sodium/dicarboxylate cotransporter NaDC-1 has been shown to translocate Krebs cycle intermediates such as succinate, citrate, and alpha-ketoglutarate across plasma membranes rabbit, human, and rat kidney. It is...; Region: SLC13_permease; cd01115
529507008524	11 probable transmembrane helices predicted for PMI1767 by TMHMM2.0 at aa 5-27, 34-53, 63-82, 103-125, 145-167, 179-201, 434-456, 469-488, 508-530, 549-571 and 591-613
529507008525	HMMPfam hit to PF02080, TrkA-C domain, score 3.6e-11
529507008526	HMMPfam hit to PF02080, TrkA-C domain, score 4.7e-13
529507008527	putative phosphatase; Provisional; Region: PRK11587
529507008528	Haloacid dehalogenase-like hydrolases. The haloacid dehalogenase-like (HAD) superfamily includes L-2-haloacid dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, and many others; Region: HAD_like; cd01427
529507008529	motif II; other site
529507008530	HMMPfam hit to PF00702, haloacid dehalogenase-like hydrolase, score 1e-29
529507008531	hypothetical protein; Validated; Region: PRK05445
529507008532	HMMPfam hit to PF03887, YfbU domain, score 1.4e-94
529507008533	hypothetical protein; Provisional; Region: PRK01816
529507008534	HMMPfam hit to PF04217, Protein of unknown function, DUF412, score 2e-80
529507008535	2 probable transmembrane helices predicted for PMI1770 by TMHMM2.0 at aa 46-65 and 69-91
529507008536	propionate/acetate kinase; Provisional; Region: PRK12379
529507008537	acetate kinase A/propionate kinase 2; Reviewed; Region: PRK00180
529507008538	Signal peptide predicted for PMI1771 by SignalP 2.0 HMM (Signal peptide probability 0.658) with cleavage site probability 0.605 between residues 19 and 20
529507008539	HMMPfam hit to PF00871, Acetokinase family, score 3.6e-245
529507008540	PS01075 Acetate and butyrate kinases family signature 1.
529507008541	PS01076 Acetate and butyrate kinases family signature 2.
529507008542	phosphate acetyltransferase; Reviewed; Region: PRK05632
529507008543	The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain. Functionally, proteins in this superfamily use the energy from hydrolysis of NTP to transfer electron or ion; Region: Fer4_NifH; cl17203
529507008544	DRTGG domain; Region: DRTGG; pfam07085
529507008545	phosphate acetyltransferase; Region: pta; TIGR00651
529507008546	HMMPfam hit to PF07085, DRTGG domain, score 2.4e-56
529507008547	HMMPfam hit to PF01515, Phosphate acetyl/butaryl transferase, score 4.4e-188
529507008548	Protein of unknown function (DUF2721); Region: DUF2721; pfam11026
529507008549	membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family; Region: PQQ_membr_DH; TIGR03074
529507008550	Membrane-bound PQQ-dependent glucose dehydrogenase; Region: PQQ_mGDH; cd10280
529507008551	Trp docking motif [polypeptide binding]; other site
529507008552	putative active site [active]
529507008553	Signal peptide predicted for PMI1773 by SignalP 2.0 HMM (Signal peptide probability 0.952) with cleavage site probability 0.659 between residues 33 and 34
529507008554	5 probable transmembrane helices predicted for PMI1773 by TMHMM2.0 at aa 7-29, 34-53, 60-76, 91-109 and 116-135
529507008555	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507008556	PS00364 Bacterial quinoprotein dehydrogenases signature 2.
529507008557	HMMPfam hit to PF01011, PQQ enzyme repeat, score 3.7e-09
529507008558	alanine racemase; Reviewed; Region: PRK13340
529507008559	Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme, Alanine Racemase 2; Region: PLPDE_III_AR2; cd06826
529507008560	active site
529507008561	pyridoxal 5'-phosphate (PLP) binding site [chemical binding]; other site
529507008562	dimer interface [polypeptide binding]; other site
529507008563	substrate binding site [chemical binding]; other site
529507008564	catalytic residues [active]
529507008565	HMMPfam hit to PF00842, Alanine racemase, C-terminal domain, score 1.1e-35
529507008566	HMMPfam hit to PF01168, Alanine racemase, N-terminal domain, score 5.8e-37
529507008567	Signal peptide predicted for PMI1774 by SignalP 2.0 HMM (Signal peptide probability 0.738) with cleavage site probability 0.502 between residues 35 and 36
529507008568	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507008569	PTS system ascorbate-specific transporter subunit IIC; Reviewed; Region: ulaA; PRK09410
529507008570	12 probable transmembrane helices predicted for PMI1775 by TMHMM2.0 at aa 7-29, 44-63, 98-117, 121-143, 148-170, 180-202, 223-245, 255-274, 314-336, 340-362, 369-391 and 395-417
529507008571	HMMPfam hit to PF04215, sugar-specific permease, SgaT/UlaA, score 9.6e-121
529507008572	PTS_IIB_ascorbate: subunit IIB of enzyme II (EII) of the L-ascorbate-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS). In this system, EII is an L-ascorbate-specific permease with two cytoplasmic subunits (IIA and IIB) and a...; Region: PTS_IIB_ascorbate; cd05563
529507008573	active site
529507008574	P-loop; other site
529507008575	phosphorylation site [posttranslational modification]
529507008576	HMMPfam hit to PF02302, PTS system, Lactose/Cellobiose specific IIB, score 2.6e-28
529507008577	PTS_IIA, PTS system, fructose/mannitol specific IIA subunit. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. This...; Region: PTS_IIA_fru; cd00211
529507008578	active site
529507008579	phosphorylation site [posttranslational modification]
529507008580	HMMPfam hit to PF00359, Phosphoenolpyruvate-dependent sugar phosph, score 9.2e-50
529507008581	PS00372 PTS EIIA domains phosphorylation site signature 2.
529507008582	Transcriptional regulators [Transcription]; Region: PurR; COG1609
529507008583	Helix-turn-helix (HTH) DNA binding domain of the LacI family of transcriptional regulators; Region: HTH_LacI; cd01392
529507008584	DNA binding site [nucleotide binding]
529507008585	domain linker motif; other site
529507008586	Type 1 periplasmic binding fold superfamily; Region: Periplasmic_Binding_Protein_Type_1; cl10011
529507008587	HMMPfam hit to PF00356, Bacterial regulatory proteins, lacI fami, score 5.6e-07
529507008588	Predicted helix-turn-helix motif with score 1930.000, SD 5.76 at aa 13-34, sequence VTLQEVAKHAGVGSMTVSRALR
529507008589	PS00356 Bacterial regulatory proteins, lacI family signature.
529507008590	HMMPfam hit to PF00532, Periplasmic binding proteins and sugar b, score 0.00013
529507008591	NUDIX hydrolase YfcD; Provisional; Region: PRK15393
529507008592	Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+...; Region: Nudix_Hydrolase; cl00447
529507008593	nudix motif; other site
529507008594	HMMPfam hit to PF00293, NUDIX domain, score 4.8e-23
529507008595	GSH-dependent disulfide bond oxidoreductase; Provisional; Region: PRK13972
529507008596	GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs. Ure2p is a regulator for nitrogen catabolism in yeast. It represses the expression of several gene products involved in the use of poor nitrogen sources...; Region: GST_N_Ure2p_like; cd03048
529507008597	C-terminal domain interface [polypeptide binding]; other site
529507008598	GSH binding site (G-site) [chemical binding]; other site
529507008599	dimer interface [polypeptide binding]; other site
529507008600	C-terminal, alpha helical domain of Escherichia coli YfcG Glutathione S-transferases and related uncharacterized proteins; Region: GST_C_YfcG_like; cd10291
529507008601	N-terminal domain interface [polypeptide binding]; other site
529507008602	putative dimer interface [polypeptide binding]; other site
529507008603	active site
529507008604	HMMPfam hit to PF02798, Glutathione S-transferase, N-terminal domain, score 9.8e-09
529507008605	HMMPfam hit to PF00043, Glutathione S-transferase, C-terminal domain, score 4.3e-10
529507008606	Predicted nucleoside-diphosphate sugar epimerase [General function prediction only]; Region: COG1090
529507008607	atypical (a) SDRs, subgroup 8; Region: SDR_a8; cd05242
529507008608	putative NAD(P) binding site [chemical binding]; other site
529507008609	putative active site [active]
529507008610	3-octaprenyl-4-hydroxybenzoate carboxy-lyase; Provisional; Region: PRK06029
529507008611	Flavoprotein; Region: Flavoprotein; pfam02441
529507008612	HMMPfam hit to PF02441, Flavoprotein, score 1.1e-44
529507008613	amidophosphoribosyltransferase; Provisional; Region: PRK09246
529507008614	Glutamine amidotransferases class-II (GN-AT)_GPAT- type. This domain is found at the N-terminus of  glutamine phosphoribosylpyrophosphate (Prpp) amidotransferase (GPATase) . The glutaminase domain catalyzes amide nitrogen transfer from glutamine to the...; Region: GPATase_N; cd00715
529507008615	active site
529507008616	tetramer interface [polypeptide binding]; other site
529507008617	Phosphoribosyl transferase (PRT)-type I domain; Region: PRTases_typeI; cd06223
529507008618	active site
529507008619	HMMPfam hit to PF00156, Phosphoribosyl transferase domain, score 2.1e-11
529507008620	PS00103 Purine/pyrimidine phosphoribosyl transferases signature.
529507008621	HMMPfam hit to PF00310, Glutamine amidotransferases class-II, score 9.8e-57
529507008622	PS00443 Glutamine amidotransferases class-II active site.
529507008623	colicin V production protein; Provisional; Region: PRK10845
529507008624	Uncharacterized membrane protein, required for colicin V production [General function prediction only]; Region: CvpA; COG1286
529507008625	HMMPfam hit to PF02674, Colicin V production protein, score 2.9e-59
529507008626	4 probable transmembrane helices predicted for PMI1784 by TMHMM2.0 at aa 4-21, 28-50, 65-87 and 100-122
529507008627	cell division protein DedD; Provisional; Region: PRK11633
529507008628	Sporulation related domain; Region: SPOR; pfam05036
529507008629	HMMPfam hit to PF05036, Sporulation related repeat, score 0.14
529507008630	HMMPfam hit to PF05036, Sporulation related repeat, score 0.0023
529507008631	1 probable transmembrane helix predicted for PMI1785 by TMHMM2.0 at aa 7-29
529507008632	bifunctional folylpolyglutamate synthase/ dihydrofolate synthase; Provisional; Region: PRK10846
529507008633	Mur ligase middle domain; Region: Mur_ligase_M; pfam08245
529507008634	Mur ligase family, glutamate ligase domain; Region: Mur_ligase_C; pfam02875
529507008635	HMMPfam hit to PF02875, Mur ligase family, glutamate ligase doma, score 0.0051
529507008636	PS01012 Folylpolyglutamate synthase signature 2.
529507008637	PS01011 Folylpolyglutamate synthase signature 1.
529507008638	acetyl-CoA carboxylase subunit beta; Validated; Region: PRK05654
529507008639	malonate decarboxylase subunit beta; Reviewed; Region: PRK07189; cl17682
529507008640	hypothetical protein; Provisional; Region: PRK10847
529507008641	Uncharacterized membrane-associated protein [Function unknown]; Region: DedA; COG0586
529507008642	4 probable transmembrane helices predicted for PMI1788 by TMHMM2.0 at aa 36-58, 78-100, 163-185 and 195-217
529507008643	HMMPfam hit to PF00597, DedA family, score 1.2e-60
529507008644	tRNA pseudouridine synthase A; Validated; Region: truA; PRK00021
529507008645	Eukaryotic and bacterial pseudouridine synthases similar to E.  coli TruA; Region: PseudoU_synth_EcTruA; cd02570
529507008646	dimerization interface 3.5A [polypeptide binding]; other site
529507008647	active site
529507008648	HMMPfam hit to PF01416, tRNA pseudouridine synthase, score 3e-27
529507008649	HMMPfam hit to PF01416, tRNA pseudouridine synthase, score 6.6e-38
529507008650	putative semialdehyde dehydrogenase; Provisional; Region: PRK08040
529507008651	Semialdehyde dehydrogenase, NAD binding domain; Region: Semialdhyde_dh; smart00859
529507008652	HMMPfam hit to PF02774, Semialdehyde dehydrogenase, dimerisat, score 7.7e-34
529507008653	HMMPfam hit to PF01118, Semialdehyde dehydrogenase, NAD bindi, score 9.8e-27
529507008654	erythronate-4-phosphate dehydrogenase PdxB; Provisional; Region: PRK15438
529507008655	D-Erythronate-4-Phosphate Dehydrogenase NAD-binding and catalytic domains; Region: ErythrP_dh; cd12158
529507008656	ligand binding site [chemical binding]; other site
529507008657	NAD binding site [chemical binding]; other site
529507008658	catalytic site [active]
529507008659	homodimer interface [polypeptide binding]; other site
529507008660	HMMPfam hit to PF02826, D-isomer specific 2-hydroxyacid dehydrog, score 8.7e-51
529507008661	PS00671 D-isomer specific 2-hydroxyacid dehydrogenases signature 3.
529507008662	PS00065 D-isomer specific 2-hydroxyacid dehydrogenases NAD-binding signature.
529507008663	HMMPfam hit to PF00389, D-isomer specific 2-hydroxyacid dehydrog, score 4e-18
529507008664	Cupin domain; Region: Cupin_2; pfam07883
529507008665	AraC-type DNA-binding domain-containing proteins [Transcription]; Region: AraC; COG2207
529507008666	Bacterial regulatory helix-turn-helix proteins, AraC family; Region: HTH_AraC; pfam00165
529507008667	HMMPfam hit to PF00165, Bacterial regulatory helix-turn-helix protei, score 1.3e-08
529507008668	PS00041 Bacterial regulatory proteins, araC family signature.
529507008669	HMMPfam hit to PF00165, Bacterial regulatory helix-turn-helix protei, score 0.037
529507008670	Predicted helix-turn-helix motif with score 1169.000, SD 3.17 at aa 175-196, sequence TSLELWAKKRYTSERTLSRRCQ
529507008671	HMMPfam hit to PF07883, Cupin domain, score 0.0013
529507008672	Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only]; Region: RhaT; COG0697
529507008673	EamA-like transporter family; Region: EamA; pfam00892
529507008674	EamA-like transporter family; Region: EamA; pfam00892
529507008675	Signal peptide predicted for PMI1794 by SignalP 2.0 HMM (Signal peptide probability 0.950) with cleavage site probability 0.424 between residues 22 and 23
529507008676	10 probable transmembrane helices predicted for PMI1794 by TMHMM2.0 at aa 3-20, 35-54, 67-86, 91-113, 115-137, 152-169, 182-201, 211-233, 242-261 and 265-282
529507008677	HMMPfam hit to PF00892, Integral membrane protein DUF6, score 1.3e-24
529507008678	HMMPfam hit to PF00892, Integral membrane protein DUF6, score 1.8e-18
529507008679	3-oxoacyl-(acyl carrier protein) synthase I; Reviewed; Region: PRK07967
529507008680	Beta-ketoacyl-acyl carrier protein (ACP) synthase (KAS), type I and II. KASs are responsible for the elongation steps in fatty acid biosynthesis. KASIII catalyses the initial condensation and KAS I and II catalyze further elongation steps by Claisen...; Region: KAS_I_II; cd00834
529507008681	dimer interface [polypeptide binding]; other site
529507008682	active site
529507008683	HMMPfam hit to PF02801, Beta-ketoacyl synthase, C-terminal do, score 4.6e-61
529507008684	PS00639 Eukaryotic thiol (cysteine) proteases histidine active site.
529507008685	HMMPfam hit to PF00109, Beta-ketoacyl synthase, N-terminal do, score 3.8e-58
529507008686	PS00606 Beta-ketoacyl synthases active site.
529507008687	bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed; Region: mnmC; PRK01747
529507008688	Uncharacterized conserved protein [Function unknown]; Region: COG4121
529507008689	hydroxyglutarate oxidase; Provisional; Region: PRK11728
529507008690	HMMPfam hit to PF05430, Protein of unknown function (DUF752), score 5.6e-130
529507008691	HMMPfam hit to PF01266, FAD dependent oxidoreductase, score 4.4e-49
529507008692	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cd04301
529507008693	Acetyltransferases [General function prediction only]; Region: RimI; COG0456
529507008694	Coenzyme A binding pocket [chemical binding]; other site
529507008695	HMMPfam hit to PF00583, Acetyltransferase (GNAT) family, score 5.7e-16
529507008696	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507008697	Signal peptide predicted for PMI1798 by SignalP 2.0 HMM (Signal peptide probability 0.991) with cleavage site probability 0.944 between residues 19 and 20
529507008698	YfcL protein; Region: YfcL; pfam08891
529507008699	Protein of unknown function, DUF462; Region: DUF462; pfam04315
529507008700	HMMPfam hit to PF04315, Protein of unknown function, DUF462, score 1.3e-114
529507008701	hypothetical protein; Provisional; Region: PRK10621
529507008702	Sulfite exporter TauE/SafE; Region: TauE; pfam01925
529507008703	7 probable transmembrane helices predicted for PMI1801 by TMHMM2.0 at aa 10-32, 80-99, 109-127, 134-153, 157-174, 195-217 and 232-249
529507008704	HMMPfam hit to PF01925, Domain of unknown function DUF81, score 5.4e-47
529507008705	Chorismate synthase [Amino acid transport and metabolism]; Region: AroC; COG0082
529507008706	Chorismase synthase, the enzyme catalyzing the final step of the shikimate pathway; Region: Chorismate_synthase; cd07304
529507008707	Tetramer interface [polypeptide binding]; other site
529507008708	active site
529507008709	FMN-binding site [chemical binding]; other site
529507008710	HMMPfam hit to PF01264, Chorismate synthase, score 1.2e-227
529507008711	PS00789 Chorismate synthase signature 3.
529507008712	PS00788 Chorismate synthase signature 2.
529507008713	PS00787 Chorismate synthase signature 1.
529507008714	HemK family putative methylases; Region: hemK_fam; TIGR00536
529507008715	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
529507008716	S-adenosylmethionine binding site [chemical binding]; other site
529507008717	PS00092 N-6 Adenine-specific DNA methylases signature.
529507008718	DNA-binding ferritin-like protein (oxidative damage protectant) [Inorganic ion transport and metabolism]; Region: Dps; COG0783
529507008719	DPS protein, ferritin-like diiron-binding domain; Region: DPS; cd01043
529507008720	dimerization interface [polypeptide binding]; other site
529507008721	DPS ferroxidase diiron center [ion binding]; other site
529507008722	ion pore; other site
529507008723	HMMPfam hit to PF00210, Ferritin-like domain, score 1.2e-22
529507008724	hypothetical protein; Provisional; Region: PRK04946
529507008725	Smr domain; Region: Smr; pfam01713
529507008726	HMMPfam hit to PF01713, Smr domain, score 2e-28
529507008727	Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction; Region: HP_PGM_like; cd07067
529507008728	catalytic core [active]
529507008729	multifunctional fatty acid oxidation complex subunit alpha; Reviewed; Region: fadJ; PRK11154
529507008730	Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily. This superfamily contains a diverse set of enzymes including enoyl-CoA hydratase, napthoate synthase, methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA dehydratase, and dienoyl-CoA isomerase; Region: crotonase-like; cd06558
529507008731	substrate binding site [chemical binding]; other site
529507008732	oxyanion hole (OAH) forming residues; other site
529507008733	trimer interface [polypeptide binding]; other site
529507008734	3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; Region: 3HCDH_N; pfam02737
529507008735	3-hydroxyacyl-CoA dehydrogenase, C-terminal domain; Region: 3HCDH; pfam00725
529507008736	HMMPfam hit to PF00725, 3-hydroxyacyl-CoA dehydrogenase, C-terminal, score 3e-35
529507008737	PS00067 3-hydroxyacyl-CoA dehydrogenase signature.
529507008738	HMMPfam hit to PF02737, 3-hydroxyacyl-CoA dehydrogenase, NAD binding, score 9.9e-69
529507008739	HMMPfam hit to PF00378, Enoyl-CoA hydratase/isomerase family, score 7.8e-69
529507008740	3-ketoacyl-CoA thiolase; Reviewed; Region: fadI; PRK08963
529507008741	Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine. They are found in prokaryotes and...; Region: thiolase; cd00751
529507008742	dimer interface [polypeptide binding]; other site
529507008743	active site
529507008744	HMMPfam hit to PF02803, Thiolase, C-terminal domain, score 1.8e-51
529507008745	PS00099 Thiolases active site.
529507008746	PS00737 Thiolases signature 2.
529507008747	HMMPfam hit to PF00108, Thiolase, N-terminal domain, score 4.1e-64
529507008748	PS00098 Thiolases acyl-enzyme intermediate signature.
529507008749	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG3691
529507008750	HMMPfam hit to PF04175, Protein of unknown function (DUF406), score 4.6e-50
529507008751	long-chain fatty acid outer membrane transporter; Provisional; Region: PRK10716
529507008752	Signal peptide predicted for PMI1810 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.997 between residues 25 and 26
529507008753	HMMPfam hit to PF03349, Outer membrane protein transport protein (O, score 3.2e-165
529507008754	PS00017 ATP/GTP-binding site motif A (P-loop).
529507008755	ABC transporter outer membrane lipoprotein; Provisional; Region: PRK15091
529507008756	HMMPfam hit to PF04333, VacJ like lipoprotein, score 3.4e-107
529507008757	Signal peptide predicted for PMI1811 by SignalP 2.0 HMM (Signal peptide probability 0.639) with cleavage site probability 0.320 between residues 40 and 41
529507008758	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507008759	Signal peptide predicted for PMI1812 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.989 between residues 20 and 21
529507008760	1 probable transmembrane helix predicted for PMI1812 by TMHMM2.0 at aa 5-27
529507008761	Sulfite exporter TauE/SafE; Region: TauE; pfam01925
529507008762	Signal peptide predicted for PMI1813 by SignalP 2.0 HMM (Signal peptide probability 0.623) with cleavage site probability 0.467 between residues 40 and 41
529507008763	HMMPfam hit to PF01925, Domain of unknown function DUF81, score 9.2e-15
529507008764	8 probable transmembrane helices predicted for PMI1813 by TMHMM2.0 at aa 13-35, 48-70, 82-104, 108-126, 146-168, 183-205, 212-234 and 249-266
529507008765	thiosulfate reductase PhsA; Provisional; Region: PRK15488
529507008766	The MopB_Thiosulfate-R-like CD contains thiosulfate-, sulfur-, and polysulfide-reductases, and other related proteins. Thiosulfate reductase catalyzes the cleavage of sulfur-sulfur bonds in thiosulfate. Polysulfide reductase is a membrane-bound enzyme...; Region: MopB_Thiosulfate-R-like; cd02755
529507008767	putative [Fe4-S4] binding site [ion binding]; other site
529507008768	putative molybdopterin cofactor binding site [chemical binding]; other site
529507008769	The MopB_CT_Thiosulfate-R-like CD contains thiosulfate-, sulfur-, and polysulfide-reductases, and other related proteins. Thiosulfate reductase catalyzes the cleavage of sulfur-sulfur bonds in thiosulfate. Polysulfide reductase is a membrane-bound enzyme...; Region: MopB_CT_Thiosulfate-R-like; cd02778
529507008770	putative molybdopterin cofactor binding site; other site
529507008771	Signal peptide predicted for PMI1814 by SignalP 2.0 HMM (Signal peptide probability 0.997) with cleavage site probability 0.985 between residues 30 and 31
529507008772	HMMPfam hit to PF04879, Molybdopterin oxidoreductase Fe4S4 do, score 3.4e-15
529507008773	HMMPfam hit to PF00384, Molybdopterin oxidoreductase, score 2.7e-111
529507008774	PS00490 Prokaryotic molybdopterin oxidoreductases signature 2.
529507008775	HMMPfam hit to PF01568, Molydopterin dinucleotide binding dom, score 2.1e-21
529507008776	This CDS appears to have a frame shift mutation following codon 49; thiosulfate reductase electron transport protein (pseudogene)
529507008777	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 1.1e-05
529507008778	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
529507008779	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 0.017
529507008780	thiosulfate reductase cytochrome B subunit; Provisional; Region: PRK15006
529507008781	Thiosulfate reductase cytochrome B subunit (membrane anchoring protein) [Energy production and conversion]; Region: COG4117
529507008782	5 probable transmembrane helices predicted for PMI1816 by TMHMM2.0 at aa 15-37, 66-85, 95-117, 170-192 and 202-224
529507008783	Predicted transcriptional regulators [Transcription]; Region: HipB; COG1396
529507008784	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
529507008785	non-specific DNA binding site [nucleotide binding]; other site
529507008786	salt bridge; other site
529507008787	sequence-specific DNA binding site [nucleotide binding]; other site
529507008788	HMMPfam hit to PF01381, Helix-turn-helix, score 8.4e-10
529507008789	Predicted helix-turn-helix motif with score 1376.000, SD 3.87 at aa 24-45, sequence YTVFQLAKEIDISEQQLFRYER
529507008790	glutamyl-tRNA synthetase; Reviewed; Region: gltX; PRK01406
529507008791	catalytic core domain of discriminating glutamyl-tRNA synthetase; Region: GluRS_core; cd00808
529507008792	HIGH motif; other site
529507008793	catalytic core domain of discriminating glutamyl-tRNA synthetase; Region: GluRS_core; cd00808
529507008794	active site
529507008795	KMSKS motif; other site
529507008796	HMMPfam hit to PF00749, tRNA synthetases class I (E and Q), cata, score 5.2e-172
529507008797	PS00178 Aminoacyl-transfer RNA synthetases class-I signature.
529507008798	3-ketoacyl-(acyl-carrier-protein) reductase; Validated; Region: fabG; PRK05557
529507008799	classical (c) SDRs; Region: SDR_c; cd05233
529507008800	NAD(P) binding site [chemical binding]; other site
529507008801	active site
529507008802	HMMPfam hit to PF00106, short chain dehydrogenase, score 1.7e-81
529507008803	PS00061 Short-chain dehydrogenases/reductases family signature.
529507008804	helix_turn_helix multiple antibiotic resistance protein; Region: HTH_MARR; smart00347
529507008805	MarR family; Region: MarR_2; pfam12802
529507008806	HMMPfam hit to PF01047, MarR family, score 1.2e-19
529507008807	Predicted helix-turn-helix motif with score 1078.000, SD 2.86 at aa 46-67, sequence LTPSQLCEILAISRQNLSKFMR
529507008808	Protein of unknown function (DUF3820); Region: DUF3820; pfam12843
529507008809	Nucleoside permease [Nucleotide transport and metabolism]; Region: NupC; COG1972
529507008810	Na+ dependent nucleoside transporter N-terminus; Region: Nucleos_tra2_N; pfam01773
529507008811	Nucleoside recognition; Region: Gate; pfam07670
529507008812	Na+ dependent nucleoside transporter C-terminus; Region: Nucleos_tra2_C; pfam07662
529507008813	HMMPfam hit to PF07662, Na+ dependent nucleoside transporter C, score 4.7e-99
529507008814	9 probable transmembrane helices predicted for PMI1822 by TMHMM2.0 at aa 4-23, 30-48, 86-108, 167-189, 193-215, 241-263, 273-295, 334-356 and 371-393
529507008815	HMMPfam hit to PF07670, Nucleoside recognition, score 3.5e-14
529507008816	HMMPfam hit to PF01773, Na+ dependent nucleoside transporter N, score 5.6e-30
529507008817	Signal peptide predicted for PMI1822 by SignalP 2.0 HMM (Signal peptide probability 0.976) with cleavage site probability 0.402 between residues 21 and 22
529507008818	NAD-dependent DNA ligase LigA; Validated; Region: ligA; PRK07956
529507008819	NAD+ dependent DNA ligase adenylation domain. DNA ligases catalyze the crucial step of joining the breaks in duplex DNA during DNA replication, repair and recombination, utilizing either ATP or NAD(+) as a cofactor, but using the same basic reaction...; Region: LIGANc; cd00114
529507008820	nucleotide binding pocket [chemical binding]; other site
529507008821	K-X-D-G motif; other site
529507008822	catalytic site [active]
529507008823	NAD-dependent DNA ligase OB-fold domain; Region: DNA_ligase_OB; pfam03120
529507008824	NAD-dependent DNA ligase C4 zinc finger domain; Region: DNA_ligase_ZBD; pfam03119
529507008825	Breast Cancer Suppressor Protein (BRCA1), carboxy-terminal domain. The BRCT domain is found within many DNA damage repair and cell cycle checkpoint proteins. The unique diversity of this domain superfamily allows BRCT modules to interact forming homo...; Region: BRCT; cd00027
529507008826	Dimer interface [polypeptide binding]; other site
529507008827	BRCT sequence motif; other site
529507008828	HMMPfam hit to PF00533, BRCA1 C Terminus (BRCT) domain, score 1.6e-19
529507008829	HMMPfam hit to PF00633, Helix-hairpin-helix motif, score 0.00017
529507008830	HMMPfam hit to PF00633, Helix-hairpin-helix motif, score 3.9
529507008831	HMMPfam hit to PF03119, NAD-dependent DNA ligase C4 zinc fing, score 1.4e-11
529507008832	HMMPfam hit to PF03120, NAD-dependent DNA ligase OB-fold doma, score 2.6e-52
529507008833	PS01056 NAD-dependent DNA ligase signature 2.
529507008834	HMMPfam hit to PF01653, NAD-dependent DNA ligase adenylation, score 1e-205
529507008835	PS01055 NAD-dependent DNA ligase signature 1.
529507008836	cell division protein ZipA; Provisional; Region: PRK03427
529507008837	ZipA C-terminal domain. ZipA, a membrane-anchored protein, is one of at least nine essential gene products necessary for assembly of the septal ring which mediates cell division in E.coli. ZipA and FtsA directly bind FtsZ, a homolog of eukaryotic...; Region: ZipA; cd00231
529507008838	FtsZ protein binding site [polypeptide binding]; other site
529507008839	HMMPfam hit to PF04354, ZipA, C-terminal FtsZ-binding domain, score 1.6e-71
529507008840	putative sulfate transport protein CysZ; Validated; Region: PRK04949
529507008841	4 probable transmembrane helices predicted for PMI1826 by TMHMM2.0 at aa 32-54, 69-91, 153-175 and 215-237
529507008842	HMMPfam hit to PF04401, Protein of unknown function (DUF540), score 3e-93
529507008843	Cysteine synthase [Amino acid transport and metabolism]; Region: CysK; COG0031
529507008844	CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase. CBS is a unique heme-containing enzyme that catalyzes a pyridoxal 5'-phosphate (PLP)-dependent condensation of serine and homocysteine to give cystathionine; Region: CBS_like; cd01561
529507008845	dimer interface [polypeptide binding]; other site
529507008846	pyridoxal 5'-phosphate binding site [chemical binding]; other site
529507008847	catalytic residue [active]
529507008848	HMMPfam hit to PF00291, Pyridoxal-phosphate dependent enzyme, score 3.1e-130
529507008849	PS00901 Cysteine synthase/cystathionine beta-synthase P-phosphate attachment site.
529507008850	Histidine-containing phosphocarrier protein (HPr)-like proteins. HPr is a central component of the bacterial phosphoenolpyruvate sugar phosphotransferase system (PTS). The PTS catalyses the phosphorylation of sugar substrates during their translocation...; Region: PTS-HPr_like; cd00367
529507008851	dimerization domain swap beta strand [polypeptide binding]; other site
529507008852	regulatory protein interface [polypeptide binding]; other site
529507008853	active site
529507008854	regulatory phosphorylation site [posttranslational modification]; other site
529507008855	HMMPfam hit to PF00381, PTS HPr component phosphorylation site, score 3.6e-44
529507008856	PS00369 PTS HPR component histidine phosphorylation site signature.
529507008857	PS00589 PTS HPR component serine phosphorylation site signature.
529507008858	phosphoenolpyruvate-protein phosphotransferase; Provisional; Region: PRK11177
529507008859	PEP-utilising enzyme, N-terminal; Region: PEP-utilisers_N; pfam05524
529507008860	PEP-utilising enzyme, mobile domain; Region: PEP-utilizers; pfam00391
529507008861	PEP-utilising enzyme, TIM barrel domain; Region: PEP-utilizers_C; pfam02896
529507008862	HMMPfam hit to PF05524, PEP-utilising enzyme, N-terminal, score 4.9e-54
529507008863	HMMPfam hit to PF00391, PEP-utilising enzyme, mobile domain, score 2.5e-34
529507008864	PS00370 PEP-utilizing enzymes phosphorylation site signature.
529507008865	HMMPfam hit to PF02896, PEP-utilising enzyme, TIM barrel doma, score 6.4e-188
529507008866	PS00742 PEP-utilizing enzymes signature 2.
529507008867	PTS_IIA, PTS system, glucose/sucrose specific IIA subunit. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. This family...; Region: PTS_IIA_glc; cd00210
529507008868	HPr interaction site; other site
529507008869	glycerol kinase (GK) interaction site [polypeptide binding]; other site
529507008870	active site
529507008871	phosphorylation site [posttranslational modification]
529507008872	HMMPfam hit to PF00358, phosphoenolpyruvate-dependent sugar phosph, score 5.1e-63
529507008873	PS00371 PTS EIIA domains phosphorylation site signature 1.
529507008874	cysteine synthase B; Region: cysM; TIGR01138
529507008875	CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase. CBS is a unique heme-containing enzyme that catalyzes a pyridoxal 5'-phosphate (PLP)-dependent condensation of serine and homocysteine to give cystathionine; Region: CBS_like; cd01561
529507008876	dimer interface [polypeptide binding]; other site
529507008877	pyridoxal 5'-phosphate binding site [chemical binding]; other site
529507008878	catalytic residue [active]
529507008879	HMMPfam hit to PF00291, Pyridoxal-phosphate dependent enzyme, score 2.9e-107
529507008880	PS00901 Cysteine synthase/cystathionine beta-synthase P-phosphate attachment site.
529507008881	sulfate/thiosulfate transporter subunit; Provisional; Region: PRK10851
529507008882	ATP-binding cassette domain of the sulfate transporter; Region: ABC_CysA_sulfate_importer; cd03296
529507008883	Walker A/P-loop; other site
529507008884	ATP binding site [chemical binding]; other site
529507008885	Q-loop/lid; other site
529507008886	ABC transporter signature motif; other site
529507008887	Walker B; other site
529507008888	D-loop; other site
529507008889	H-loop/switch region; other site
529507008890	HMMPfam hit to PF00005, ABC transporter, score 2.8e-68
529507008891	PS00211 ABC transporters family signature.
529507008892	PS00017 ATP/GTP-binding site motif A (P-loop).
529507008893	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
529507008894	dimer interface [polypeptide binding]; other site
529507008895	conserved gate region; other site
529507008896	putative PBP binding loops; other site
529507008897	ABC-ATPase subunit interface; other site
529507008898	HMMPfam hit to PF00528, Binding-protein-dependent transport syst, score 8e-17
529507008899	5 probable transmembrane helices predicted for PMI1833 by TMHMM2.0 at aa 21-43, 63-85, 106-125, 140-162 and 246-268
529507008900	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
529507008901	sulfate transport protein; Provisional; Region: cysT; CHL00187
529507008902	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
529507008903	dimer interface [polypeptide binding]; other site
529507008904	conserved gate region; other site
529507008905	putative PBP binding loops; other site
529507008906	ABC-ATPase subunit interface; other site
529507008907	HMMPfam hit to PF00528, Binding-protein-dependent transport syst, score 2.7e-42
529507008908	6 probable transmembrane helices predicted for PMI1834 by TMHMM2.0 at aa 13-35, 62-84, 104-126, 136-155, 212-234 and 244-266
529507008909	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
529507008910	Signal peptide predicted for PMI1834 by SignalP 2.0 HMM (Signal peptide probability 0.862) with cleavage site probability 0.689 between residues 36 and 37
529507008911	thiosulfate transporter subunit; Provisional; Region: PRK10852
529507008912	Bacterial extracellular solute-binding protein; Region: SBP_bac_11; pfam13531
529507008913	HMMPfam hit to PF01547, Bacterial extracellular solute-binding prot, score 4.2e-08
529507008914	1 probable transmembrane helix predicted for PMI1835 by TMHMM2.0 at aa 13-35
529507008915	Signal peptide predicted for PMI1835 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.995 between residues 31 and 32
529507008916	Dyp-type peroxidase family; Region: Dyp_perox; pfam04261
529507008917	HMMPfam hit to PF04261, Dyp-type peroxidase family, score 4.4e-119
529507008918	Protein of unknown function (DUF1131); Region: DUF1131; pfam06572
529507008919	RpoE-regulated lipoprotein; Provisional; Region: PRK10718
529507008920	HMMPfam hit to PF06572, Protein of unknown function (DUF1131), score 7.3e-63
529507008921	PS00430 TonB-dependent receptor proteins signature 1.
529507008922	Signal peptide predicted for PMI1837 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.578 between residues 29 and 30
529507008923	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507008924	putative acetyltransferase; Provisional; Region: PRK03624
529507008925	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cd04301
529507008926	Coenzyme A binding pocket [chemical binding]; other site
529507008927	HMMPfam hit to PF00583, Acetyltransferase (GNAT) family, score 7.5e-14
529507008928	coproporphyrinogen III oxidase; Provisional; Region: PRK05330
529507008929	Coproporphyrinogen III oxidase; Region: Coprogen_oxidas; pfam01218
529507008930	HMMPfam hit to PF01218, Coproporphyrinogen III oxidase, score 7.9e-207
529507008931	PS01021 Coproporphyrinogen III oxidase signature.
529507008932	Signal peptide predicted for PMI1840 by SignalP 2.0 HMM (Signal peptide probability 0.681) with cleavage site probability 0.330 between residues 17 and 18
529507008933	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507008934	GTP-binding protein Der; Reviewed; Region: PRK00093
529507008935	EngA1 GTPase contains the first domain of EngA; Region: EngA1; cd01894
529507008936	G1 box; other site
529507008937	GTP/Mg2+ binding site [chemical binding]; other site
529507008938	Switch I region; other site
529507008939	G2 box; other site
529507008940	Switch II region; other site
529507008941	G3 box; other site
529507008942	G4 box; other site
529507008943	G5 box; other site
529507008944	EngA2 GTPase contains the second domain of EngA; Region: EngA2; cd01895
529507008945	G1 box; other site
529507008946	GTP/Mg2+ binding site [chemical binding]; other site
529507008947	Switch I region; other site
529507008948	G2 box; other site
529507008949	G3 box; other site
529507008950	Switch II region; other site
529507008951	G4 box; other site
529507008952	G5 box; other site
529507008953	HMMPfam hit to PF01926, GTPase of unknown function, score 1.8e-45
529507008954	PS00017 ATP/GTP-binding site motif A (P-loop).
529507008955	HMMPfam hit to PF01926, GTPase of unknown function, score 2.3e-45
529507008956	PS00017 ATP/GTP-binding site motif A (P-loop).
529507008957	outer membrane biogenesis protein BamB; Provisional; Region: PRK11138
529507008958	Beta-barrel assembly machinery (Bam) complex component B and related proteins; Region: BamB_YfgL; cd10276
529507008959	Trp docking motif [polypeptide binding]; other site
529507008960	Signal peptide predicted for PMI1842 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.512 between residues 23 and 24
529507008961	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507008962	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG2976
529507008963	1 probable transmembrane helix predicted for PMI1843 by TMHMM2.0 at aa 20-39
529507008964	histidyl-tRNA synthetase; Reviewed; Region: hisS; PRK00037
529507008965	Class II Histidinyl-tRNA synthetase (HisRS)-like catalytic core domain. HisRS is a homodimer. It is responsible for the attachment of histidine to the 3' OH group of ribose of the appropriate tRNA. This domain is primarily responsible for...; Region: HisRS-like_core; cd00773
529507008966	dimer interface [polypeptide binding]; other site
529507008967	motif 1; other site
529507008968	active site
529507008969	motif 2; other site
529507008970	motif 3; other site
529507008971	HisRS Histidyl-anticodon binding domain. HisRS belongs to class II aminoacyl-tRNA synthetases (aaRS). This alignment contains the anticodon binding domain, which is responsible for specificity in tRNA-binding, so that the activated amino acid is...; Region: HisRS_anticodon; cd00859
529507008972	anticodon binding site; other site
529507008973	HMMPfam hit to PF03129, Anticodon binding domain, score 1.1e-14
529507008974	PS00339 Aminoacyl-transfer RNA synthetases class-II signature 2.
529507008975	HMMPfam hit to PF00587, tRNA synthetase class II core domain (, score 1.9e-50
529507008976	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Reviewed; Region: ispG; PRK00366
529507008977	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Validated; Region: PRK00694
529507008978	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Validated; Region: PRK00694
529507008979	HMMPfam hit to PF04551, GcpE protein, score 1.6e-250
529507008980	cytoskeletal protein RodZ; Provisional; Region: PRK10856
529507008981	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
529507008982	non-specific DNA binding site [nucleotide binding]; other site
529507008983	salt bridge; other site
529507008984	sequence-specific DNA binding site [nucleotide binding]; other site
529507008985	Domain of unknown function (DUF4115); Region: DUF4115; pfam13464
529507008986	1 probable transmembrane helix predicted for PMI1846 by TMHMM2.0 at aa 126-148
529507008987	Predicted helix-turn-helix motif with score 1148.000, SD 3.10 at aa 43-64, sequence LTQQTVADRLCLKLTTVCEIEA
529507008988	Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi; Region: TPR; cd00189
529507008989	binding surface
529507008990	Tetratricopeptide repeat; Region: TPR_16; pfam13432
529507008991	TPR motif; other site
529507008992	HMMPfam hit to PF07719, Tetratricopeptide repeat, score 1.9
529507008993	HMMPfam hit to PF07719, Tetratricopeptide repeat, score 0.0051
529507008994	Signal peptide predicted for PMI1847 by SignalP 2.0 HMM (Signal peptide probability 0.985) with cleavage site probability 0.705 between residues 24 and 25
529507008995	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507008996	ribosomal RNA large subunit methyltransferase N; Provisional; Region: PRK11194
529507008997	Radical SAM superfamily. Enzymes of this family generate radicals by combining a 4Fe-4S cluster and S-adenosylmethionine (SAM) in close proximity. They are characterized by a conserved CxxxCxxC motif, which coordinates the conserved iron-sulfur cluster; Region: Radical_SAM; cl15377
529507008998	FeS/SAM binding site; other site
529507008999	HMMPfam hit to PF04055, Radical SAM superfamily, score 5.9e-19
529507009000	Nucleoside diphosphate kinase Group I (NDPk_I)-like: NDP kinase domains are present in a large family of structurally and functionally conserved proteins from bacteria to humans that generally catalyze the transfer of gamma-phosphates of a nucleoside...; Region: NDPk_I; cd04413
529507009001	active site
529507009002	multimer interface [polypeptide binding]; other site
529507009003	HMMPfam hit to PF00334, Nucleoside diphosphate kinase, score 4.9e-73
529507009004	PS00469 Nucleoside diphosphate kinases active site.
529507009005	penicillin-binding protein 1C; Provisional; Region: PRK11240
529507009006	Transglycosylase; Region: Transgly; pfam00912
529507009007	Ribosomal protein L1.  The L1 protein, located near the E-site of the ribosome, forms part of the L1 stalk along with 23S rRNA.  In bacteria and archaea, L1 functions both as a ribosomal protein that binds rRNA, and as a translation repressor that binds...; Region: Ribosomal_L1; cl00322
529507009008	Penicillin binding protein transpeptidase domain; Region: Transpeptidase; cl17760
529507009009	Penicillin-Binding Protein C-terminus Family; Region: BiPBP_C; pfam06832
529507009010	HMMPfam hit to PF06832, Penicillin-Binding Protein C-terminus, score 9.6e-16
529507009011	HMMPfam hit to PF00905, Penicillin binding protein transpeptid, score 3.8e-13
529507009012	PS00017 ATP/GTP-binding site motif A (P-loop).
529507009013	HMMPfam hit to PF00912, Transglycosylase, score 9.6e-82
529507009014	1 probable transmembrane helix predicted for PMI1850 by TMHMM2.0 at aa 7-26
529507009015	Large extracellular alpha-helical protein [General function prediction only]; Region: COG2373
529507009016	MG2 domain; Region: A2M_N; pfam01835
529507009017	Proteins similar to alpha2-macroglobulin (alpha (2)-M).  Alpha (2)-M is a major carrier protein in serum. It is a broadly specific proteinase inhibitor.  The structural thioester of alpha (2)-M, is involved in the immobilization and entrapment of...; Region: A2M_like; cd02891
529507009018	surface patch; other site
529507009019	thioester region; other site
529507009020	specificity defining residues; other site
529507009021	HMMPfam hit to PF07703, Alpha-2-macroglobulin family N-terminal regi, score 1.8e-31
529507009022	PS00215 Mitochondrial energy transfer proteins signature.
529507009023	HMMPfam hit to PF01835, Alpha-2-macroglobulin family N-terminal regi, score 1.2e-78
529507009024	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507009025	SseB protein; Region: SseB; cl06279
529507009026	aminopeptidase B; Provisional; Region: PRK05015
529507009027	Cytosol aminopeptidase family, N-terminal and catalytic domains.  Family M17 contains zinc- and manganese-dependent exopeptidases ( EC  3.4.11.1), including leucine aminopeptidase. They catalyze removal of amino acids from the N-terminus of a protein and...; Region: Peptidase_M17; cd00433
529507009028	interface (dimer of trimers) [polypeptide binding]; other site
529507009029	Substrate-binding/catalytic site; other site
529507009030	Zn-binding sites [ion binding]; other site
529507009031	HMMPfam hit to PF00883, Cytosol aminopeptidase family, catalyti, score 6.3e-155
529507009032	PS00631 Cytosol aminopeptidase signature.
529507009033	Iron-sulphur cluster assembly; Region: Fe-S_assembly; cl01123
529507009034	HMMPfam hit to PF04384, Protein of unknown function (DUF528), score 1.9e-44
529507009035	Ferredoxin [Energy production and conversion]; Region: Fdx; COG0633
529507009036	2Fe-2S iron-sulfur cluster binding domain. Iron-sulfur proteins play an important role in electron transfer processes and in various enzymatic reactions. The family includes plant and algal ferredoxins, which act as electron carriers in photosynthesis...; Region: fer2; cd00207
529507009037	catalytic loop [active]
529507009038	iron binding site [ion binding]; other site
529507009039	HMMPfam hit to PF00111, 2Fe-2S iron-sulfur cluster binding domain, score 5.7e-25
529507009040	PS00814 Adrenodoxin family, iron-sulfur binding region signature.
529507009041	chaperone protein HscA; Provisional; Region: hscA; PRK05183
529507009042	Nucleotide-binding domain of HscA and similar proteins; Region: HscA_like_NBD; cd10236
529507009043	nucleotide binding site [chemical binding]; other site
529507009044	putative NEF/HSP70 interaction site [polypeptide binding]; other site
529507009045	SBD interface [polypeptide binding]; other site
529507009046	HMMPfam hit to PF00012, Hsp70 protein, score 1.1e-242
529507009047	PS01036 Heat shock hsp70 proteins family signature 3.
529507009048	PS00329 Heat shock hsp70 proteins family signature 2.
529507009049	PS00297 Heat shock hsp70 proteins family signature 1.
529507009050	co-chaperone HscB; Provisional; Region: hscB; PRK05014
529507009051	DnaJ domain or J-domain.  DnaJ/Hsp40 (heat shock protein 40) proteins are highly conserved and play crucial roles in protein translation, folding, unfolding, translocation, and degradation. They act primarily by stimulating the ATPase activity of Hsp70s; Region: DnaJ; cd06257
529507009052	HSP70 interaction site [polypeptide binding]; other site
529507009053	HSCB C-terminal oligomerisation domain; Region: HSCB_C; pfam07743
529507009054	HMMPfam hit to PF07743, HSCB C-terminal oligomerisation domain, score 4.9e-31
529507009055	HMMPfam hit to PF00226, DnaJ domain, score 1.1e-11
529507009056	iron-sulfur cluster assembly protein; Provisional; Region: iscA; PRK09502
529507009057	HMMPfam hit to PF01521, HesB-like domain, score 4.6e-56
529507009058	PS01152 Hypothetical hesB/yadR/yfhF family signature.
529507009059	NifU homolog involved in Fe-S cluster formation [Energy production and conversion]; Region: IscU; COG0822
529507009060	Iron-sulfur cluster scaffold-like proteins; Region: IscU_like; cd06664
529507009061	trimerization site [polypeptide binding]; other site
529507009062	active site
529507009063	HMMPfam hit to PF01592, NifU-like N terminal domain, score 1.3e-82
529507009064	cysteine desulfurase; Provisional; Region: PRK14012
529507009065	cysteine desulfurase NifS; Region: FeS_nifS; TIGR03402
529507009066	pyridoxal 5'-phosphate binding pocket [chemical binding]; other site
529507009067	catalytic residue [active]
529507009068	HMMPfam hit to PF00266, Aminotransferase class-V, score 2.3e-121
529507009069	PS00595 Aminotransferases class-V pyridoxal-phosphate attachment site.
529507009070	DNA-binding transcriptional regulator IscR; Provisional; Region: PRK10857
529507009071	Rrf2 family protein; Region: rrf2_super; TIGR00738
529507009072	HMMPfam hit to PF02082, Transcriptional regulator, score 6.8e-49
529507009073	Predicted helix-turn-helix motif with score 1222.000, SD 3.35 at aa 36-57, sequence VPLADISERQGISLSYLEQLFS
529507009074	tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ; Provisional; Region: PRK15114
529507009075	SpoU rRNA Methylase family; Region: SpoU_methylase; pfam00588
529507009076	HMMPfam hit to PF00588, SpoU rRNA Methylase family, score 3.4e-24
529507009077	Archaeal fructose-1,6-bisphosphatase and related enzymes of inositol monophosphatase family [Carbohydrate transport and metabolism]; Region: SuhB; COG0483
529507009078	IMPase, inositol monophosphatase and related domains. A family of Mg++ dependent phosphatases, inhibited by lithium, many of which may act on inositol monophosphate substrate. They dephosphorylate inositol phosphate to generate inositol, which may be...; Region: IMPase; cd01639
529507009079	active site
529507009080	dimerization interface [polypeptide binding]; other site
529507009081	HMMPfam hit to PF00459, Inositol monophosphatase family, score 7e-110
529507009082	PS00629 Inositol monophosphatase family signature 1.
529507009083	putative DNA-binding transcriptional regulator; Provisional; Region: PRK11552
529507009084	Bacterial regulatory proteins, tetR family; Region: TetR_N; pfam00440
529507009085	Domain of unknown function (DUF1956); Region: DUF1956; pfam09209
529507009086	HMMPfam hit to PF00440, Bacterial regulatory proteins, tetR family, score 3.4e-07
529507009087	Predicted helix-turn-helix motif with score 1619.000, SD 4.70 at aa 34-55, sequence LRTRQLAQDAGVNQSAIPYHFG
529507009088	Xaa-Pro aminopeptidase [Amino acid transport and metabolism]; Region: PepP; COG0006
529507009089	Creatinase/Prolidase N-terminal domain; Region: Creatinase_N; pfam01321
529507009090	A family including aminopeptidase P, aminopeptidase M, and prolidase. Also known as metallopeptidase family M24. This family of enzymes is able to cleave amido-, imido- and amidino-containing bonds. Members exibit relatively narrow substrate specificity...; Region: APP_MetAP; cd01066
529507009091	active site
529507009092	HMMPfam hit to PF00557, metallopeptidase family M24, score 5.2e-05
529507009093	PS00017 ATP/GTP-binding site motif A (P-loop).
529507009094	putative 3-phenylpropionic acid transporter; Provisional; Region: PRK11128
529507009095	MFS_1 like family; Region: MFS_1_like; pfam12832
529507009096	12 probable transmembrane helices predicted for PMI1866 by TMHMM2.0 at aa 13-35, 45-67, 80-102, 106-128, 141-158, 163-185, 215-237, 247-269, 276-298, 302-324, 337-356 and 366-383
529507009097	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 4.4e-17
529507009098	serine hydroxymethyltransferase; Reviewed; Region: glyA; PRK00011
529507009099	Serine-glycine hydroxymethyltransferase (SHMT). This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). SHMT carries out interconversion of serine and glycine; it catalyzes the transfer of hydroxymethyl...; Region: SHMT; cd00378
529507009100	dimer interface [polypeptide binding]; other site
529507009101	active site
529507009102	glycine-pyridoxal phosphate binding site [chemical binding]; other site
529507009103	folate binding site [chemical binding]; other site
529507009104	HMMPfam hit to PF00464, Serine hydroxymethyltransferase, score 3.2e-280
529507009105	PS00096 Serine hydroxymethyltransferase pyridoxal-phosphate attachment site.
529507009106	bifunctional nitric oxide dioxygenase/dihydropteridine reductase 2; Provisional; Region: PRK13289
529507009107	Globins are heme proteins, which bind and transport oxygen. This family summarizes a diverse set of homologous protein domains, including: (1) tetrameric vertebrate hemoglobins, which are the major protein component of erythrocytes and transport oxygen...; Region: globin; cd01040
529507009108	heme-binding site [chemical binding]; other site
529507009109	FAD_NAD(P)H binding domain of flavohemoglobin. Flavohemoglobins have a globin domain containing a B-type heme fused with a ferredoxin reductase-like FAD/NAD-binding domain. Flavohemoglobins detoxify nitric oxide (NO) via an NO dioxygenase reaction. The...; Region: flavohem_like_fad_nad_binding; cd06184
529507009110	FAD binding pocket [chemical binding]; other site
529507009111	FAD binding motif [chemical binding]; other site
529507009112	phosphate binding motif [ion binding]; other site
529507009113	beta-alpha-beta structure motif; other site
529507009114	NAD binding pocket [chemical binding]; other site
529507009115	Heme binding  pocket [chemical binding]; other site
529507009116	HMMPfam hit to PF00042, Globin, score 4.4e-22
529507009117	HMMPfam hit to PF00970, Oxidoreductase FAD-binding domain, score 1.2e-06
529507009118	HMMPfam hit to PF00175, Oxidoreductase NAD-binding domain, score 1.1e-13
529507009119	6 probable transmembrane helices predicted for PMI1869 by TMHMM2.0 at aa 13-35, 50-67, 74-91, 101-119, 139-161 and 183-200
529507009120	Signal peptide predicted for PMI1869 by SignalP 2.0 HMM (Signal peptide probability 0.718) with cleavage site probability 0.235 between residues 32 and 33
529507009121	nitrogen regulatory protein P-II 1; Provisional; Region: PRK10858
529507009122	Nitrogen regulatory protein P-II; Region: P-II; smart00938
529507009123	HMMPfam hit to PF00543, Nitrogen regulatory protein P-II, score 6.5e-70
529507009124	PS00638 P-II protein C-terminal region signature.
529507009125	PS00496 P-II protein urydylation site.
529507009126	NAD synthetase; Provisional; Region: PRK13981
529507009127	Glutamine aminotransferase (GAT, glutaminase) domain of glutamine-dependent NAD synthetases (class 7 and 8 nitrilases); Region: GAT_Gln-NAD-synth; cd07570
529507009128	multimer interface [polypeptide binding]; other site
529507009129	active site
529507009130	catalytic triad [active]
529507009131	protein interface 1 [polypeptide binding]; other site
529507009132	NAD+ synthase is a homodimer, which catalyzes the final step in de novo nicotinamide adenine dinucleotide (NAD+) biosynthesis, an amide transfer from either ammonia or glutamine to nicotinic acid adenine dinucleotide (NaAD). The conversion of NaAD to NAD...; Region: NAD_synthase; cd00553
529507009133	homodimer interface [polypeptide binding]; other site
529507009134	NAD binding pocket [chemical binding]; other site
529507009135	ATP binding pocket [chemical binding]; other site
529507009136	Mg binding site [ion binding]; other site
529507009137	active-site loop [active]
529507009138	HMMPfam hit to PF02540, NAD synthase, score 7.7e-74
529507009139	PS00307 Legume lectins beta-chain signature.
529507009140	HMMPfam hit to PF00795, Carbon-nitrogen hydrolase, score 3.4e-10
529507009141	response regulator GlrR; Provisional; Region: PRK15115
529507009142	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
529507009143	active site
529507009144	phosphorylation site [posttranslational modification]
529507009145	intermolecular recognition site; other site
529507009146	dimerization interface [polypeptide binding]; other site
529507009147	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
529507009148	Walker A motif; other site
529507009149	ATP binding site [chemical binding]; other site
529507009150	Walker B motif; other site
529507009151	arginine finger; other site
529507009152	PS00688 Sigma-54 interaction domain C-terminal part signature.
529507009153	HMMPfam hit to PF00158, Sigma-54 interaction domain, score 2.3e-149
529507009154	PS00676 Sigma-54 interaction domain ATP-binding region B signature.
529507009155	PS00675 Sigma-54 interaction domain ATP-binding region A signature.
529507009156	HMMPfam hit to PF00072, Response regulator receiver domain, score 4.7e-44
529507009157	hypothetical protein; Provisional; Region: PRK10722
529507009158	Signal peptide predicted for PMI1873 by SignalP 2.0 HMM (Signal peptide probability 0.653) with cleavage site probability 0.541 between residues 35 and 36
529507009159	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507009160	Signal transduction histidine kinase [Signal transduction mechanisms]; Region: BaeS; COG0642
529507009161	HAMP domain; Region: HAMP; pfam00672
529507009162	Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via...; Region: HisKA; cd00082
529507009163	dimer interface [polypeptide binding]; other site
529507009164	phosphorylation site [posttranslational modification]
529507009165	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
529507009166	ATP binding site [chemical binding]; other site
529507009167	Mg2+ binding site [ion binding]; other site
529507009168	G-X-G motif; other site
529507009169	HMMPfam hit to PF02518, Histidine kinase-, DNA gyrase B-, and HSP90, score 5.2e-22
529507009170	HMMPfam hit to PF00512, His Kinase A (phosphoacceptor) domain, score 5.2e-18
529507009171	HMMPfam hit to PF00672, HAMP domain, score 4.5e-08
529507009172	2 probable transmembrane helices predicted for PMI1874 by TMHMM2.0 at aa 15-37 and 181-203
529507009173	Signal peptide predicted for PMI1874 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.848 between residues 33 and 34
529507009174	phosphoribosylformylglycinamidine synthase; Provisional; Region: PRK05297
529507009175	PurL subunit of the formylglycinamide ribonucleotide amidotransferase (FGAR-AT), first repeat. FGAR-AT catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to formylglycinamidine ribonucleotide (FGAM), ADP; Region: PurL_repeat1; cd02203
529507009176	dimerization interface [polypeptide binding]; other site
529507009177	ATP binding site [chemical binding]; other site
529507009178	PurL subunit of the formylglycinamide ribonucleotide amidotransferase (FGAR-AT), second repeat. FGAR-AT catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to formylglycinamidine ribonucleotide (FGAM), ADP; Region: PurL_repeat2; cd02204
529507009179	dimerization interface [polypeptide binding]; other site
529507009180	ATP binding site [chemical binding]; other site
529507009181	Type 1 glutamine amidotransferase (GATase1)-like domain found in Formylglycinamide ribonucleotide amidotransferase; Region: GATase1_FGAR_AT; cd01740
529507009182	putative active site [active]
529507009183	catalytic triad [active]
529507009184	HMMPfam hit to PF02769, AIR synthase related protein, C-terminal dom, score 1.5e-23
529507009185	HMMPfam hit to PF02769, AIR synthase related protein, C-terminal dom, score 4.8e-35
529507009186	HMMPfam hit to PF00586, AIR synthase related protein, N-terminal dom, score 1.7e-37
529507009187	membrane-bound lytic transglycosylase F; Provisional; Region: PRK10859
529507009188	Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of  substrates, such as, amino acids, peptides, sugars, vitamins and inorganic...; Region: PBPb; cd00134
529507009189	substrate binding pocket [chemical binding]; other site
529507009190	membrane-bound complex binding site; other site
529507009191	hinge residues; other site
529507009192	Lytic Transglycosylase (LT)  and Goose Egg White Lysozyme (GEWL) domain. Members include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as, the eukaryotic "goose-type" lysozymes (GEWL).  LTs...; Region: LT_GEWL; cd00254
529507009193	N-acetyl-D-glucosamine binding site [chemical binding]; other site
529507009194	catalytic residue [active]
529507009195	Signal peptide predicted for PMI1876 by SignalP 2.0 HMM (Signal peptide probability 0.975) with cleavage site probability 0.759 between residues 23 and 24
529507009196	1 probable transmembrane helix predicted for PMI1876 by TMHMM2.0 at aa 7-29
529507009197	HMMPfam hit to PF00497, Bacterial extracellular solute-binding prot, score 7.3e-17
529507009198	HMMPfam hit to PF01464, Transglycosylase SLT domain, score 5.6e-43
529507009199	PS00922 Prokaryotic transglycosylases signature.
529507009200	fimbrial operon 9 (pmf fimbrial operon)
529507009201	P pilus assembly protein, pilin FimA [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimA; COG3539
529507009202	Signal peptide predicted for PMI1877 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.956 between residues 22 and 23
529507009203	HMMPfam hit to PF00419, Fimbrial protein, score 6.5e-58
529507009204	putative fimbrial outer membrane usher protein StfC; Provisional; Region: PRK15284
529507009205	PapC N-terminal domain; Region: PapC_N; pfam13954
529507009206	Type VII secretion system (T7SS), usher protein; Region: Usher; pfam00577
529507009207	PapC C-terminal domain; Region: PapC_C; pfam13953
529507009208	Signal peptide predicted for PMI1878 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.939 between residues 28 and 29
529507009209	HMMPfam hit to PF00577, Fimbrial Usher protein, score 0
529507009210	PS01151 Fimbrial biogenesis outer membrane usher protein signature.
529507009211	P pilus assembly protein, chaperone PapD [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimC; COG3121
529507009212	Gram-negative pili assembly chaperone, N-terminal domain; Region: Pili_assembly_N; pfam00345
529507009213	Gram-negative pili assembly chaperone, C-terminal domain; Region: Pili_assembly_C; pfam02753
529507009214	Signal peptide predicted for PMI1879 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.937 between residues 26 and 27
529507009215	HMMPfam hit to PF00345, Gram-negative pili assembly chaperone, score 4.1e-46
529507009216	PS00635 Gram-negative pili assembly chaperone signature.
529507009217	HMMPfam hit to PF02753, Gram-negative pili assembly chaperone, score 7.5e-08
529507009218	Fimbrial protein; Region: Fimbrial; pfam00419
529507009219	Signal peptide predicted for PMI1880 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.895 between residues 30 and 31
529507009220	1 probable transmembrane helix predicted for PMI1880 by TMHMM2.0 at aa 12-34
529507009221	P pilus assembly protein, pilin FimA [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimA; COG3539
529507009222	Signal peptide predicted for PMI1881 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.994 between residues 22 and 23
529507009223	HMMPfam hit to PF00419, Fimbrial protein, score 6.5e-28
529507009224	Nucleoside deaminases include adenosine, guanine and cytosine deaminases. These enzymes are Zn dependent and catalyze the deamination of nucleosides. The zinc ion in the active site plays a central role in the proposed catalytic mechanism, activating a...; Region: nucleoside_deaminase; cd01285
529507009225	nucleoside/Zn binding site; other site
529507009226	dimer interface [polypeptide binding]; other site
529507009227	catalytic motif [active]
529507009228	HMMPfam hit to PF00383, Cytidine and deoxycytidylate deaminase, score 3.5e-41
529507009229	PS00903 Cytidine and deoxycytidylate deaminases zinc-binding region signature.
529507009230	4Fe-4S dicluster domain; Region: Fer4_7; pfam12838
529507009231	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 1.3e-05
529507009232	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
529507009233	4'-phosphopantetheinyl transferase; Provisional; Region: acpS; PRK00070
529507009234	HMMPfam hit to PF01648, 4'-phosphopantetheinyl transferase superfami, score 1.5e-21
529507009235	Pyridoxine 5'-phosphate (PNP) synthase domain; pyridoxal 5'-phosphate is the active form of vitamin B6 that acts as an essential, ubiquitous coenzyme in amino acid metabolism. In bacteria, formation of pyridoxine 5'-phosphate is a step in...; Region: PNPsynthase; cd00003
529507009236	active site
529507009237	hydrophilic channel; other site
529507009238	dimerization interface [polypeptide binding]; other site
529507009239	catalytic residues [active]
529507009240	active site lid [active]
529507009241	HMMPfam hit to PF03740, Pyridoxal phosphate biosynthesis protein Pdx, score 4.3e-148
529507009242	DNA repair protein RecO; Reviewed; Region: recO; PRK00085
529507009243	Recombination protein O N terminal; Region: RecO_N; pfam11967
529507009244	Recombination protein O C terminal; Region: RecO_C; pfam02565
529507009245	HMMPfam hit to PF02565, Recombination protein O, score 1.2e-74
529507009246	GTPase Era; Reviewed; Region: era; PRK00089
529507009247	E. coli Ras-like protein (Era) is a multifunctional GTPase; Region: Era; cd04163
529507009248	G1 box; other site
529507009249	GTP/Mg2+ binding site [chemical binding]; other site
529507009250	Switch I region; other site
529507009251	G2 box; other site
529507009252	Switch II region; other site
529507009253	G3 box; other site
529507009254	G4 box; other site
529507009255	G5 box; other site
529507009256	KH domain; Region: KH_2; pfam07650
529507009257	HMMPfam hit to PF07650, KH domain, score 2.1e-25
529507009258	HMMPfam hit to PF01926, GTPase of unknown function, score 6.5e-38
529507009259	PS00017 ATP/GTP-binding site motif A (P-loop).
529507009260	ribonuclease III; Reviewed; Region: rnc; PRK00102
529507009261	RIBOc. Ribonuclease III C terminal domain. This group consists of eukaryotic, bacterial and archeal ribonuclease III (RNAse III) proteins. RNAse III is a double stranded RNA-specific endonuclease. Prokaryotic RNAse III is important in...; Region: RIBOc; cd00593
529507009262	dimerization interface [polypeptide binding]; other site
529507009263	active site
529507009264	metal binding site [ion binding]; metal-binding site
529507009265	Double-stranded RNA binding motif. Binding is not sequence specific but is highly specific for double stranded RNA. Found in a variety of proteins including dsRNA dependent protein kinase PKR, RNA helicases, Drosophila staufen protein, E. coli RNase III; Region: DSRM; cd00048
529507009266	dsRNA binding site [nucleotide binding]; other site
529507009267	HMMPfam hit to PF00035, Double-stranded RNA binding motif, score 6.2e-23
529507009268	HMMPfam hit to PF00636, RNase3 domain, score 4.4e-44
529507009269	PS00517 Ribonuclease III family signature.
529507009270	signal peptidase I; Provisional; Region: PRK10861
529507009271	The S26 Type I signal peptidase (SPase; LepB; leader peptidase B; leader peptidase I; EC 3.4.21.89) family members are essential membrane-bound serine proteases that function to cleave the amino-terminal signal peptide extension from proteins that are...; Region: S26_SPase_I; cd06530
529507009272	Catalytic site [active]
529507009273	The S26 Type I signal peptidase (SPase; LepB; leader peptidase B; leader peptidase I; EC 3.4.21.89) family members are essential membrane-bound serine proteases that function to cleave the amino-terminal signal peptide extension from proteins that are...; Region: S26_SPase_I; cd06530
529507009274	PS00761 Signal peptidases I signature 3.
529507009275	HMMPfam hit to PF00717, Peptidase S24-like, score 1e-24
529507009276	PS00760 Signal peptidases I lysine active site.
529507009277	PS00501 Signal peptidases I serine active site.
529507009278	2 probable transmembrane helices predicted for PMI1889 by TMHMM2.0 at aa 5-22 and 60-82
529507009279	GTP-binding protein LepA; Provisional; Region: PRK05433
529507009280	LepA also known as Elongation Factor 4 (EF4); Region: LepA; cd01890
529507009281	G1 box; other site
529507009282	putative GEF interaction site [polypeptide binding]; other site
529507009283	GTP/Mg2+ binding site [chemical binding]; other site
529507009284	Switch I region; other site
529507009285	G2 box; other site
529507009286	G3 box; other site
529507009287	Switch II region; other site
529507009288	G4 box; other site
529507009289	G5 box; other site
529507009290	lepA_II: This subfamily represents the domain II of LepA, a GTP-binding protein localized in the cytoplasmic membrane. The N-terminal domain of LepA shares regions of homology to translation factors. In terms of interaction with the ribosome, EF-G, EF-Tu...; Region: lepA_II; cd03699
529507009291	lepA_C: This family represents the C-terminal region of LepA, a GTP-binding protein localized in the cytoplasmic membrane.   LepA is ubiquitous in Bacteria and Eukaryota (e.g. Saccharomyces cerevisiae GUF1p), but is missing from Archaea. LepA exhibits...; Region: lepA_C; cd03709
529507009292	GTP-binding protein LepA C-terminus; Region: LepA_C; pfam06421
529507009293	HMMPfam hit to PF06421, GTP-binding protein LepA C-terminus, score 2.7e-80
529507009294	HMMPfam hit to PF00679, Elongation factor G C-terminus, score 2.6e-31
529507009295	HMMPfam hit to PF03144, Elongation factor Tu domain, score 8e-08
529507009296	HMMPfam hit to PF00009, Elongation factor Tu GTP binding domain, score 1.9e-71
529507009297	PS00301 GTP-binding elongation factors signature.
529507009298	PS00017 ATP/GTP-binding site motif A (P-loop).
529507009299	SoxR reducing system protein RseC; Provisional; Region: PRK10862
529507009300	HMMPfam hit to PF04246, Positive regulator of sigma(E), RseC/MucC, score 7.1e-41
529507009301	2 probable transmembrane helices predicted for PMI1891 by TMHMM2.0 at aa 78-100 and 104-121
529507009302	anti-sigma E factor; Provisional; Region: rseB; PRK09455
529507009303	Negative regulator of sigma E activity [Signal transduction mechanisms]; Region: RseB; COG3026
529507009304	HMMPfam hit to PF03888, MucB/RseB family, score 2.1e-93
529507009305	1 probable transmembrane helix predicted for PMI1892 by TMHMM2.0 at aa 20-42
529507009306	anti-RNA polymerase sigma factor SigE; Provisional; Region: PRK10863
529507009307	Anti sigma-E protein RseA, N-terminal domain; Region: RseA_N; pfam03872
529507009308	Anti sigma-E protein RseA, C-terminal domain; Region: RseA_C; pfam03873
529507009309	HMMPfam hit to PF03873, Anti sigma-E protein RseA, C-terminal domain, score 0.00032
529507009310	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507009311	HMMPfam hit to PF03872, Anti sigma-E protein RseA, N-terminal domain, score 5.5e-34
529507009312	RNA polymerase sigma factor AlgU; Provisional; Region: algU; PRK11923
529507009313	Sigma-70 region 2; Region: Sigma70_r2; pfam04542
529507009314	Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs). A SF is a dissociable subunit of RNA polymerase, it directs bacterial or...; Region: Sigma70_r4; cd06171
529507009315	DNA binding residues [nucleotide binding]
529507009316	HMMPfam hit to PF04545, Sigma-70, region, score 4.1e-14
529507009317	Predicted helix-turn-helix motif with score 1031.000, SD 2.70 at aa 154-175, sequence LSYEEIAVIMDCPVGTVRSRIF
529507009318	HMMPfam hit to PF04542, Sigma-70 region, score 2.3e-20
529507009319	PS01063 Sigma-70 factors ECF subfamily signature.
529507009320	2 probable transmembrane helices predicted for PMI1895 by TMHMM2.0 at aa 5-27 and 50-72
529507009321	Predicted O-methyltransferase [General function prediction only]; Region: COG4123
529507009322	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
529507009323	S-adenosylmethionine binding site [chemical binding]; other site
529507009324	PS00092 N-6 Adenine-specific DNA methylases signature.
529507009325	ATP-dependent RNA helicase SrmB; Provisional; Region: PRK11192
529507009326	DEAD-box helicases. A diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker  B motif; Region: DEADc; cd00268
529507009327	ATP binding site [chemical binding]; other site
529507009328	Mg++ binding site [ion binding]; other site
529507009329	motif III; other site
529507009330	Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may...; Region: HELICc; cd00079
529507009331	nucleotide binding region [chemical binding]; other site
529507009332	ATP-binding site [chemical binding]; other site
529507009333	HMMPfam hit to PF00270, DEAD/DEAH box helicase, score 1.8e-68
529507009334	PS00017 ATP/GTP-binding site motif A (P-loop).
529507009335	PS00039 DEAD-box subfamily ATP-dependent helicases signature.
529507009336	HMMPfam hit to PF00271, Helicase conserved C-terminal domain, score 9.9e-31
529507009337	autonomous glycyl radical cofactor GrcA; Provisional; Region: PRK11127
529507009338	HMMPfam hit to PF01228, Glycine radical, score 3.4e-40
529507009339	PS00850 Glycine radical signature.
529507009340	Family 1 of Uracil-DNA glycosylase (UDG) enzymes; Region: UDG_F1; cd10027
529507009341	ligand binding site [chemical binding]; other site
529507009342	active site
529507009343	UGI interface [polypeptide binding]; other site
529507009344	catalytic site [active]
529507009345	HMMPfam hit to PF03167, Uracil DNA glycosylase superfamily, score 4e-83
529507009346	GrpE; Region: GrpE; pfam01025
529507009347	GrpE is the adenine nucleotide exchange factor of DnaK (Hsp70)-type ATPases. The GrpE dimer binds to the ATPase domain of Hsp70 catalyzing the dissociation of ADP, which enables rebinding of ATP, one step in the Hsp70 reaction cycle in protein folding; Region: GrpE; cd00446
529507009348	dimer interface [polypeptide binding]; other site
529507009349	hsp70 (ATPase domain) interactions [polypeptide binding]; other site
529507009350	HMMPfam hit to PF01025, GrpE, score 3.3e-67
529507009351	PS01071 grpE protein signature.
529507009352	inorganic polyphosphate/ATP-NAD kinase; Provisional; Region: ppnK; PRK03378
529507009353	inorganic polyphosphate/ATP-NAD kinase; Provisional; Region: ppnK; PRK02231
529507009354	HMMPfam hit to PF01513, ATP-NAD kinase, score 3.5e-101
529507009355	recombination and repair protein; Provisional; Region: PRK10869
529507009356	ATP-binding cassette domain of RecN; Region: ABC_RecN; cd03241
529507009357	Walker A/P-loop; other site
529507009358	ATP binding site [chemical binding]; other site
529507009359	Q-loop/lid; other site
529507009360	ATP-binding cassette domain of RecN; Region: ABC_RecN; cd03241
529507009361	ABC transporter signature motif; other site
529507009362	Walker B; other site
529507009363	D-loop; other site
529507009364	H-loop/switch region; other site
529507009365	PS00017 ATP/GTP-binding site motif A (P-loop).
529507009366	outer membrane biogenesis protein BamE; Provisional; Region: PRK11548
529507009367	SmpA / OmlA family; Region: SmpA_OmlA; pfam04355
529507009368	Signal peptide predicted for PMI1903 by SignalP 2.0 HMM (Signal peptide probability 0.819) with cleavage site probability 0.521 between residues 22 and 23
529507009369	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507009370	HMMPfam hit to PF04355, SmpA / OmlA family, score 5e-35
529507009371	PS00018 EF-hand calcium-binding domain.
529507009372	hypothetical protein; Validated; Region: PRK01777
529507009373	HMMPfam hit to PF03658, Uncharacterised protein family (UPF0125), score 3e-48
529507009374	Coenzyme Q-binding protein COQ10p and similar proteins; Region: COQ10p_like; cd07813
529507009375	putative coenzyme Q binding site [chemical binding]; other site
529507009376	HMMPfam hit to PF03364, Streptomyces cyclase/dehydrase, score 1.7e-36
529507009377	Small protein B (SmpB) is a component of the trans-translation system in prokaryotes for releasing stalled ribosome from damaged messenger RNAs; Region: SmpB; cd09294
529507009378	SmpB-tmRNA interface; other site
529507009379	HMMPfam hit to PF01668, SmpB protein, score 1.5e-42
529507009380	PS01317 Protein smpB signature.
529507009381	S-type Pyocin; Region: Pyocin_S; pfam06958
529507009382	Colicin pore forming domain; Region: Colicin; pfam01024
529507009383	HMMPfam hit to PF01024, Colicin pore forming domain, score 1.8e-78
529507009384	2 probable transmembrane helices predicted for PMI1908 by TMHMM2.0 at aa 504-526 and 528-550
529507009385	PS00017 ATP/GTP-binding site motif A (P-loop).
529507009386	HMMPfam hit to PF06958, S-type Pyocin, score 0.00027
529507009387	PS00387 Inorganic pyrophosphatase signature.
529507009388	Colicin-E5 Imm protein; Region: ImmE5; pfam11480
529507009389	S-type Pyocin; Region: Pyocin_S; pfam06958
529507009390	Colicin C terminal ribonuclease domain; Region: Colicin_C; pfam12106
529507009391	PS00017 ATP/GTP-binding site motif A (P-loop).
529507009392	FtsK/SpoIIIE family; Region: FtsK_SpoIIIE; pfam01580
529507009393	Ftsk gamma domain; Region: Ftsk_gamma; pfam09397
529507009394	HMMPfam hit to PF01580, FtsK/SpoIIIE family, score 5.3e-34
529507009395	PS00017 ATP/GTP-binding site motif A (P-loop).
529507009396	Partial CDS. Similar to the C-terminal region of HsdR.; type I restriction-modification system, specificity determinant subunit (fragment)
529507009397	Partial CDS. Similar to the N-terminal region of HsdM.; type I restriction-modification system, DNA methyltransferase (fragment)
529507009398	HMMPfam hit to PF02506, Type I restriction modification system, M, score 3.8e-07
529507009399	3 probable transmembrane helices predicted for PMI1915 by TMHMM2.0 at aa 20-39, 52-73 and 83-105
529507009400	PD-(D/E)XK nuclease superfamily; Region: PDDEXK_4; pfam14281
529507009401	This CDS appears to have a frameshift mutation following codon 87; conserved hypothetical protein (pseudogene)
529507009402	PS00017 ATP/GTP-binding site motif A (P-loop).
529507009403	Signal peptide predicted for PMI1920 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.999 between residues 20 and 21
529507009404	Signal peptide predicted for PMI1921 by SignalP 2.0 HMM (Signal peptide probability 0.983) with cleavage site probability 0.720 between residues 23 and 24
529507009405	Protein of unknown function (DUF1120); Region: DUF1120; cl05856
529507009406	Signal peptide predicted for PMI1922 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 1.000 between residues 20 and 21
529507009407	Signal peptide predicted for PMI1923 by SignalP 2.0 HMM (Signal peptide probability 0.983) with cleavage site probability 0.722 between residues 23 and 24
529507009408	Signal peptide predicted for PMI1924 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 1.000 between residues 20 and 21
529507009409	FOG: TPR repeat, SEL1 subfamily [General function prediction only]; Region: COG0790
529507009410	Sel1-like repeats; Region: SEL1; smart00671
529507009411	Signal peptide predicted for PMI1926 by SignalP 2.0 HMM (Signal peptide probability 0.996) with cleavage site probability 0.704 between residues 32 and 33
529507009412	P pilus assembly protein, pilin FimA [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimA; COG3539
529507009413	Signal peptide predicted for PMI1929 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 1.000 between residues 20 and 21
529507009414	Cupin domain; Region: Cupin_2; pfam07883
529507009415	malate:quinone oxidoreductase; Validated; Region: PRK05257
529507009416	malate:quinone-oxidoreductase; Region: mal_quin_oxido; TIGR01320
529507009417	HMMPfam hit to PF06039, Malate:quinone oxidoreductase (Mqo), score 4.7e-303
529507009418	Membrane transport protein; Region: Mem_trans; cl09117
529507009419	10 probable transmembrane helices predicted for PMI1932 by TMHMM2.0 at aa 5-24, 36-58, 68-90, 102-121, 126-148, 160-182, 197-216, 223-245, 255-274 and 281-303
529507009420	HMMPfam hit to PF03547, Auxin Efflux Carrier, score 6.8e-12
529507009421	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
529507009422	Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction; Region: HP_PGM_like; cd07067
529507009423	catalytic core [active]
529507009424	1 probable transmembrane helix predicted for PMI1933 by TMHMM2.0 at aa 13-32
529507009425	Signal peptide predicted for PMI1933 by SignalP 2.0 HMM (Signal peptide probability 0.971) with cleavage site probability 0.618 between residues 19 and 20
529507009426	Putative NADPH-quinone reductase (modulator of drug activity B) [General function prediction only]; Region: MdaB; COG2249
529507009427	HMMPfam hit to PF02525, Flavodoxin-like fold, score 6.7e-62
529507009428	L-lactate permease [Energy production and conversion]; Region: LldP; COG1620
529507009429	L-lactate permease; Region: Lactate_perm; cl00701
529507009430	13 probable transmembrane helices predicted for PMI1935 by TMHMM2.0 at aa 5-22, 27-49, 56-78, 118-140, 147-169, 184-206, 213-235, 239-256, 277-299, 334-356, 369-391, 395-417 and 488-507
529507009431	HMMPfam hit to PF02652, L-lactate permease, score 1.2e-131
529507009432	PS00030 Eukaryotic RNA-binding region RNP-1 signature.
529507009433	Fe-S oxidoreductase [Energy production and conversion]; Region: GlpC; COG0247
529507009434	Cysteine-rich domain; Region: CCG; pfam02754
529507009435	Cysteine-rich domain; Region: CCG; pfam02754
529507009436	HMMPfam hit to PF02754, Cysteine-rich domain, score 1.7e-13
529507009437	HMMPfam hit to PF02754, Cysteine-rich domain, score 4.2e-14
529507009438	Uncharacterized conserved protein containing a ferredoxin-like domain [Energy production and conversion]; Region: COG1139
529507009439	Uncharacterized ACR, YkgG family COG1556; Region: DUF162; pfam02589
529507009440	The HCP family of iron-sulfur proteins includes hybrid cluster protein (HCP), acetyl-CoA synthase (ACS), and carbon monoxide dehydrogenase (CODH), all of which contain [Fe4-S4] metal clusters at their active sites. These proteins have a conserved...; Region: HCP_like; cl14655
529507009441	Domain of unknown function (DUF3390); Region: DUF3390; pfam11870
529507009442	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
529507009443	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 0.0097
529507009444	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
529507009445	Uncharacterized conserved protein [Function unknown]; Region: COG1556
529507009446	HMMPfam hit to PF02589, Uncharacterized ACR, YkgG family COG1556, score 9.5e-64
529507009447	Protein of unknown function (DUF1311); Region: DUF1311; pfam07007
529507009448	1 probable transmembrane helix predicted for PMI1939 by TMHMM2.0 at aa 7-29
529507009449	Signal peptide predicted for PMI1939 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.996 between residues 24 and 25
529507009450	Protein of unknown function, DUF486; Region: DUF486; cl01236
529507009451	HMMPfam hit to PF04342, Protein of unknown function, DUF486, score 1.1e-47
529507009452	4 probable transmembrane helices predicted for PMI1940 by TMHMM2.0 at aa 10-29, 36-57, 72-91 and 96-113
529507009453	Predicted Fe-S-cluster oxidoreductase [General function prediction only]; Region: COG0727
529507009454	HMMPfam hit to PF03692, Uncharacterised protein family (UPF0153), score 1.1e-19
529507009455	Domain of unknown function (DUF1287); Region: DUF1287; pfam06940
529507009456	HMMPfam hit to PF06940, Protein of unknown function (DUF1287), score 6.5e-89
529507009457	Signal peptide predicted for PMI1942 by SignalP 2.0 HMM (Signal peptide probability 0.958) with cleavage site probability 0.909 between residues 29 and 30
529507009458	putative MFS family transporter protein; Provisional; Region: PRK03633
529507009459	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507009460	putative substrate translocation pore; other site
529507009461	12 probable transmembrane helices predicted for PMI1943 by TMHMM2.0 at aa 21-43, 53-72, 85-107, 111-133, 145-167, 172-191, 212-234, 249-271, 276-295, 299-321, 328-350 and 365-387
529507009462	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 1e-25
529507009463	Predicted hydrolase of the alpha/beta superfamily [General function prediction only]; Region: COG2819
529507009464	Putative esterase; Region: Esterase; pfam00756
529507009465	Signal peptide predicted for PMI1944 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.999 between residues 18 and 19
529507009466	putative iron-regulated outer membrane virulence protein; Provisional; Region: PRK13484
529507009467	TonB dependent/Ligand-Gated channels are created by a monomeric 22 strand (22,24) anti-parallel beta-barrel. Ligands apparently bind to the large extracellular loops. The N-terminal 150-200 residues form a plug from the periplasmic end of barrel; Region: ligand_gated_channel; cd01347
529507009468	N-terminal plug; other site
529507009469	ligand-binding site [chemical binding]; other site
529507009470	HMMPfam hit to PF00593, TonB dependent receptor, score 2.3e-29
529507009471	HMMPfam hit to PF07715, TonB-dependent Receptor Plug Domain, score 7.8e-27
529507009472	Signal peptide predicted for PMI1945 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.993 between residues 21 and 22
529507009473	Vibrio parahaemolyticus Na(+)/galactose cotransporter (vSGLT) and related proteins; solute binding domain; Region: SLC5sbd_vSGLT; cd10325
529507009474	putative transporter; Provisional; Region: PRK10484
529507009475	Na binding site [ion binding]; other site
529507009476	substrate binding site [chemical binding]; other site
529507009477	14 probable transmembrane helices predicted for PMI1946 by TMHMM2.0 at aa 10-32, 45-67, 77-99, 131-153, 163-185, 192-214, 245-267, 288-310, 356-378, 399-421, 431-449, 456-478, 483-502 and 523-542
529507009478	HMMPfam hit to PF00474, Sodium:solute symporter family, score 3.8e-60
529507009479	DNA-binding transcriptional regulator GalR; Provisional; Region: PRK10727
529507009480	Helix-turn-helix (HTH) DNA binding domain of the LacI family of transcriptional regulators; Region: HTH_LacI; cd01392
529507009481	DNA binding site [nucleotide binding]
529507009482	domain linker motif; other site
529507009483	Ligand binding domain of DNA transcription iso-repressor GalS, which is one of two regulatory proteins involved in galactose transport and metabolism; Region: PBP1_GalS_like; cd06270
529507009484	dimerization interface (closed form) [polypeptide binding]; other site
529507009485	ligand binding site [chemical binding]; other site
529507009486	HMMPfam hit to PF00532, Periplasmic binding proteins and sugar b, score 7.2e-15
529507009487	HMMPfam hit to PF00356, Bacterial regulatory proteins, lacI fami, score 5.2e-14
529507009488	Predicted helix-turn-helix motif with score 2188.000, SD 6.64 at aa 4-25, sequence ATIKDVAKEAGVSVATVSRVIN
529507009489	PS00356 Bacterial regulatory proteins, lacI family signature.
529507009490	galactose mutarotase_like; Region: galactose_mutarotase_like; cd09019
529507009491	active site
529507009492	catalytic residues [active]
529507009493	HMMPfam hit to PF01263, Aldose 1-epimerase, score 1e-114
529507009494	PS00545 Aldose 1-epimerase active site.
529507009495	galactokinase; Provisional; Region: PRK05101
529507009496	Galactokinase galactose-binding signature; Region: GalKase_gal_bdg; pfam10509
529507009497	GHMP kinases N terminal domain; Region: GHMP_kinases_N; pfam00288
529507009498	HMMPfam hit to PF00288, GHMP kinases ATP-binding protei, score 3.5e-51
529507009499	PS00627 GHMP kinases ATP-binding domain.
529507009500	PS00106 Galactokinase signature.
529507009501	galactose-1-phosphate uridylyltransferase; Provisional; Region: PRK11720
529507009502	Galactose-1-phosphate uridyl transferase (GalT): This enzyme plays a key role in galactose metabolism by catalysing the transfer of a uridine 5'-phosphoryl group from UDP-galactose 1-phosphate. The structure of E.coli GalT reveals that the enzyme...; Region: GalT; cd00608
529507009503	dimer interface [polypeptide binding]; other site
529507009504	active site
529507009505	HMMPfam hit to PF02744, Galactose-1-phosphate uridyl transfer, score 3.2e-85
529507009506	HMMPfam hit to PF01087, Galactose-1-phosphate uridyl transfer, score 5e-88
529507009507	PS00117 Galactose-1-phosphate uridyl transferase family 1 active site signature.
529507009508	UDP-glucose 4-epimerase; Region: PLN02240
529507009509	UDP-glucose 4 epimerase, subgroup 1, extended (e) SDRs; Region: UDP_G4E_1_SDR_e; cd05247
529507009510	NAD binding site [chemical binding]; other site
529507009511	homodimer interface [polypeptide binding]; other site
529507009512	active site
529507009513	substrate binding site [chemical binding]; other site
529507009514	HMMPfam hit to PF01370, NAD dependent epimerase/dehydratase family, score 3.9e-157
529507009515	bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional; Region: PRK15409
529507009516	D-glycerate dehydrogenase/hydroxypyruvate reductase (GDH); Region: GDH; cd05301
529507009517	dimerization interface [polypeptide binding]; other site
529507009518	ligand binding site [chemical binding]; other site
529507009519	NADP binding site [chemical binding]; other site
529507009520	catalytic site [active]
529507009521	HMMPfam hit to PF00389, D-isomer specific 2-hydroxyacid dehydrog, score 5e-14
529507009522	HMMPfam hit to PF02826, D-isomer specific 2-hydroxyacid dehydrog, score 1.3e-74
529507009523	PS00065 D-isomer specific 2-hydroxyacid dehydrogenases NAD-binding signature.
529507009524	PS00671 D-isomer specific 2-hydroxyacid dehydrogenases signature 3.
529507009525	Predicted Co/Zn/Cd cation transporters [Inorganic ion transport and metabolism]; Region: MMT1; COG0053
529507009526	cation diffusion facilitator family transporter; Region: CDF; TIGR01297
529507009527	HMMPfam hit to PF01545, Cation efflux family, score 1.9e-76
529507009528	4 probable transmembrane helices predicted for PMI1953 by TMHMM2.0 at aa 30-49, 97-119, 132-154 and 185-207
529507009529	Usp: Universal stress protein family. The universal stress protein Usp is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. Usp enhances the rate of cell survival during prolonged exposure to...; Region: USP_Like; cd00293
529507009530	Ligand Binding Site [chemical binding]; other site
529507009531	HMMPfam hit to PF00582, Universal stress protein family, score 1.6e-14
529507009532	Protease Inhibitor Ecotin; homodimeric protease inhibitor; Region: Ecotin; cl00178
529507009533	secondary substrate binding site; other site
529507009534	primary substrate binding site; other site
529507009535	inhibition loop; other site
529507009536	dimerization interface [polypeptide binding]; other site
529507009537	HMMPfam hit to PF03974, Ecotin, score 2.8e-60
529507009538	Signal peptide predicted for PMI1955 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.663 between residues 21 and 22
529507009539	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507009540	Protein of unknown function (DUF465); Region: DUF465; cl01070
529507009541	HMMPfam hit to PF04325, Protein of unknown function (DUF465), score 9.7e-12
529507009542	probable metal-binding protein; Region: matur_matur; TIGR03853
529507009543	PS00142 Neutral zinc metallopeptidases, zinc-binding region signature.
529507009544	DinI-like family; Region: DinI; cl11630
529507009545	HMMPfam hit to PF06183, DinI-like family, score 3.1e-10
529507009546	Nitrous oxide-stimulated promoter; Region: YgbA_NO; pfam11756
529507009547	Acetyltransferase (GNAT) domain; Region: Acetyltransf_3; pfam13302
529507009548	Acetyltransferase (GNAT) family; Region: Acetyltransf_1; pfam00583
529507009549	HMMPfam hit to PF00583, Acetyltransferase (GNAT) family, score 1.9e-12
529507009550	Integral membrane protein CcmA involved in cell shape determination [Cell envelope biogenesis, outer membrane]; Region: CcmA; COG1664
529507009551	Polymer-forming cytoskeletal; Region: Bactofilin; pfam04519
529507009552	HMMPfam hit to PF04519, Protein of unknown function, DUF583, score 3.3e-49
529507009553	2 probable transmembrane helices predicted for PMI1961 by TMHMM2.0 at aa 12-31 and 35-52
529507009554	helix_turn_helix, arabinose operon control protein; Region: HTH_ARAC; smart00342
529507009555	Bacterial regulatory helix-turn-helix proteins, AraC family; Region: HTH_AraC; pfam00165
529507009556	HMMPfam hit to PF00165, Bacterial regulatory helix-turn-helix protei, score 0.0021
529507009557	Predicted helix-turn-helix motif with score 1183.000, SD 3.22 at aa 190-211, sequence WKLKQFAREFGMGLTTFKELFN
529507009558	HMMPfam hit to PF00165, Bacterial regulatory helix-turn-helix protei, score 3e-11
529507009559	FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones]; Region: FkpA; COG0545
529507009560	HMMPfam hit to PF00254, FKBP-type peptidyl-prolyl cis-trans isomeras, score 0.0015
529507009561	Signal peptide predicted for PMI1964 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.959 between residues 20 and 21
529507009562	Signal peptide predicted for PMI1965 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.572 between residues 31 and 32
529507009563	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507009564	NADPH-dependent FMN reductase; Region: FMN_red; pfam03358
529507009565	Predicted flavoprotein [General function prediction only]; Region: COG0431
529507009566	HMMPfam hit to PF03358, NADPH-dependent FMN reductase, score 6e-18
529507009567	2 probable transmembrane helices predicted for PMI1969 by TMHMM2.0 at aa 5-24 and 37-56
529507009568	DNA-binding transcriptional regulator; Provisional; Region: PRK09678
529507009569	Ogr/Delta-like zinc finger; Region: Ogr_Delta; pfam04606
529507009570	HMMPfam hit to PF04606, Phage transcriptional activator, Ogr/Delta, score 1.9e-32
529507009571	prophage
529507009572	tail protein; Provisional; Region: D; PHA02561
529507009573	HMMPfam hit to PF05954, Phage late control gene D protein (GPD), score 2e-167
529507009574	Phage protein U [General function prediction only]; Region: COG3499
529507009575	HMMPfam hit to PF06995, Phage P2 GpU, score 7.6e-65
529507009576	phage tail tape measure protein, TP901 family, core region; Region: tape_meas_TP901; TIGR01760
529507009577	HMMPfam hit to PF05017, TMP repeat, score 98
529507009578	HMMPfam hit to PF05017, TMP repeat, score 4.1
529507009579	HMMPfam hit to PF05017, TMP repeat, score 30
529507009580	HMMPfam hit to PF05017, TMP repeat, score 6
529507009581	HMMPfam hit to PF05017, TMP repeat, score 1.6e+02
529507009582	HMMPfam hit to PF05017, TMP repeat, score 35
529507009583	HMMPfam hit to PF05017, TMP repeat, score 27
529507009584	3 probable transmembrane helices predicted for PMI1973 by TMHMM2.0 at aa 535-557, 564-586 and 601-623
529507009585	Mu-like prophage FluMu protein gp41; Region: FluMu_gp41; pfam10109
529507009586	HMMPfam hit to PF06158, Phage tail protein E, score 1.6e-38
529507009587	major tail tube protein; Provisional; Region: FII; PHA02600
529507009588	HMMPfam hit to PF04985, Phage tail tube protein FII, score 4.3e-103
529507009589	major tail sheath protein; Provisional; Region: FI; PHA02560
529507009590	HMMPfam hit to PF04984, Phage tail sheath protein, score 3.3e-167
529507009591	PS00017 ATP/GTP-binding site motif A (P-loop).
529507009592	Phage tail-collar fibre protein; Region: DUF3751; pfam12571
529507009593	Signal peptide predicted for PMI1977 by SignalP 2.0 HMM (Signal peptide probability 0.832) with cleavage site probability 0.272 between residues 18 and 19
529507009594	Bacteriophage P2-related tail formation protein [General function prediction only]; Region: gpI; COG4385
529507009595	baseplate assembly protein; Provisional; Region: J; PHA02568
529507009596	HMMPfam hit to PF04865, Baseplate J-like protein, score 5.5e-100
529507009597	Gene 25-like lysozyme; Region: GPW_gp25; cl01403
529507009598	HMMPfam hit to PF04965, GPW / gp25 family, score 1.9e-36
529507009599	phage baseplate assembly protein V; Region: phage_P2_V; TIGR01644
529507009600	Phage P2 baseplate assembly protein gpV [General function prediction only]; Region: gpV; COG4540
529507009601	HMMPfam hit to PF04717, Phage-related baseplate assembly protein, score 1.6e-41
529507009602	Phage virion morphogenesis family; Region: Phage_tail_S; pfam05069
529507009603	HMMPfam hit to PF05069, Phage virion morphogenesis family, score 6.9e-15
529507009604	P2 phage tail completion protein R (GpR); Region: P2_Phage_GpR; pfam06891
529507009605	HMMPfam hit to PF06891, P2 phage tail completion protein R (GpR), score 1.7e-49
529507009606	Bacteriophage lysis protein; Region: Phage_lysis; pfam03245
529507009607	HMMPfam hit to PF03245, Bacteriophage lysis protein, score 1.1e-08
529507009608	1 probable transmembrane helix predicted for PMI1984 by TMHMM2.0 at aa 5-27
529507009609	Signal peptide predicted for PMI1984 by SignalP 2.0 HMM (Signal peptide probability 0.737) with cleavage site probability 0.343 between residues 24 and 25
529507009610	D-alanyl-D-alanine carboxypeptidase; Region: Peptidase_M15_4; pfam13539
529507009611	3 probable transmembrane helices predicted for PMI1986 by TMHMM2.0 at aa 15-37, 42-64 and 74-93
529507009612	Signal peptide predicted for PMI1986 by SignalP 2.0 HMM (Signal peptide probability 0.983) with cleavage site probability 0.572 between residues 33 and 34
529507009613	Phage Tail Protein X; Region: Phage_tail_X; cl02088
529507009614	HMMPfam hit to PF05489, Phage Tail Protein X, score 1.3e-27
529507009615	Phage head completion protein (GPL); Region: Phage_GPL; pfam05926
529507009616	HMMPfam hit to PF05926, Phage head completion protein (GPL), score 1.6e-64
529507009617	terminase endonuclease subunit; Provisional; Region: M; PHA02537
529507009618	Phage small terminase subunit; Region: Phage_term_smal; pfam05944
529507009619	HMMPfam hit to PF05944, Phage small terminase subunit, score 1.4e-62
529507009620	capsid protein; Provisional; Region: N; PHA02538
529507009621	HMMPfam hit to PF05125, Phage major capsid protein, P2 family, score 1.1e-183
529507009622	Phage capsid scaffolding protein (GPO) serine peptidase; Region: Phage_GPO; cl15838
529507009623	HMMPfam hit to PF05929, Phage capsid scaffolding protein (GPO), score 2.5e-119
529507009624	terminase ATPase subunit; Provisional; Region: P; PHA02535
529507009625	Putative ATPase subunit of terminase (gpP-like); Region: Terminase_5; pfam06056
529507009626	HMMPfam hit to PF06056, ATPase subunit of terminase (gpP, score 0
529507009627	Predicted helix-turn-helix motif with score 1344.000, SD 3.76 at aa 21-42, sequence YRIARIAESLGEKASTIHSWKR
529507009628	portal vertex protein; Provisional; Region: Q; PHA02536
529507009629	Phage portal protein; Region: Phage_portal; pfam04860
529507009630	HMMPfam hit to PF04860, Phage portal protein, score 9e-81
529507009631	Predicted transcriptional regulators [Transcription]; Region: HipB; COG1396
529507009632	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
529507009633	non-specific DNA binding site [nucleotide binding]; other site
529507009634	salt bridge; other site
529507009635	sequence-specific DNA binding site [nucleotide binding]; other site
529507009636	Domain of unknown function (DUF955); Region: DUF955; cl01076
529507009637	HMMPfam hit to PF06114, Domain of unknown function (DUF955), score 3.4e-14
529507009638	HMMPfam hit to PF01381, Helix-turn-helix, score 1.9e-08
529507009639	Predicted helix-turn-helix motif with score 1744.000, SD 5.13 at aa 16-37, sequence LSLEQVAERVGKTRQYIQRLES
529507009640	2 probable transmembrane helices predicted for PMI1996 by TMHMM2.0 at aa 5-22 and 37-56
529507009641	Bacteriophage replication gene A protein (GPA); Region: Phage_GPA; pfam05840
529507009642	HMMPfam hit to PF05840, Bacteriophage replication gene A protein (G, score 7.1e-189
529507009643	D12 class N6 adenine-specific DNA methyltransferase; Region: MethyltransfD12; cl17344
529507009644	HMMPfam hit to PF02086, D12 class N6 adenine-specific DNA met, score 9.7e-65
529507009645	PS00092 N-6 Adenine-specific DNA methylases signature.
529507009646	DksA-like zinc finger domain containing protein; Region: PHA00080
529507009647	HMMPfam hit to PF01258, Prokaryotic dksA/traR C4-type zinc finge, score 1.6e-16
529507009648	Protein of unknown function (DUF2732); Region: DUF2732; pfam10809
529507009649	1 probable transmembrane helix predicted for PMI2003 by TMHMM2.0 at aa 31-48
529507009650	Regulatory phage protein cox; Region: Phage_Cox; pfam10743
529507009651	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
529507009652	non-specific DNA binding site [nucleotide binding]; other site
529507009653	salt bridge; other site
529507009654	sequence-specific DNA binding site [nucleotide binding]; other site
529507009655	integrase; Provisional; Region: int; PHA02601
529507009656	DNA breaking-rejoining enzymes, C-terminal catalytic domain. The DNA breaking-rejoining enzyme superfamily includes type IB topoisomerases and tyrosine recombinases that share the same fold in their catalytic domain containing six conserved active site...; Region: DNA_BRE_C; cl00213
529507009657	active site
529507009658	DNA binding site [nucleotide binding]
529507009659	Int/Topo IB signature motif; other site
529507009660	HMMPfam hit to PF02899, Phage integrase, N-terminal SAM-like, score 0.068
529507009661	HMMPfam hit to PF00589, Phage integrase family, score 8.2e-35
529507009662	lysyl-tRNA synthetase; Reviewed; Region: lysS; PRK00484
529507009663	LysRS_N: N-terminal, anticodon recognition domain of lysyl-tRNA synthetases (LysRS). These enzymes are homodimeric class 2b aminoacyl-tRNA synthetases (aaRSs). This domain is a beta-barrel domain (OB fold) involved in binding the tRNA anticodon stem-loop; Region: LysRS_N; cd04322
529507009664	dimer interface [polypeptide binding]; other site
529507009665	putative anticodon binding site; other site
529507009666	Lys_tRNA synthetase (LysRS) class II core domain. Class II LysRS is a dimer which attaches a lysine to the 3' OH group of ribose of the appropriate tRNA. Its assignment to class II aaRS is based upon its structure and the presence of three...; Region: LysRS_core; cd00775
529507009667	motif 1; other site
529507009668	active site
529507009669	motif 2; other site
529507009670	motif 3; other site
529507009671	HMMPfam hit to PF00152, tRNA synthetases class II (D, K and N), score 2.9e-203
529507009672	PS00339 Aminoacyl-transfer RNA synthetases class-II signature 2.
529507009673	PS00179 Aminoacyl-transfer RNA synthetases class-II signature 1.
529507009674	HMMPfam hit to PF01336, OB-fold nucleic acid binding domain, score 8.2e-18
529507009675	peptide chain release factor 2; Validated; Region: prfB; PRK00578
529507009676	This domain is found in peptide chain release factors; Region: PCRF; smart00937
529507009677	RF-1 domain; Region: RF-1; pfam00472
529507009678	HMMPfam hit to PF00472, Peptidyl-tRNA hydrolase domain, score 8.2e-68
529507009679	PS00745 Prokaryotic-type class I peptide chain release factors signature.
529507009680	HMMPfam hit to PF03462, PCRF domain, score 5.7e-60
529507009681	ssDNA exonuclease RecJ; Provisional; Region: PRK11070
529507009682	DHH family; Region: DHH; pfam01368
529507009683	DHHA1 domain; Region: DHHA1; pfam02272
529507009684	HMMPfam hit to PF02272, DHHA1 domain, score 5e-14
529507009685	HMMPfam hit to PF01368, DHH family, score 8.1e-51
529507009686	protein disulfide isomerase II DsbC; Provisional; Region: PRK10877
529507009687	DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold. They function as protein disulfide isomerases and chaperones in the bacterial periplasm to correct non-native disulfide bonds...; Region: DsbA_DsbC_DsbG; cd03020
529507009688	dimerization domain [polypeptide binding]; other site
529507009689	dimer interface [polypeptide binding]; other site
529507009690	catalytic residues [active]
529507009691	Signal peptide predicted for PMI2011 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.996 between residues 21 and 22
529507009692	site-specific tyrosine recombinase XerD; Reviewed; Region: xerD; PRK00283
529507009693	XerD and XerC integrases, DNA breaking-rejoining enzymes, N- and C-terminal domains. XerD-like integrases are involved in the site-specific integration and excision of lysogenic bacteriophage genomes, transposition of conjugative transposons, termination...; Region: INT_XerDC; cd00798
529507009694	active site
529507009695	Int/Topo IB signature motif; other site
529507009696	HMMPfam hit to PF00589, Phage integrase family, score 7.8e-66
529507009697	HMMPfam hit to PF02899, Phage integrase, N-terminal SAM-like, score 1.2e-32
529507009698	flavodoxin FldB; Provisional; Region: PRK12359
529507009699	HMMPfam hit to PF00258, Flavodoxin, score 1.3e-33
529507009700	PS00201 Flavodoxin signature.
529507009701	Protein of unknown function (DUF1434); Region: DUF1434; pfam07254
529507009702	HMMPfam hit to PF07254, Protein of unknown function (DUF1434), score 7.7e-28
529507009703	2 probable transmembrane helices predicted for PMI2014 by TMHMM2.0 at aa 12-34 and 38-55
529507009704	Flavinator of succinate dehydrogenase; Region: Sdh5; cl01110
529507009705	HMMPfam hit to PF03937, TPR repeat region, score 5e-32
529507009706	putative global regulator; Reviewed; Region: PRK09559
529507009707	folate-binding protein YgfZ; Region: ygfZ_signature; TIGR03317
529507009708	HMMPfam hit to PF01571, Glycine cleavage T-protein (aminomethyl tran, score 1.3e-05
529507009709	HD domain; Region: HD_3; pfam13023
529507009710	HMMPfam hit to PF01966, HD domain, score 7.9e-05
529507009711	glycine dehydrogenase; Provisional; Region: PRK05367
529507009712	Glycine cleavage system P-protein, alpha- and beta-subunits. This family consists of Glycine cleavage system P-proteins EC:1.4.4.2 from bacterial, mammalian and plant sources. The P protein is part of the glycine decarboxylase multienzyme complex EC:2.1; Region: GDC-P; cd00613
529507009713	tetramer interface [polypeptide binding]; other site
529507009714	pyridoxal 5'-phosphate binding site [chemical binding]; other site
529507009715	catalytic residue [active]
529507009716	Glycine cleavage system P-protein, alpha- and beta-subunits. This family consists of Glycine cleavage system P-proteins EC:1.4.4.2 from bacterial, mammalian and plant sources. The P protein is part of the glycine decarboxylase multienzyme complex EC:2.1; Region: GDC-P; cd00613
529507009717	tetramer interface [polypeptide binding]; other site
529507009718	pyridoxal 5'-phosphate binding site [chemical binding]; other site
529507009719	catalytic residue [active]
529507009720	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507009721	HMMPfam hit to PF02347, Glycine cleavage system P-protein, score 6.3e-264
529507009722	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507009723	Glycine cleavage H-protein. Glycine cleavage H-proteins are part of the glycine cleavage system (GCS) found in bacteria, archea and the mitochondria of eukaryotes. GCS is a multienzyme complex consisting of 4 different components (P-, H-, T- and...; Region: GCS_H; cd06848
529507009724	lipoyl attachment site [posttranslational modification]; other site
529507009725	HMMPfam hit to PF01597, Glycine cleavage H-protein, score 5.2e-68
529507009726	PS00189 2-oxo acid dehydrogenases acyltransferase component lipoyl binding site.
529507009727	glycine cleavage system aminomethyltransferase T; Reviewed; Region: gcvT; PRK00389
529507009728	Glycine cleavage T-protein C-terminal barrel domain; Region: GCV_T_C; pfam08669
529507009729	HMMPfam hit to PF01571, Glycine cleavage T-protein (aminomethyl tran, score 7.6e-122
529507009730	oxidoreductase; Provisional; Region: PRK08013
529507009731	Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family; Region: Ubi-OHases; TIGR01988
529507009732	HMMPfam hit to PF01360, Monooxygenase, score 2.9e-34
529507009733	PS01304 ubiH/COQ6 monooxygenase family signature.
529507009734	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507009735	Signal peptide predicted for PMI2022 by SignalP 2.0 HMM (Signal peptide probability 0.762) with cleavage site probability 0.488 between residues 19 and 20
529507009736	2-octaprenyl-6-methoxyphenyl hydroxylase; Validated; Region: PRK05732
529507009737	2-polyprenyl-6-methoxyphenol 4-hydroxylase; Region: UbiH; TIGR01984
529507009738	HMMPfam hit to PF01360, Monooxygenase, score 4.8e-21
529507009739	PS01304 ubiH/COQ6 monooxygenase family signature.
529507009740	Signal peptide predicted for PMI2023 by SignalP 2.0 HMM (Signal peptide probability 0.982) with cleavage site probability 0.664 between residues 23 and 24
529507009741	proline aminopeptidase P II; Provisional; Region: PRK10879
529507009742	Aminopeptidase P, N-terminal domain; Region: AMP_N; pfam05195
529507009743	Prolidase. E.C. 3.4.13.9. Also known as Xaa-Pro dipeptidase, X-Pro dipeptidase, proline dipeptidase., imidodipeptidase, peptidase D, gamma-peptidase. Catalyses hydrolysis of Xaa-Pro dipeptides; also acts on aminoacyl-hydroxyproline analogs. No action on...; Region: Prolidase; cd01087
529507009744	active site
529507009745	HMMPfam hit to PF00557, metallopeptidase family M24, score 2.7e-110
529507009746	PS00491 Aminopeptidase P and proline dipeptidase signature.
529507009747	HMMPfam hit to PF05195, Aminopeptidase P, N-terminal domain, score 3.5e-59
529507009748	hypothetical protein; Reviewed; Region: PRK01736
529507009749	HMMPfam hit to PF03695, Uncharacterised protein family (UPF0149), score 9.5e-69
529507009750	PS00290 Immunoglobulins and major histocompatibility complex proteins signature.
529507009751	Z-ring-associated protein; Provisional; Region: PRK10972
529507009752	HMMPfam hit to PF05164, Family of unknown function (DUF710), score 8.3e-29
529507009753	5-formyltetrahydrofolate cyclo-ligase [Coenzyme metabolism]; Region: COG0212; cl00360
529507009754	5-formyltetrahydrofolate cyclo-ligase family; Region: 5-FTHF_cyc-lig; pfam01812
529507009755	HMMPfam hit to PF01812, 5-formyltetrahydrofolate cyclo-ligase, score 1e-56
529507009756	ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]; Region: MdlB; COG1132
529507009757	ABC transporter transmembrane region; Region: ABC_membrane; pfam00664
529507009758	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
529507009759	Walker A/P-loop; other site
529507009760	ATP binding site [chemical binding]; other site
529507009761	Q-loop/lid; other site
529507009762	ABC transporter signature motif; other site
529507009763	Walker B; other site
529507009764	D-loop; other site
529507009765	H-loop/switch region; other site
529507009766	HMMPfam hit to PF00664, ABC transporter transmembrane region, score 9.8e-42
529507009767	5 probable transmembrane helices predicted for PMI2028 by TMHMM2.0 at aa 141-163, 167-189, 254-276, 280-297 and 376-398
529507009768	HMMPfam hit to PF00005, ABC transporter, score 1.3e-60
529507009769	PS00017 ATP/GTP-binding site motif A (P-loop).
529507009770	PS00211 ABC transporters family signature.
529507009771	type I secretion membrane fusion protein, HlyD family; Region: type_I_hlyD; TIGR01843
529507009772	HlyD family secretion protein; Region: HlyD_3; pfam13437
529507009773	1 probable transmembrane helix predicted for PMI2029 by TMHMM2.0 at aa 40-62
529507009774	HMMPfam hit to PF00529, HlyD family secretion protein, score 3.4e-14
529507009775	PS00543 HlyD family secretion proteins signature.
529507009776	Peptidase family C39 mostly contains bacteriocin-processing endopeptidases from bacteria. The cysteine peptidases in family C39 cleave the "double-glycine" leader peptides from the precursors of various bacteriocins (mostly non-lantibiotic); Region: Peptidase_C39_like; cl00296
529507009777	type I secretion system ABC transporter, HlyB family; Region: type_I_sec_HlyB; TIGR01846
529507009778	ABC transporter transmembrane region; Region: ABC_membrane; pfam00664
529507009779	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
529507009780	Walker A/P-loop; other site
529507009781	ATP binding site [chemical binding]; other site
529507009782	Q-loop/lid; other site
529507009783	ABC transporter signature motif; other site
529507009784	Walker B; other site
529507009785	D-loop; other site
529507009786	H-loop/switch region; other site
529507009787	5 probable transmembrane helices predicted for PMI2030 by TMHMM2.0 at aa 152-174, 189-211, 263-285, 290-312 and 374-396
529507009788	HMMPfam hit to PF00664, ABC transporter transmembrane region, score 6.8e-45
529507009789	HMMPfam hit to PF00005, ABC transporter, score 1.2e-62
529507009790	PS00017 ATP/GTP-binding site motif A (P-loop).
529507009791	PS00211 ABC transporters family signature.
529507009792	D-3-phosphoglycerate dehydrogenase; Provisional; Region: PRK11790
529507009793	Phosphoglycerate dehydrogenases, NAD-binding and catalytic domains; Region: PGDH_3; cd12176
529507009794	ligand binding site [chemical binding]; other site
529507009795	NAD binding site [chemical binding]; other site
529507009796	tetramer interface [polypeptide binding]; other site
529507009797	catalytic site [active]
529507009798	C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria; Region: ACT_3PGDH; cd04901
529507009799	L-serine binding site [chemical binding]; other site
529507009800	ACT domain interface; other site
529507009801	HMMPfam hit to PF01842, ACT domain, score 5.2e-07
529507009802	HMMPfam hit to PF02826, D-isomer specific 2-hydroxyacid dehydrog, score 5.1e-92
529507009803	PS00671 D-isomer specific 2-hydroxyacid dehydrogenases signature 3.
529507009804	PS00670 D-isomer specific 2-hydroxyacid dehydrogenases signature 2.
529507009805	PS00065 D-isomer specific 2-hydroxyacid dehydrogenases NAD-binding signature.
529507009806	HMMPfam hit to PF00389, D-isomer specific 2-hydroxyacid dehydrog, score 3e-23
529507009807	RPI_A: Ribose 5-phosphate isomerase type A (RPI_A) subfamily; RPI catalyzes the reversible conversion of ribose-5-phosphate to ribulose 5-phosphate, the first step of the non-oxidative branch of the pentose phosphate pathway. This reaction leads to the...; Region: RPI_A; cd01398
529507009808	tetramer (dimer of dimers) interface [polypeptide binding]; other site
529507009809	active site
529507009810	dimer interface [polypeptide binding]; other site
529507009811	HMMPfam hit to PF06026, Ribose 5-phosphate isomerase A (phosph, score 4.2e-103
529507009812	chromosome replication initiation inhibitor protein; Validated; Region: PRK03635
529507009813	Bacterial regulatory helix-turn-helix protein, lysR family; Region: HTH_1; pfam00126
529507009814	The C-terminal substrate binding domain of LysR-type transcriptional regulator, ArgP (IciA), for arginine exporter (ArgO); contains the type 2 periplasmic binding fold; Region: PBP2_IciA_ArgP; cd08428
529507009815	putative dimerization interface [polypeptide binding]; other site
529507009816	HMMPfam hit to PF00126, Bacterial regulatory helix-turn-helix, score 2e-17
529507009817	Predicted helix-turn-helix motif with score 1987.000, SD 5.95 at aa 19-40, sequence RGFERAAQKLCITQSAVSQRIK
529507009818	PS00044 Bacterial regulatory proteins, lysR family signature.
529507009819	HMMPfam hit to PF03466, LysR substrate binding domain, score 3.9e-11
529507009820	Uncharacterized conserved protein [Function unknown]; Region: COG2968
529507009821	oxidative stress defense protein; Provisional; Region: PRK11087
529507009822	HMMPfam hit to PF04402, Protein of unknown function (DUF541), score 2.5e-69
529507009823	Signal peptide predicted for PMI2036 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.992 between residues 22 and 23
529507009824	arginine exporter protein; Provisional; Region: PRK09304
529507009825	HMMPfam hit to PF01810, LysE type translocator, score 4.6e-50
529507009826	6 probable transmembrane helices predicted for PMI2037 by TMHMM2.0 at aa 5-27, 40-62, 67-86, 111-133, 148-170 and 182-201
529507009827	Signal peptide predicted for PMI2037 by SignalP 2.0 HMM (Signal peptide probability 0.985) with cleavage site probability 0.670 between residues 26 and 27
529507009828	mechanosensitive channel MscS; Provisional; Region: PRK10334
529507009829	Conserved TM helix; Region: TM_helix; pfam05552
529507009830	Mechanosensitive ion channel; Region: MS_channel; pfam00924
529507009831	HMMPfam hit to PF00924, Mechanosensitive ion channel, score 3.1e-79
529507009832	PS01246 Uncharacterized protein family UPF0003 signature.
529507009833	3 probable transmembrane helices predicted for PMI2038 by TMHMM2.0 at aa 20-42, 62-84 and 94-125
529507009834	HMMPfam hit to PF05552, Conserved TM helix, score 1.4e-14
529507009835	hypothetical protein; Provisional; Region: PRK05248
529507009836	HMMPfam hit to PF06062, Uncharacterised protein family (UPF0231), score 2.9e-62
529507009837	bifunctional aconitate hydratase 2/2-methylisocitrate dehydratase; Validated; Region: PRK09238
529507009838	Aconitase B swivel domain. Aconitate hydratase B is involved in energy metabolism as part of the TCA cycle. It catalyses the formation of cis-aconitate from citrate. This is the aconitase swivel domain, which undergoes swivelling conformational change in...; Region: AcnB_Swivel; cd01576
529507009839	substrate binding site [chemical binding]; other site
529507009840	Aconitate hydratase B catalyses the formation of cis-aconitate from citrate as part of the TCA cycle; Region: AcnB; cd01581
529507009841	substrate binding site [chemical binding]; other site
529507009842	ligand binding site [chemical binding]; other site
529507009843	HMMPfam hit to PF00330, Aconitase family (aconitate hydratase), score 2.5e-09
529507009844	PS01244 Aconitase family signature 2.
529507009845	PS00450 Aconitase family signature 1.
529507009846	HMMPfam hit to PF06434, Aconitate hydratase, score 3.4e-286
529507009847	This CDS appears to have an in-frame stop codon.; conserved hypothetical protein (pseudogene)
529507009848	C-terminal region of Pasteurella multocida toxin residues 569-1285; Region: PMT_C; pfam11647
529507009849	C-terminal region of Pasteurella multocida toxin residues 569-1285; Region: PMT_C; pfam11647
529507009850	Putative lysophospholipase; Region: Hydrolase_4; pfam12146
529507009851	Alpha/beta hydrolase family; Region: Abhydrolase_5; pfam12695
529507009852	Peptidase C80 family; Region: Peptidase_C80; pfam11713
529507009853	RTX toxins and related Ca2+-binding proteins [Secondary metabolites biosynthesis, transport, and catabolism]; Region: COG2931
529507009854	HMMPfam hit to PF07634, no description, score 0.067
529507009855	HMMPfam hit to PF07634, no description, score 0.0045
529507009856	HMMPfam hit to PF07634, no description, score 1.9
529507009857	HMMPfam hit to PF07634, no description, score 1
529507009858	HMMPfam hit to PF07634, no description, score 6.6
529507009859	HMMPfam hit to PF07634, no description, score 3.3
529507009860	HMMPfam hit to PF07634, no description, score 0.029
529507009861	HMMPfam hit to PF07634, no description, score 0.045
529507009862	HMMPfam hit to PF07634, no description, score 0.4
529507009863	HMMPfam hit to PF07634, no description, score 8.9e-05
529507009864	HMMPfam hit to PF07634, no description, score 0.88
529507009865	HMMPfam hit to PF07634, no description, score 2
529507009866	HMMPfam hit to PF07634, no description, score 0.78
529507009867	HMMPfam hit to PF07634, no description, score 0.79
529507009868	HMMPfam hit to PF07634, no description, score 0.21
529507009869	HMMPfam hit to PF07634, no description, score 1.9
529507009870	HMMPfam hit to PF07634, no description, score 0.47
529507009871	HMMPfam hit to PF07634, no description, score 0.0038
529507009872	HMMPfam hit to PF07634, no description, score 0.0076
529507009873	HMMPfam hit to PF07634, no description, score 0.51
529507009874	HMMPfam hit to PF07634, no description, score 0.092
529507009875	HMMPfam hit to PF07634, no description, score 0.038
529507009876	HMMPfam hit to PF07634, no description, score 0.0085
529507009877	HMMPfam hit to PF07634, no description, score 0.28
529507009878	HMMPfam hit to PF07634, no description, score 0.41
529507009879	HMMPfam hit to PF07634, no description, score 0.0052
529507009880	HMMPfam hit to PF07634, no description, score 0.045
529507009881	HMMPfam hit to PF07634, no description, score 0.41
529507009882	HMMPfam hit to PF07634, no description, score 0.16
529507009883	HMMPfam hit to PF07634, no description, score 0.51
529507009884	HMMPfam hit to PF07634, no description, score 1.1
529507009885	HMMPfam hit to PF07634, no description, score 0.27
529507009886	HMMPfam hit to PF07634, no description, score 11
529507009887	HMMPfam hit to PF07634, no description, score 0.52
529507009888	HMMPfam hit to PF07634, no description, score 0.0086
529507009889	HMMPfam hit to PF07634, no description, score 0.0028
529507009890	HMMPfam hit to PF07634, no description, score 3.4
529507009891	HMMPfam hit to PF07634, no description, score 0.16
529507009892	HMMPfam hit to PF07634, no description, score 14
529507009893	HMMPfam hit to PF07634, no description, score 0.82
529507009894	HMMPfam hit to PF07634, no description, score 0.14
529507009895	HMMPfam hit to PF07634, no description, score 2.3
529507009896	HMMPfam hit to PF07634, no description, score 0.002
529507009897	HMMPfam hit to PF07634, no description, score 3.1
529507009898	HMMPfam hit to PF07634, no description, score 14
529507009899	HMMPfam hit to PF00561, alpha/beta hydrolase fold, score 0.0015
529507009900	HMMPfam hit to PF07634, no description, score 9.5
529507009901	HMMPfam hit to PF00353, no description, score 6.2
529507009902	dihydrolipoamide dehydrogenase; Reviewed; Region: PRK06467
529507009903	NAD(P)-binding Rossmann-like domain; Region: NAD_binding_8; pfam13450
529507009904	Pyridine nucleotide-disulphide oxidoreductase; Region: Pyr_redox; pfam00070
529507009905	Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain; Region: Pyr_redox_dim; pfam02852
529507009906	HMMPfam hit to PF02852, Pyridine nucleotide-disulphide oxidored, score 4.1e-51
529507009907	HMMPfam hit to PF00070, Pyridine nucleotide-disulphide oxidored, score 2.6e-92
529507009908	PS00076 Pyridine nucleotide-disulphide oxidoreductases class-I active site.
529507009909	pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated; Region: aceF; PRK11854
529507009910	Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases. 2-oxo acid dehydrogenase multienzyme complexes, like pyruvate dehydrogenase (PDH), 2-oxoglutarate dehydrogenase (OGDH) and branched-chain 2-oxo acid...; Region: lipoyl_domain; cd06849
529507009911	E3 interaction surface; other site
529507009912	lipoyl attachment site [posttranslational modification]; other site
529507009913	Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases. 2-oxo acid dehydrogenase multienzyme complexes, like pyruvate dehydrogenase (PDH), 2-oxoglutarate dehydrogenase (OGDH) and branched-chain 2-oxo acid...; Region: lipoyl_domain; cd06849
529507009914	E3 interaction surface; other site
529507009915	lipoyl attachment site [posttranslational modification]; other site
529507009916	Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases. 2-oxo acid dehydrogenase multienzyme complexes, like pyruvate dehydrogenase (PDH), 2-oxoglutarate dehydrogenase (OGDH) and branched-chain 2-oxo acid...; Region: lipoyl_domain; cd06849
529507009917	E3 interaction surface; other site
529507009918	lipoyl attachment site [posttranslational modification]; other site
529507009919	e3 binding domain; Region: E3_binding; pfam02817
529507009920	2-oxoacid dehydrogenases acyltransferase (catalytic domain); Region: 2-oxoacid_dh; pfam00198
529507009921	HMMPfam hit to PF00198, 2-oxoacid dehydrogenases acyltransferas, score 1.1e-113
529507009922	HMMPfam hit to PF02817, e3 binding domain, score 7.8e-18
529507009923	HMMPfam hit to PF00364, Biotin-requiring enzyme, score 1.4e-27
529507009924	PS00189 2-oxo acid dehydrogenases acyltransferase component lipoyl binding site.
529507009925	HMMPfam hit to PF00364, Biotin-requiring enzyme, score 6.4e-27
529507009926	PS00189 2-oxo acid dehydrogenases acyltransferase component lipoyl binding site.
529507009927	HMMPfam hit to PF00364, Biotin-requiring enzyme, score 5.9e-27
529507009928	PS00189 2-oxo acid dehydrogenases acyltransferase component lipoyl binding site.
529507009929	pyruvate dehydrogenase subunit E1; Reviewed; Region: aceE; PRK09405
529507009930	Thiamine pyrophosphate (TPP) family, E1 of E. coli PDC-like subfamily, TPP-binding module; composed of proteins similar to the E1 component of the Escherichia coli pyruvate dehydrogenase multienzyme complex (PDC). PDC catalyzes the oxidative...; Region: TPP_E1_EcPDC_like; cd02017
529507009931	dimer interface [polypeptide binding]; other site
529507009932	TPP-binding site [chemical binding]; other site
529507009933	Pyrimidine (PYR) binding domain of thiamine pyrophosphate (TPP)-dependent enzymes; Region: TPP_enzyme_PYR; cl11410
529507009934	transcriptional regulator PdhR; Reviewed; Region: pdhR; PRK09464
529507009935	Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators; Region: WHTH_GntR; cd07377
529507009936	DNA-binding site [nucleotide binding]; DNA binding site
529507009937	This entry represents the C-terminal ligand binding domain of many members of the GntR family; Region: FCD; smart00895
529507009938	HMMPfam hit to PF07729, FCD domain, score 3.5e-33
529507009939	HMMPfam hit to PF00392, Bacterial regulatory proteins, gntR family, score 5.2e-27
529507009940	PS00043 Bacterial regulatory proteins, gntR family signature.
529507009941	Predicted helix-turn-helix motif with score 1517.000, SD 4.35 at aa 40-61, sequence LPERELAKQFDVSRPSLREAIQ
529507009942	N-acetyl-anhydromuramyl-L-alanine amidase [Cell envelope biogenesis, outer membrane]; Region: ampD; COG3023
529507009943	Peptidoglycan recognition proteins (PGRPs) are pattern recognition receptors that bind, and in certain cases, hydrolyze peptidoglycans (PGNs) of bacterial cell walls. PGRPs have been divided into three classes: short PGRPs (PGRP-S), that are small (20...; Region: PGRP; cd06583
529507009944	amidase catalytic site [active]
529507009945	substrate binding site [chemical binding]; other site
529507009946	Zn binding residues [ion binding]; other site
529507009947	HMMPfam hit to PF01510, N-acetylmuramoyl-L-alanine amidase, score 3.2e-58
529507009948	putative major pilin subunit; Provisional; Region: PRK10574
529507009949	HMMPfam hit to PF07963, Prokaryotic N-terminal methylation motif, score 4.9e-08
529507009950	1 probable transmembrane helix predicted for PMI2049 by TMHMM2.0 at aa 15-37
529507009951	Type II/IV secretion system protein; Region: T2SE; pfam00437
529507009952	PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP). It is responsible for the export the majority of Gram-negative bacterial exoenzymes and toxins. PulE is a cytoplasmic protein of the GSP, which...; Region: PulE-GspE; cd01129
529507009953	Walker A motif; other site
529507009954	ATP binding site [chemical binding]; other site
529507009955	Walker B motif; other site
529507009956	HMMPfam hit to PF00437, Type II/IV secretion system protein, score 5.4e-101
529507009957	PS00017 ATP/GTP-binding site motif A (P-loop).
529507009958	Predicted helix-turn-helix motif with score 1182.000, SD 3.21 at aa 186-207, sequence INQTQITEKAGITFATILRALL
529507009959	PS00662 Bacterial type II secretion system protein E signature.
529507009960	type IV pilin biogenesis protein; Provisional; Region: PRK10573
529507009961	Type II secretion system (T2SS), protein F; Region: T2SF; pfam00482
529507009962	Type II secretion system (T2SS), protein F; Region: T2SF; pfam00482
529507009963	HMMPfam hit to PF00482, Bacterial type II secretion system protein F, score 2.4e-14
529507009964	3 probable transmembrane helices predicted for PMI2051 by TMHMM2.0 at aa 164-186, 213-235 and 370-392
529507009965	HMMPfam hit to PF00482, Bacterial type II secretion system protein F, score 3.7e-15
529507009966	PS00017 ATP/GTP-binding site motif A (P-loop).
529507009967	Dephospho-CoA kinase [Coenzyme metabolism]; Region: CoaE; COG0237
529507009968	Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.24) catalyzes the phosphorylation of dephosphocoenzyme A (dCoA) to yield CoA, which is the final step in CoA biosynthesis; Region: DPCK; cd02022
529507009969	CoA-binding site [chemical binding]; other site
529507009970	ATP-binding [chemical binding]; other site
529507009971	HMMPfam hit to PF01121, Dephospho-CoA kinase, score 1.3e-97
529507009972	PS00017 ATP/GTP-binding site motif A (P-loop).
529507009973	PS01294 Uncharacterized protein family UPF0038 signature.
529507009974	hypothetical protein; Provisional; Region: PRK05287
529507009975	HMMPfam hit to PF07072, Protein of unknown function (DUF1342), score 7.6e-110
529507009976	DNA gyrase inhibitor; Reviewed; Region: PRK00418
529507009977	HMMPfam hit to PF03884, Domain of unknown function (DUF329), score 1e-31
529507009978	The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic...; Region: MutT_pyrophosphohydrolase; cd03425
529507009979	active site
529507009980	8-oxo-dGMP binding site [chemical binding]; other site
529507009981	nudix motif; other site
529507009982	metal binding site [ion binding]; metal-binding site
529507009983	HMMPfam hit to PF00293, NUDIX domain, score 9.1e-25
529507009984	PS00893 mutT domain signature.
529507009985	Hemolysin activation/secretion protein [Intracellular trafficking and secretion]; Region: FhaC; COG2831
529507009986	POTRA domain, ShlB-type; Region: POTRA_2; pfam08479
529507009987	Haemolysin secretion/activation protein ShlB/FhaC/HecB; Region: ShlB; pfam03865
529507009988	HMMPfam hit to PF03865, Haemolysin secretion/activation protein ShlB, score 0
529507009989	Signal peptide predicted for PMI2056 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.613 between residues 20 and 21
529507009990	PS00079 Multicopper oxidases signature 1.
529507009991	haemagglutination activity domain; Region: Haemagg_act; pfam05860
529507009992	Haemagluttinin repeat; Region: Fil_haemagg_2; pfam13332
529507009993	Haemagluttinin repeat; Region: Fil_haemagg_2; pfam13332
529507009994	Haemagluttinin repeat; Region: Fil_haemagg_2; pfam13332
529507009995	Haemagluttinin repeat; Region: Fil_haemagg_2; pfam13332
529507009996	Haemagluttinin repeat; Region: Fil_haemagg_2; pfam13332
529507009997	Signal peptide predicted for PMI2057 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.909 between residues 29 and 30
529507009998	HMMPfam hit to PF05860, haemagglutination activity domain, score 3.6e-60
529507009999	HMMPfam hit to PF05594, Haemagluttinin repeat, score 1.6
529507010000	HMMPfam hit to PF05594, Haemagluttinin repeat, score 0.42
529507010001	HMMPfam hit to PF05594, Haemagluttinin repeat, score 2.4
529507010002	HMMPfam hit to PF05594, Haemagluttinin repeat, score 1.1
529507010003	HMMPfam hit to PF05594, Haemagluttinin repeat, score 0.022
529507010004	This CDS appears to have a frameshift mutation following codon 187.; Also similar to PMI2173 (45.5 38d); copper-transporting P-type ATPase (pseudogene)
529507010005	HMMPfam hit to PF00403, Heavy-metal-associated domain, score 3.8e-13
529507010006	PS01047 Heavy-metal-associated domain.
529507010007	Predicted helix-turn-helix motif with score 973.000, SD 2.50 at aa 77-98, sequence EEITELAIEEMTCASCVGRVEK
529507010008	HMMPfam hit to PF00403, Heavy-metal-associated domain, score 1.8e-11
529507010009	PS01047 Heavy-metal-associated domain.
529507010010	1 probable transmembrane helix predicted for PMI2058 by TMHMM2.0 at aa 171-193
529507010011	5 probable transmembrane helices predicted for PMI2059 by TMHMM2.0 at aa 48-70, 208-230, 235-257, 551-573 and 577-599
529507010012	HMMPfam hit to PF00122, E1-E2 ATPase, score 2e-105
529507010013	HMMPfam hit to PF00702, haloacid dehalogenase-like hydrolase, score 1.6e-42
529507010014	PS00154 E1-E2 ATPases phosphorylation site.
529507010015	Cu(I)-responsive transcriptional regulator; Region: CueR; TIGR02044
529507010016	Helix-Turn-Helix DNA binding domain of CueR-like transcription regulators; Region: HTH_CueR; cd01108
529507010017	DNA binding residues [nucleotide binding]
529507010018	dimer interface [polypeptide binding]; other site
529507010019	copper binding site [ion binding]; other site
529507010020	Predicted helix-turn-helix motif with score 1457.000, SD 4.15 at aa 1-22, sequence MNIGQAAKKSGISSKMIRYYEQ
529507010021	HMMPfam hit to PF00376, MerR family regulatory protein, score 4.9e-14
529507010022	PS00552 Bacterial regulatory proteins, merR family signature.
529507010023	preprotein translocase subunit SecA; Reviewed; Region: PRK12904
529507010024	SecA preprotein cross-linking domain; Region: SecA_PP_bind; smart00958
529507010025	Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may...; Region: HELICc; cl17351
529507010026	nucleotide binding region [chemical binding]; other site
529507010027	ATP-binding site [chemical binding]; other site
529507010028	SEC-C motif; Region: SEC-C; pfam02810
529507010029	HMMPfam hit to PF02810, SEC-C motif, score 2.7e-10
529507010030	HMMPfam hit to PF07516, SecA Wing and Scaffold domain, score 4.9e-119
529507010031	Predicted helix-turn-helix motif with score 1028.000, SD 2.69 at aa 518-539, sequence SWQTEVAKLENPTEEQIEEIKA
529507010032	PS01312 Protein secA signatures.
529507010033	HMMPfam hit to PF07517, SecA DEAD-like domain, score 2.5e-161
529507010034	HMMPfam hit to PF01043, SecA preprotein cross-linking domain, score 3.6e-82
529507010035	SecA regulator SecM; Provisional; Region: PRK02943
529507010036	HMMPfam hit to PF06558, Secretion monitor precursor protein (SecM), score 3e-23
529507010037	Signal peptide predicted for PMI2062 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.879 between residues 38 and 39
529507010038	Protein of unknown function (DUF721); Region: DUF721; cl02324
529507010039	UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase; Reviewed; Region: lpxC; PRK13186
529507010040	UDP-3-O-acyl N-acetylglycosamine deacetylase; Region: LpxC; pfam03331
529507010041	HMMPfam hit to PF03331, UDP-3-O-acyl N-acetylglycosamine deacetylase, score 6.5e-188
529507010042	cell division protein FtsZ; Validated; Region: PRK09330
529507010043	FtsZ is a GTPase that is similar to the eukaryotic tubulins and is essential for cell division in prokaryotes.  FtsZ is capable of polymerizing in a GTP-driven process into structures similar to those formed by tubulin. FtsZ forms a ring-shaped septum at...; Region: FtsZ_type1; cd02201
529507010044	nucleotide binding site [chemical binding]; other site
529507010045	SulA interaction site; other site
529507010046	HMMPfam hit to PF03953, Tubulin/FtsZ family, C-terminal domain, score 1.6e-45
529507010047	HMMPfam hit to PF00091, Tubulin/FtsZ family, GTPase domain, score 3.2e-89
529507010048	PS01135 FtsZ protein signature 2.
529507010049	PS01134 FtsZ protein signature 1.
529507010050	cell division protein FtsA; Reviewed; Region: ftsA; PRK09472
529507010051	Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily; Region: NBD_sugar-kinase_HSP70_actin; cd00012
529507010052	Cell division protein FtsA; Region: FtsA; pfam14450
529507010053	HMMPfam hit to PF02491, Cell division protein FtsA, score 1.1e-68
529507010054	HMMPfam hit to PF02491, Cell division protein FtsA, score 3e-72
529507010055	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507010056	cell division protein FtsQ; Provisional; Region: PRK10775
529507010057	POTRA domain, FtsQ-type; Region: POTRA_1; pfam08478
529507010058	Cell division protein FtsQ; Region: FtsQ; pfam03799
529507010059	HMMPfam hit to PF03799, Cell division protein FtsQ, score 4.1e-58
529507010060	1 probable transmembrane helix predicted for PMI2067 by TMHMM2.0 at aa 30-52
529507010061	UDP-N-acetylmuramate--L-alanine ligase; Provisional; Region: murC; PRK00421
529507010062	Mur ligase family, catalytic domain; Region: Mur_ligase; pfam01225
529507010063	Mur ligase middle domain; Region: Mur_ligase_M; pfam08245
529507010064	Mur ligase family, glutamate ligase domain; Region: Mur_ligase_C; pfam02875
529507010065	HMMPfam hit to PF02875, Mur ligase family, glutamate ligase doma, score 1.3e-24
529507010066	HMMPfam hit to PF01225, Mur ligase family, catalytic domain, score 3.4e-63
529507010067	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional; Region: murG; PRK00726
529507010068	MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide...; Region: GT1_MurG; cd03785
529507010069	active site
529507010070	homodimer interface [polypeptide binding]; other site
529507010071	HMMPfam hit to PF04101, Glycosyltransferase family, score 4.5e-50
529507010072	HMMPfam hit to PF03033, Glycosyltransferase family, score 1.7e-52
529507010073	Signal peptide predicted for PMI2070 by SignalP 2.0 HMM (Signal peptide probability 0.847) with cleavage site probability 0.690 between residues 26 and 27
529507010074	cell division protein FtsW; Provisional; Region: PRK10774
529507010075	HMMPfam hit to PF01098, Cell cycle protein, score 1.4e-173
529507010076	8 probable transmembrane helices predicted for PMI2071 by TMHMM2.0 at aa 32-54, 69-88, 95-117, 167-189, 202-224, 290-312, 324-346 and 356-378
529507010077	PS00428 Cell cycle proteins ftsW / rodA / spoVE signature.
529507010078	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional; Region: murD; PRK03806
529507010079	Mur ligase middle domain; Region: Mur_ligase_M; pfam08245
529507010080	Mur ligase family, glutamate ligase domain; Region: Mur_ligase_C; pfam02875
529507010081	HMMPfam hit to PF02875, Mur ligase family, glutamate ligase doma, score 1.4e-14
529507010082	HMMPfam hit to PF01225, Mur ligase family, catalytic domain, score 3e-54
529507010083	PS00012 Phosphopantetheine attachment site.
529507010084	1 probable transmembrane helix predicted for PMI2072 by TMHMM2.0 at aa 9-26
529507010085	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507010086	phospho-N-acetylmuramoyl-pentapeptide-transferase; Provisional; Region: mraY; PRK00108
529507010087	Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY) is an enzyme responsible for the formation of the first lipid intermediate in the synthesis of bacterial cell wall peptidoglycan. It catalyzes the formation of...; Region: GT_MraY; cd06852
529507010088	Mg++ binding site [ion binding]; other site
529507010089	putative catalytic motif [active]
529507010090	putative substrate binding site [chemical binding]; other site
529507010091	10 probable transmembrane helices predicted for PMI2073 by TMHMM2.0 at aa 26-48, 69-91, 95-114, 134-151, 171-193, 200-219, 234-256, 263-285, 289-311 and 338-357
529507010092	HMMPfam hit to PF00953, Glycosyl transferase, score 1.2e-83
529507010093	UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase; Reviewed; Region: murF; PRK10773
529507010094	Mur ligase family, catalytic domain; Region: Mur_ligase; pfam01225
529507010095	Mur ligase middle domain; Region: Mur_ligase_M; pfam08245
529507010096	Mur ligase family, glutamate ligase domain; Region: Mur_ligase_C; pfam02875
529507010097	HMMPfam hit to PF02875, Mur ligase family, glutamate ligase doma, score 8.5e-15
529507010098	HMMPfam hit to PF01225, Mur ligase family, catalytic domain, score 2.2e-61
529507010099	Predicted helix-turn-helix motif with score 1054.000, SD 2.78 at aa 20-41, sequence ITQSQANQLMIKSISTDSRKID
529507010100	UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase; Provisional; Region: murE; PRK00139
529507010101	Mur ligase family, catalytic domain; Region: Mur_ligase; pfam01225
529507010102	Mur ligase middle domain; Region: Mur_ligase_M; pfam08245
529507010103	Mur ligase family, glutamate ligase domain; Region: Mur_ligase_C; pfam02875
529507010104	HMMPfam hit to PF02875, Mur ligase family, glutamate ligase doma, score 4.4e-40
529507010105	HMMPfam hit to PF01225, Mur ligase family, catalytic domain, score 1.1e-73
529507010106	peptidoglycan synthase FtsI; Provisional; Region: PRK15105
529507010107	Penicillin-binding Protein dimerisation domain; Region: PBP_dimer; pfam03717
529507010108	Penicillin binding protein transpeptidase domain; Region: Transpeptidase; pfam00905
529507010109	HMMPfam hit to PF00905, Penicillin binding protein transpeptid, score 8.8e-114
529507010110	HMMPfam hit to PF03717, Penicillin-binding Protein dimerisatio, score 1.2e-50
529507010111	Predicted helix-turn-helix motif with score 1116.000, SD 2.99 at aa 117-138, sequence SRWLALADALKLPVNQISQKIS
529507010112	1 probable transmembrane helix predicted for PMI2076 by TMHMM2.0 at aa 27-49
529507010113	Signal peptide predicted for PMI2076 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.902 between residues 45 and 46
529507010114	cell division protein FtsL; Provisional; Region: PRK10772
529507010115	HMMPfam hit to PF04999, Cell division protein FtsL, score 2.1e-49
529507010116	1 probable transmembrane helix predicted for PMI2077 by TMHMM2.0 at aa 22-39
529507010117	MraW methylase family; Region: Methyltransf_5; pfam01795
529507010118	16S rRNA m(4)C1402 methyltranserfase; Provisional; Region: PRK00050
529507010119	HMMPfam hit to PF01795, MraW methylase family, score 3.1e-174
529507010120	cell division protein MraZ; Reviewed; Region: PRK00326
529507010121	MraZ protein; Region: MraZ; pfam02381
529507010122	MraZ protein; Region: MraZ; pfam02381
529507010123	HMMPfam hit to PF02381, Domain of unknown function UPF0040 family, score 1.2e-22
529507010124	HMMPfam hit to PF02381, Domain of unknown function UPF0040 family, score 3.1e-26
529507010125	DNA-binding transcriptional regulator FruR; Provisional; Region: PRK11303
529507010126	Helix-turn-helix (HTH) DNA binding domain of the LacI family of transcriptional regulators; Region: HTH_LacI; cd01392
529507010127	DNA binding site [nucleotide binding]
529507010128	domain linker motif; other site
529507010129	Ligand binding domain of DNA transcription repressor specific for fructose (FruR) and its close homologs; Region: PBP1_FruR; cd06274
529507010130	dimerization interface [polypeptide binding]; other site
529507010131	ligand binding site [chemical binding]; other site
529507010132	HMMPfam hit to PF00532, Periplasmic binding proteins and sugar b, score 7.9e-05
529507010133	HMMPfam hit to PF00356, Bacterial regulatory proteins, lacI fami, score 5.8e-09
529507010134	Predicted helix-turn-helix motif with score 1821.000, SD 5.39 at aa 1-22, sequence MKLDEIARLAGVSRTTASYVIN
529507010135	PS00356 Bacterial regulatory proteins, lacI family signature.
529507010136	Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism]; Region: FAA1; COG1022
529507010137	Long-chain fatty acid CoA synthetases and Bubblegum-like very long-chain fatty acid CoA synthetases; Region: VL_LC_FACS_like; cd05907
529507010138	acyl-activating enzyme (AAE) consensus motif; other site
529507010139	putative AMP binding site [chemical binding]; other site
529507010140	putative active site [active]
529507010141	putative CoA binding site [chemical binding]; other site
529507010142	HMMPfam hit to PF00501, AMP-binding enzyme, score 3.5e-87
529507010143	PS00455 AMP-binding domain signature.
529507010144	leucine transcriptional activator; Reviewed; Region: leuO; PRK09508
529507010145	Bacterial regulatory helix-turn-helix protein, lysR family; Region: HTH_1; pfam00126
529507010146	The C-terminal substrate binding domain of LysR-type transcriptional regulator LeuO, an activator of leucine synthesis operon, contains the type 2 periplasmic binding fold; Region: PBP2_LeuO; cd08466
529507010147	putative substrate binding pocket [chemical binding]; other site
529507010148	putative dimerization interface [polypeptide binding]; other site
529507010149	HMMPfam hit to PF03466, LysR substrate binding domain, score 1.1e-12
529507010150	HMMPfam hit to PF00126, Bacterial regulatory helix-turn-helix, score 8.5e-18
529507010151	PS00044 Bacterial regulatory proteins, lysR family signature.
529507010152	Predicted helix-turn-helix motif with score 1484.000, SD 4.24 at aa 37-58, sequence QNVTRAAQVLGMSQPAVSNAVS
529507010153	2 probable transmembrane helices predicted for PMI2083 by TMHMM2.0 at aa 10-27 and 48-70
529507010154	2-isopropylmalate synthase; Validated; Region: PRK00915
529507010155	2-isopropylmalate synthase (IPMS), N-terminal catalytic TIM barrel domain; Region: DRE_TIM_IPMS; cd07940
529507010156	active site
529507010157	catalytic residues [active]
529507010158	metal binding site [ion binding]; metal-binding site
529507010159	LeuA allosteric (dimerisation) domain; Region: LeuA_dimer; pfam08502
529507010160	PS00815 Alpha-isopropylmalate and homocitrate synthases signature 1.
529507010161	HMMPfam hit to PF00682, HMGL-like, score 3.4e-145
529507010162	PS00816 Alpha-isopropylmalate and homocitrate synthases signature 2.
529507010163	3-isopropylmalate dehydrogenase; Provisional; Region: PRK00772
529507010164	tartrate dehydrogenase; Region: TTC; TIGR02089
529507010165	HMMPfam hit to PF00180, Isocitrate/isopropylmalate dehydrogenase, score 2.3e-211
529507010166	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507010167	PS00470 Isocitrate and isopropylmalate dehydrogenases signature.
529507010168	3-isopropylmalate dehydratase large subunit; Reviewed; Region: PRK00402
529507010169	3-isopropylmalate dehydratase catalyzes the isomerization between 2-isopropylmalate and 3-isopropylmalate; Region: IPMI; cd01583
529507010170	substrate binding site [chemical binding]; other site
529507010171	ligand binding site [chemical binding]; other site
529507010172	HMMPfam hit to PF00330, Aconitase family (aconitate hydratase), score 2.1e-271
529507010173	PS00450 Aconitase family signature 1.
529507010174	PS01244 Aconitase family signature 2.
529507010175	isopropylmalate isomerase small subunit; Provisional; Region: leuD; PRK01641
529507010176	Aconatase-like swivel domain of 3-isopropylmalate dehydratase and related uncharacterized proteins. 3-isopropylmalate dehydratase catalyzes the isomerization between 2-isopropylmalate and 3-isopropylmalate, via the formation of 2-isopropylmaleate...; Region: IPMI_Swivel; cd01577
529507010177	substrate binding site [chemical binding]; other site
529507010178	HMMPfam hit to PF00694, Aconitase C-terminal domain, score 1e-64
529507010179	transcriptional regulator SgrR; Provisional; Region: PRK13626
529507010180	Sugar transport-related sRNA regulator N-term; Region: SgrR_N; pfam12793
529507010181	The C-terminal solute-binding domain of DNA-binding transcriptional regulator SgrR is related to the ABC-type oligopeptide-binding proteins and contains the type 2 periplasmic-binding fold; Region: PBP2_SgrR_like; cd08507
529507010182	Predicted helix-turn-helix motif with score 1801.000, SD 5.32 at aa 24-45, sequence TTLQELAETLHCTRRHVRSLLN
529507010183	HMMPfam hit to PF00496, Bacterial extracellular solute-binding prot, score 3.7e-33
529507010184	MutH is a 28kD endonuclease involved in methyl-directed DNA mismatch repair in gram negative bacteria. MutH is both sequence-specific and methylation-specific, introducing a nick in the unmethylated strand of a hemi-methylated d(GATC) DNA duplex.   MutH...; Region: MutH_Sau3AI; cd00583
529507010185	putative DNA-binding cleft [nucleotide binding]; other site
529507010186	putative DNA clevage site; other site
529507010187	molecular lever; other site
529507010188	HMMPfam hit to PF02976, DNA mismatch repair enzyme MutH, score 8.3e-50
529507010189	Predicted transcriptional regulator [Transcription]; Region: COG3636; cl17681
529507010190	Predicted helix-turn-helix motif with score 1357.000, SD 3.81 at aa 66-87, sequence GGVGVIAKKSGLSRQHIYRALS
529507010191	putative addiction module killer protein; Region: upstrm_HI1419; TIGR02683
529507010192	HMMPfam hit to PF05973, Phage derived protein Gp49-like (DUF891), score 3.6e-17
529507010193	meso-2,3-butanediol dehydrogenase-like, classical (c) SDRs; Region: meso-BDH-like_SDR_c; cd05366
529507010194	acetoin reductases; Region: 23BDH; TIGR02415
529507010195	NAD binding site [chemical binding]; other site
529507010196	homotetramer interface [polypeptide binding]; other site
529507010197	homodimer interface [polypeptide binding]; other site
529507010198	active site
529507010199	substrate binding site [chemical binding]; other site
529507010200	HMMPfam hit to PF00106, short chain dehydrogenase, score 2.4e-86
529507010201	PS00061 Short-chain dehydrogenases/reductases family signature.
529507010202	PS00216 Sugar transport proteins signature 1.
529507010203	Agmatinase-like family includes proclavaminic acid amidinohydrolase; Region: Agmatinase_PAH; cd11592
529507010204	agmatinase; Region: agmatinase; TIGR01230
529507010205	oligomer interface [polypeptide binding]; other site
529507010206	putative active site [active]
529507010207	Mn binding site [ion binding]; other site
529507010208	HMMPfam hit to PF00491, Arginase family, score 9.7e-118
529507010209	PS01053 Arginase family signature 3.
529507010210	PS00148 Arginase family signature 2.
529507010211	PS00147 Arginase family signature 1.
529507010212	arginine decarboxylase; Provisional; Region: PRK05354
529507010213	Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Arginine Decarboxylase; Region: PLPDE_III_ADC; cd06830
529507010214	dimer interface [polypeptide binding]; other site
529507010215	active site
529507010216	pyridoxal 5'-phosphate (PLP) binding site [chemical binding]; other site
529507010217	catalytic residues [active]
529507010218	Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes; Region: PLPDE_III; cl00261
529507010219	HMMPfam hit to PF00278, Pyridoxal-dependent decarboxylase, C-, score 4.2e-43
529507010220	HMMPfam hit to PF02784, Pyridoxal-dependent decarboxylase, py, score 7.4e-107
529507010221	PS00879 Orn/DAP/Arg decarboxylases family 2 signature 2.
529507010222	PS00878 Orn/DAP/Arg decarboxylases family 2 pyridoxal-P attachment site.
529507010223	S-adenosylmethionine synthetase, N-terminal domain; Region: S-AdoMet_synt_N; pfam00438
529507010224	S-adenosylmethionine synthetase; Validated; Region: PRK05250
529507010225	S-adenosylmethionine synthetase, central domain; Region: S-AdoMet_synt_M; pfam02772
529507010226	S-adenosylmethionine synthetase, C-terminal domain; Region: S-AdoMet_synt_C; pfam02773
529507010227	HMMPfam hit to PF00438, S-adenosylmethionine synthetase, N-te, score 2.9e-63
529507010228	HMMPfam hit to PF02772, S-adenosylmethionine synthetase, cent, score 1.6e-84
529507010229	PS00376 S-adenosylmethionine synthetase signature 1.
529507010230	HMMPfam hit to PF02773, S-adenosylmethionine synthetase, C-te, score 2.2e-90
529507010231	PS00377 S-adenosylmethionine synthetase signature 2.
529507010232	Protein of unknown function (DUF3260); Region: DUF3260; pfam11658
529507010233	5 probable transmembrane helices predicted for PMI2096 by TMHMM2.0 at aa 12-34, 39-56, 63-82, 106-128 and 135-157
529507010234	Protein of unknown function (DUF2629); Region: DUF2629; pfam10945
529507010235	YhjQ protein; Region: YhjQ; pfam06564
529507010236	HMMPfam hit to PF06564, YhjQ protein, score 4.7e-16
529507010237	cellulose synthase catalytic subunit; Provisional; Region: bcsA; PRK11498
529507010238	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose; Region: CESA_CelA_like; cd06421
529507010239	DXD motif; other site
529507010240	PilZ domain; Region: PilZ; pfam07238
529507010241	11 probable transmembrane helices predicted for PMI2099 by TMHMM2.0 at aa 35-57, 96-118, 146-168, 173-190, 197-216, 229-251, 528-550, 554-576, 639-658, 668-690 and 832-854
529507010242	HMMPfam hit to PF00535, Glycosyl transferase, score 3.6e-27
529507010243	cellulose synthase regulator protein; Provisional; Region: PRK11114
529507010244	Signal peptide predicted for PMI2100 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.996 between residues 19 and 20
529507010245	HMMPfam hit to PF03170, Bacterial cellulose synthase subunit, score 5e-149
529507010246	1 probable transmembrane helix predicted for PMI2100 by TMHMM2.0 at aa 729-748
529507010247	Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi; Region: TPR; cd00189
529507010248	TPR motif; other site
529507010249	binding surface
529507010250	Tetratricopeptide repeat; Region: TPR_16; pfam13432
529507010251	Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi; Region: TPR; cd00189
529507010252	binding surface
529507010253	TPR motif; other site
529507010254	Cellulose synthase operon protein C C-terminus (BCSC_C); Region: BCSC_C; pfam05420
529507010255	Signal peptide predicted for PMI2101 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.821 between residues 28 and 29
529507010256	1 probable transmembrane helix predicted for PMI2101 by TMHMM2.0 at aa 12-29
529507010257	HMMPfam hit to PF07719, Tetratricopeptide repeat, score 0.022; HMMPfam hit to PF00515, Tetratricopeptide repeat, score 0.17
529507010258	HMMPfam hit to PF00515, Tetratricopeptide repeat, score 1.5
529507010259	HMMPfam hit to PF00515, Tetratricopeptide repeat, score 8.3e-07; HMMPfam hit to PF07719, Tetratricopeptide repeat, score 9.3e-07
529507010260	HMMPfam hit to PF07719, Tetratricopeptide repeat, score 2.5
529507010261	HMMPfam hit to PF00515, Tetratricopeptide repeat, score 0.12; HMMPfam hit to PF07719, Tetratricopeptide repeat, score 0.0021
529507010262	HMMPfam hit to PF05420, Cellulose synthase operon protein C C-termin, score 1.9e-107
529507010263	Predicted transporter component [General function prediction only]; Region: COG2391
529507010264	Sulphur transport; Region: Sulf_transp; pfam04143
529507010265	HMMPfam hit to PF04143, YeeE/YedE family (DUF395), score 4e-11
529507010266	4 probable transmembrane helices predicted for PMI2102 by TMHMM2.0 at aa 7-29, 49-67, 91-113 and 118-140
529507010267	Signal peptide predicted for PMI2102 by SignalP 2.0 HMM (Signal peptide probability 0.675) with cleavage site probability 0.245 between residues 23 and 24
529507010268	Domain of unknown function (DUF4341); Region: DUF4341; pfam14241
529507010269	Predicted transporter component [General function prediction only]; Region: COG2391
529507010270	Sulphur transport; Region: Sulf_transp; pfam04143
529507010271	4 probable transmembrane helices predicted for PMI2103 by TMHMM2.0 at aa 10-32, 53-72, 82-101 and 121-143
529507010272	HMMPfam hit to PF04143, YeeE/YedE family (DUF395), score 7.9e-24
529507010273	Signal peptide predicted for PMI2103 by SignalP 2.0 HMM (Signal peptide probability 0.648) with cleavage site probability 0.346 between residues 35 and 36
529507010274	Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to...; Region: HTH_ARSR; cd00090
529507010275	dimerization interface [polypeptide binding]; other site
529507010276	putative DNA binding site [nucleotide binding]; other site
529507010277	putative Zn2+ binding site [ion binding]; other site
529507010278	HMMPfam hit to PF01022, Bacterial regulatory protein, arsR family, score 4.1e-22
529507010279	Predicted helix-turn-helix motif with score 1198.000, SD 3.27 at aa 48-69, sequence KSVSELEESLGIRQPTLSQQLT
529507010280	hypothetical protein; Provisional; Region: PRK04860
529507010281	Zn-dependent metalloprotease, SprT family [General function prediction only]; Region: SprT; COG3091
529507010282	HMMPfam hit to PF03926, metallopeptidase (SprT family), score 5.6e-67
529507010283	PS00142 Neutral zinc metallopeptidases, zinc-binding region signature.
529507010284	Toxin YafO, type II toxin-antitoxin system; Region: YafO_toxin; pfam13957
529507010285	Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism]; Region: MgtE; COG2239
529507010286	This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE.  MgtE and its homologs are found in eubacteria, archaebacteria, and eukaryota. Members of this family transport Mg2+ or other...; Region: CBS_pair_Mg_transporter; cd04606
529507010287	Divalent cation transporter; Region: MgtE; pfam01769
529507010288	5 probable transmembrane helices predicted for PMI2109 by TMHMM2.0 at aa 191-210, 215-237, 265-287, 292-314 and 327-349
529507010289	HMMPfam hit to PF01769, Divalent cation transporter, score 4.5e-51
529507010290	HMMPfam hit to PF00571, CBS domain, score 1.2e-08
529507010291	HMMPfam hit to PF00571, CBS domain, score 0.14
529507010292	Signal peptide predicted for PMI2110 by SignalP 2.0 HMM (Signal peptide probability 0.769) with cleavage site probability 0.370 between residues 20 and 21
529507010293	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507010294	HCP oxidoreductase, NADH-dependent; Provisional; Region: PRK10684
529507010295	Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron...; Region: FNR_iron_sulfur_binding_1; cd06215
529507010296	FAD binding pocket [chemical binding]; other site
529507010297	FAD binding motif [chemical binding]; other site
529507010298	phosphate binding motif [ion binding]; other site
529507010299	beta-alpha-beta structure motif; other site
529507010300	NAD binding pocket [chemical binding]; other site
529507010301	2Fe-2S iron-sulfur cluster binding domain. Iron-sulfur proteins play an important role in electron transfer processes and in various enzymatic reactions. The family includes plant and algal ferredoxins, which act as electron carriers in photosynthesis...; Region: fer2; cd00207
529507010302	catalytic loop [active]
529507010303	iron binding site [ion binding]; other site
529507010304	HMMPfam hit to PF00111, 2Fe-2S iron-sulfur cluster binding doma, score 8.5e-19
529507010305	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507010306	PS00197 2Fe-2S ferredoxins, iron-sulfur binding region signature.
529507010307	HMMPfam hit to PF00175, Oxidoreductase NAD-binding domain, score 2.6e-06
529507010308	HMMPfam hit to PF00970, Oxidoreductase FAD-binding domain, score 9.1e-08
529507010309	hybrid cluster protein; Provisional; Region: PRK05290
529507010310	The HCP family of iron-sulfur proteins includes hybrid cluster protein (HCP), acetyl-CoA synthase (ACS), and carbon monoxide dehydrogenase (CODH), all of which contain [Fe4-S4] metal clusters at their active sites. These proteins have a conserved...; Region: HCP_like; cl14655
529507010311	ACS interaction site; other site
529507010312	CODH interaction site; other site
529507010313	Hybrid cluster protein (HCP), formerly known as prismane, is thought to play a role in nitrogen metabolism but its specific function is unknown. HCP has three structural domains, an N-terminal alpha-helical domain, and two similar domains comprising a...; Region: HCP; cd01914
529507010314	hybrid metal cluster; other site
529507010315	HMMPfam hit to PF03063, Prismane/CO dehydrogenase family, score 9.5e-244
529507010316	PS00017 ATP/GTP-binding site motif A (P-loop).
529507010317	NAD(P)+-dependent aldehyde dehydrogenase superfamily; Region: ALDH-SF; cl11961
529507010318	Aldehyde dehydrogenase family; Region: Aldedh; pfam00171
529507010319	NAD(P) binding site [chemical binding]; other site
529507010320	catalytic residues [active]
529507010321	HMMPfam hit to PF00171, Aldehyde dehydrogenase family, score 1.9e-227
529507010322	PS00687 Aldehyde dehydrogenases glutamic acid active site.
529507010323	Na+/alanine symporter [Amino acid transport and metabolism]; Region: AlsT; COG1115
529507010324	amino acid carrier protein; Region: agcS; TIGR00835
529507010325	HMMPfam hit to PF01235, Sodium:alanine symporter family, score 4.6e-154
529507010326	10 probable transmembrane helices predicted for PMI2114 by TMHMM2.0 at aa 7-29, 78-100, 145-167, 180-202, 214-236, 251-270, 302-324, 350-372, 385-404 and 414-436
529507010327	PS00873 Sodium:alanine symporter family signature.
529507010328	Chloride channel protein EriC [Inorganic ion transport and metabolism]; Region: EriC; COG0038
529507010329	ClC chloride channel EriC.  This domain is found in the EriC chloride transporters that mediate the extreme acid resistance response in eubacteria and archaea. This response allows bacteria to survive in the acidic environments by decarboxylation-linked...; Region: EriC; cd01031
529507010330	Cl- selectivity filter; other site
529507010331	Cl- binding residues [ion binding]; other site
529507010332	pore gating glutamate residue; other site
529507010333	dimer interface [polypeptide binding]; other site
529507010334	H+/Cl- coupling transport residue; other site
529507010335	Signal peptide predicted for PMI2115 by SignalP 2.0 HMM (Signal peptide probability 0.761) with cleavage site probability 0.379 between residues 51 and 52
529507010336	11 probable transmembrane helices predicted for PMI2115 by TMHMM2.0 at aa 27-49, 72-94, 121-143, 176-198, 207-229, 249-271, 288-310, 314-336, 349-371, 381-403 and 416-438
529507010337	HMMPfam hit to PF00654, Voltage gated chloride channel, score 1.7e-105
529507010338	tellurite resistance protein TehB; Provisional; Region: PRK12335
529507010339	Domain of unknown function (DUF1971); Region: DUF1971; pfam09313
529507010340	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
529507010341	S-adenosylmethionine binding site [chemical binding]; other site
529507010342	HMMPfam hit to PF03848, Tellurite resistance protein TehB, score 1.2e-75
529507010343	Ion channel; Region: Ion_trans_2; pfam07885
529507010344	TrkA-N domain; Region: TrkA_N; pfam02254
529507010345	HMMPfam hit to PF02254, TrkA-N domain, score 5.1e-07
529507010346	HMMPfam hit to PF07885, Ion channel, score 1.5e-17
529507010347	7 probable transmembrane helices predicted for PMI2117 by TMHMM2.0 at aa 21-43, 58-80, 87-106, 110-127, 139-161, 176-198 and 203-225
529507010348	Choloylglycine hydrolase (CGH) is a bile salt-modifying enzyme that hydrolyzes non-peptide carbon-nitrogen bonds in choloylglycine and choloyltaurine, both of which are present in bile.  CGH is present in a number of probiotic microbial organisms that...; Region: Ntn_CGH; cd01902
529507010349	Linear amide C-N hydrolases, choloylglycine hydrolase family; Region: CBAH; pfam02275
529507010350	HMMPfam hit to PF02275, Linear amide C-N hydrolases, choloylglycine, score 3.4e-37
529507010351	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507010352	Signal peptide predicted for PMI2118 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.748 between residues 28 and 29
529507010353	hypothetical protein; Provisional; Region: PRK03757
529507010354	HMMPfam hit to PF04264, YceI like family, score 3.2e-73
529507010355	Signal peptide predicted for PMI2119 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 1.000 between residues 23 and 24
529507010356	Cytochrome B561 [Energy production and conversion]; Region: CybB; COG3038
529507010357	HMMPfam hit to PF01292, Cytochrome b561 family, score 6.5e-60
529507010358	4 probable transmembrane helices predicted for PMI2120 by TMHMM2.0 at aa 24-46, 61-79, 100-122 and 157-179
529507010359	Transcriptional regulators [Transcription]; Region: RpiR; COG1737
529507010360	Helix-turn-helix domain, rpiR family; Region: HTH_6; pfam01418
529507010361	RpiR-like protein. RpiR contains a SIS (Sugar ISomerase) domain, which is found in many phosphosugar isomerases and phosphosugar binding proteins. In E. coli, rpiR negatively regulates the expression of rpiB gene. Both rpiB and rpiA are ribose phosphate...; Region: SIS_RpiR; cd05013
529507010362	putative active site [active]
529507010363	Predicted helix-turn-helix motif with score 1198.000, SD 3.27 at aa 57-78, sequence DTIAILADKANVPPSTLIRFAN
529507010364	HMMPfam hit to PF01380, SIS domain, score 7.5e-15
529507010365	Left-handed beta-roll, including virulence factors and various other proteins; Region: LbR-like; cl17507
529507010366	trimer interface [polypeptide binding]; other site
529507010367	YadA-like C-terminal region; Region: YadA; pfam03895
529507010368	HMMPfam hit to PF05658, Hep_Hag, score 0.74
529507010369	HMMPfam hit to PF05658, Hep_Hag, score 4.8e-05
529507010370	Acetyltransferase (GNAT) domain; Region: Acetyltransf_3; pfam13302
529507010371	TAT (twin-arginine translocation) pathway signal sequence; Region: TAT_signal; pfam10518
529507010372	Arylsulfatase A and related enzymes [Inorganic ion transport and metabolism]; Region: AslA; COG3119
529507010373	Sulfatase; Region: Sulfatase; cl17466
529507010374	Signal peptide predicted for PMI2124 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.968 between residues 27 and 28
529507010375	HMMPfam hit to PF00884, Sulfatase, score 2e-26
529507010376	Signal peptide predicted for PMI2125 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.999 between residues 24 and 25
529507010377	Autotransporter beta-domain; Region: Autotransporter; pfam03797
529507010378	Signal peptide predicted for PMI2126 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.983 between residues 23 and 24
529507010379	PS00017 ATP/GTP-binding site motif A (P-loop).
529507010380	HMMPfam hit to PF03797, Autotransporter beta-domain, score 1.1e-16
529507010381	Lyase, N terminal; Region: Lyase_N; pfam09092
529507010382	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues; Region: GAG_Lyase; cd01083
529507010383	substrate binding site [chemical binding]; other site
529507010384	catalytic residues [active]
529507010385	Signal peptide predicted for PMI2127 by SignalP 2.0 HMM (Signal peptide probability 0.995) with cleavage site probability 0.641 between residues 24 and 25
529507010386	HMMPfam hit to PF02278, Polysaccharide lyase family 8, super-sandwic, score 3.4e-07
529507010387	Lyase, N terminal; Region: Lyase_N; pfam09092
529507010388	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues; Region: GAG_Lyase; cl17706
529507010389	substrate binding site [chemical binding]; other site
529507010390	catalytic residues [active]
529507010391	Signal peptide predicted for PMI2128 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.992 between residues 23 and 24
529507010392	Predicted unsaturated glucuronyl hydrolase involved in regulation of bacterial surface properties, and related proteins [General function prediction only]; Region: COG4225
529507010393	HMMPfam hit to PF07470, Glycosyl Hydrolase Family, score 1.5e-125
529507010394	2-deoxy-D-gluconate 3-dehydrogenase; Provisional; Region: PRK12481
529507010395	gluconate 5-dehydrogenase (Ga5DH)-like, classical (c) SDRs; Region: Ga5DH-like_SDR_c; cd05347
529507010396	NADP binding site [chemical binding]; other site
529507010397	homodimer interface [polypeptide binding]; other site
529507010398	active site
529507010399	HMMPfam hit to PF00106, short chain dehydrogenase, score 1.4e-82
529507010400	PS00061 Short-chain dehydrogenases/reductases family signature.
529507010401	5-keto-4-deoxyuronate isomerase; Provisional; Region: PRK00924
529507010402	HMMPfam hit to PF04962, 5-keto 4-deoxyuronate isomerase, score 3e-187
529507010403	PS00108 Serine/Threonine protein kinases active-site signature.
529507010404	N-acetylglucosamine-6-phosphate deacetylase [Carbohydrate transport and metabolism]; Region: NagA; COG1820
529507010405	N-acetylglucosamine-6-phosphate deacetylase, NagA, catalyzes the hydrolysis of the N-acetyl group of N-acetyl-glucosamine-6-phosphate (GlcNAc-6-P) to glucosamine 6-phosphate and acetate. This is the first committed step in the biosynthetic pathway to...; Region: NagA; cd00854
529507010406	active site
529507010407	dimer interface [polypeptide binding]; other site
529507010408	HMMPfam hit to PF01979, Amidohydrolase family, score 4e-06
529507010409	PTS_IIA, PTS system, mannose/sorbose specific IIA subunit. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. This family...; Region: PTS_IIA_man; cd00006
529507010410	active pocket/dimerization site; other site
529507010411	active site
529507010412	phosphorylation site [posttranslational modification]
529507010413	HMMPfam hit to PF03610, PTS system fructose IIA component, score 7.5e-31
529507010414	Phosphotransferase system, mannose/fructose/N-acetylgalactosamine-specific component IID [Carbohydrate transport and metabolism]; Region: ManZ; COG3716
529507010415	HMMPfam hit to PF03613, PTS system mannose/fructose/sorbose family I, score 4.2e-78
529507010416	4 probable transmembrane helices predicted for PMI2136 by TMHMM2.0 at aa 162-184, 205-227, 242-264 and 271-293
529507010417	Phosphotransferase system, mannose/fructose/N-acetylgalactosamine-specific component IIC [Carbohydrate transport and metabolism]; Region: ManY; COG3715
529507010418	4 probable transmembrane helices predicted for PMI2137 by TMHMM2.0 at aa 94-116, 136-158, 173-194 and 215-237
529507010419	HMMPfam hit to PF03609, PTS system sorbose-specific iic component, score 5.6e-72
529507010420	PTS_IIB, PTS system, Mannose/sorbose specific IIB subunit. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. This family...; Region: PTS_IIB_man; cd00001
529507010421	active site
529507010422	phosphorylation site [posttranslational modification]
529507010423	HMMPfam hit to PF03830, PTS system sorbose subfamily IIB componen, score 9.2e-60
529507010424	putative sugar isomerase, AgaS family; Region: agaS_fam; TIGR02815
529507010425	SIS (Sugar ISomerase) domain repeat 1 found in Glucosamine 6-phosphate synthase (GlmS) and Glucosamine-6-phosphate deaminase (GlmD). The SIS domain is found in many phosphosugar isomerases and phosphosugar binding proteins. GlmS contains a N-terminal...; Region: SIS_GlmS_GlmD_1; cd05008
529507010426	dimer interface [polypeptide binding]; other site
529507010427	active site
529507010428	AgaS-like protein. AgaS contains a SIS (Sugar ISomerase) domain which is found in many phosphosugar isomerases and phosphosugar binding proteins. AgaS is a putative isomerase in Escherichia coli. It is similar to the glucosamine-6-phosphate synthases; Region: SIS_AgaS_like; cd05010
529507010429	putative active site [active]
529507010430	HMMPfam hit to PF01380, SIS domain, score 0.0046
529507010431	HMMPfam hit to PF01380, SIS domain, score 5.3e-05
529507010432	tagatose 6-phosphate aldolase subunit KbaZ; Provisional; Region: PRK15458
529507010433	Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism]; Region: GlpR; COG1349
529507010434	helix_turn_helix, Deoxyribose operon repressor; Region: HTH_DEOR; smart00420
529507010435	DeoR C terminal sensor domain; Region: DeoRC; pfam00455
529507010436	HMMPfam hit to PF00455, Bacterial regulatory proteins, deoR family, score 3.1e-78
529507010437	Predicted helix-turn-helix motif with score 1130.000, SD 3.04 at aa 21-42, sequence TRVEDLAELFKVSSVTIRSDLS
529507010438	anaerobic sulfatase-maturating enzyme; Region: sulfatase_rSAM; TIGR03942
529507010439	Radical SAM superfamily. Enzymes of this family generate radicals by combining a 4Fe-4S cluster and S-adenosylmethionine (SAM) in close proximity. They are characterized by a conserved CxxxCxxC motif, which coordinates the conserved iron-sulfur cluster; Region: Radical_SAM; cd01335
529507010440	FeS/SAM binding site; other site
529507010441	radical SAM additional 4Fe4S-binding SPASM domain; Region: rSAM_more_4Fe4S; TIGR04085
529507010442	HMMPfam hit to PF04055, Radical SAM superfamily, score 1.2e-15
529507010443	Arylsulfatase A and related enzymes [Inorganic ion transport and metabolism]; Region: AslA; COG3119
529507010444	Sulfatase; Region: Sulfatase; pfam00884
529507010445	Signal peptide predicted for PMI2143 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.991 between residues 28 and 29
529507010446	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507010447	HMMPfam hit to PF00884, Sulfatase, score 5.6e-44
529507010448	PS00149 Sulfatases signature 2.
529507010449	Uncharacterized protein conserved in bacteria (DUF2264); Region: DUF2264; cl01752
529507010450	Tagatose-1,6-bisphosphate (TBP) aldolase and related Type B Class II aldolases. TBP aldolase is a tetrameric class II aldolase that catalyzes the reversible condensation of dihydroxyacetone phosphate with glyceraldehyde 3-phsophate to produce tagatose 1; Region: TBP_aldolase_IIB; cd00947
529507010451	fructose-bisphosphate aldolase; Provisional; Region: PRK09197
529507010452	intersubunit interface [polypeptide binding]; other site
529507010453	active site
529507010454	zinc binding site [ion binding]; other site
529507010455	Na+ binding site [ion binding]; other site
529507010456	HMMPfam hit to PF01116, Fructose-bisphosphate aldolase class-II, score 7.7e-131
529507010457	PS00602 Fructose-bisphosphate aldolase class-II signature 1.
529507010458	PS00806 Fructose-bisphosphate aldolase class-II signature 2.
529507010459	Sugar kinases, ribokinase family [Carbohydrate transport and metabolism]; Region: RbsK; COG0524
529507010460	2-keto-3-deoxygluconate kinase (KdgK) phosphorylates 2-keto-3-deoxygluconate (KDG) to form 2-keto-3-deoxy-6-phosphogluconate (KDGP). KDG is the common intermediate product, that allows organisms to channel D-glucuronate and/or D-galacturinate into the...; Region: KdgK; cd01166
529507010461	substrate binding site [chemical binding]; other site
529507010462	ATP binding site [chemical binding]; other site
529507010463	HMMPfam hit to PF00294, pfkB family carbohydrate kinase, score 7.4e-62
529507010464	PS00584 pfkB family of carbohydrate kinases signature 2.
529507010465	keto-hydroxyglutarate-aldolase/keto-deoxy- phosphogluconate aldolase; Provisional; Region: PRK05718
529507010466	KDPG and KHG aldolase; Region: KDPG_aldolase; cd00452
529507010467	active site
529507010468	intersubunit interface [polypeptide binding]; other site
529507010469	catalytic residue [active]
529507010470	HMMPfam hit to PF01081, KDPG and KHG aldolase, score 2.3e-83
529507010471	PS00160 KDPG and KHG aldolases Schiff-base forming residue.
529507010472	DJ-1 family protein; Region: not_thiJ; TIGR01383
529507010473	Type 1 glutamine amidotransferase (GATase1)-like domain found in Human DJ-1; Region: GATase1_DJ-1; cd03135
529507010474	conserved cys residue [active]
529507010475	HMMPfam hit to PF01965, DJ-1/PfpI family, score 2e-15
529507010476	Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism]; Region: DadA; COG0665
529507010477	hydroxyglutarate oxidase; Provisional; Region: PRK11728
529507010478	HMMPfam hit to PF01266, FAD dependent oxidoreductase, score 2.2e-72
529507010479	Signal peptide predicted for PMI2149 by SignalP 2.0 HMM (Signal peptide probability 0.978) with cleavage site probability 0.712 between residues 21 and 22
529507010480	Predicted epimerase, PhzC/PhzF homolog [General function prediction only]; Region: COG0384
529507010481	Diaminopimelate epimerase; Region: DAP_epimerase; pfam01678
529507010482	HMMPfam hit to PF02567, Phenazine biosynthesis-like protein, score 7e-49
529507010483	arsenical pump membrane protein; Provisional; Region: PRK15445
529507010484	Anion permease ArsB.  These permeases have been shown to export arsenate and antimonite in eubacteria and archaea.  A typical ArsB permease contains 8-13 transmembrane helices and can function either independently as a chemiosmotic transporter or as a...; Region: ArsB_permease; cd01118
529507010485	transmembrane helices; other site
529507010486	10 probable transmembrane helices predicted for PMI2152 by TMHMM2.0 at aa 7-26, 30-49, 56-78, 105-139, 146-168, 183-205, 236-270, 285-304, 324-343 and 414-436
529507010487	HMMPfam hit to PF02040, Arsenical pump membrane protein, score 0
529507010488	Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to...; Region: HTH_ARSR; cd00090
529507010489	dimerization interface [polypeptide binding]; other site
529507010490	putative DNA binding site [nucleotide binding]; other site
529507010491	putative Zn2+ binding site [ion binding]; other site
529507010492	HMMPfam hit to PF01022, Bacterial regulatory protein, arsR family, score 4.3e-24
529507010493	PS00846 Bacterial regulatory proteins, arsR family signature.
529507010494	Signal peptide predicted for PMI2154 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 1.000 between residues 20 and 21
529507010495	bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional; Region: PRK10792
529507010496	Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain; Region: THF_DHG_CYH; pfam00763
529507010497	NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase; Region: NAD_bind_m-THF_DH_Cyclohyd; cd01080
529507010498	homodimer interface [polypeptide binding]; other site
529507010499	NADP binding site [chemical binding]; other site
529507010500	substrate binding site [chemical binding]; other site
529507010501	PS00017 ATP/GTP-binding site motif A (P-loop).
529507010502	HMMPfam hit to PF00763, Tetrahydrofolate dehydrogenase/cyclohyd, score 4.8e-68
529507010503	HMMPfam hit to PF02882, Tetrahydrofolate dehydrogenase/cyclohyd, score 2.7e-104
529507010504	PS00767 Tetrahydrofolate dehydrogenase/cyclohydrolase signature 2.
529507010505	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507010506	ribosome-associated protein; Provisional; Region: PRK11507
529507010507	Fructose-1-phosphate kinase and related fructose-6-phosphate kinase (PfkB) [Carbohydrate transport and metabolism]; Region: FruK; COG1105
529507010508	1-phosphofructokinase (FruK), minor 6-phosphofructokinase (pfkB) and related sugar kinases. FruK plays an important role in the predominant pathway for fructose utilisation.This group also contains tagatose-6-phophate kinase, an enzyme of the tagatose...; Region: FruK_PfkB_like; cd01164
529507010509	putative substrate binding site [chemical binding]; other site
529507010510	putative ATP binding site [chemical binding]; other site
529507010511	HMMPfam hit to PF00294, pfkB family carbohydrate kinase, score 3.1e-55
529507010512	PS00583 pfkB family of carbohydrate kinases signature 1.
529507010513	PS00584 pfkB family of carbohydrate kinases signature 2.
529507010514	cysteinyl-tRNA synthetase; Validated; Region: cysS; PRK00260
529507010515	catalytic core domain of cysteinyl tRNA synthetase; Region: CysRS_core; cd00672
529507010516	active site
529507010517	HIGH motif; other site
529507010518	catalytic core domain of cysteinyl tRNA synthetase; Region: CysRS_core; cd00672
529507010519	KMSKS motif; other site
529507010520	Anticodon-binding domain of cysteinyl tRNA synthetases; Region: Anticodon_Ia_Cys; cd07963
529507010521	tRNA binding surface [nucleotide binding]; other site
529507010522	anticodon binding site; other site
529507010523	HMMPfam hit to PF01406, tRNA synthetases class I (C) catalytic d, score 9.4e-208
529507010524	cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E. coli cyclophilin A and Streptomyces antibioticus SanCyp18. Compared to the archetypal cyclophilin Human cyclophilin A, these...; Region: cyclophilin_EcCYP_like; cd01920
529507010525	substrate binding site [chemical binding]; other site
529507010526	HMMPfam hit to PF00160, Cyclophilin type peptidyl-prolyl cis-tr, score 2.1e-51
529507010527	PS00170 Cyclophilin-type peptidyl-prolyl cis-trans isomerase signature.
529507010528	Escherichia coli YbbF/LpxH and related proteins, metallophosphatase domain; Region: MPP_YbbF-LpxH; cd07398
529507010529	putative active site [active]
529507010530	putative metal binding site [ion binding]; other site
529507010531	HMMPfam hit to PF00149, Calcineurin-like phosphoesterase, score 1.7e-11
529507010532	Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism]; Region: PurE; COG0041
529507010533	HMMPfam hit to PF00731, AIR carboxylase, score 1.5e-98
529507010534	phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed; Region: PRK06019
529507010535	ATP-grasp domain; Region: ATP-grasp; pfam02222
529507010536	HMMPfam hit to PF02222, ATP-grasp domain, score 8.5e-16
529507010537	Major Facilitator Superfamily; Region: MFS_1; pfam07690
529507010538	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507010539	putative substrate translocation pore; other site
529507010540	Signal peptide predicted for PMI2163 by SignalP 2.0 HMM (Signal peptide probability 0.618) with cleavage site probability 0.409 between residues 29 and 30
529507010541	12 probable transmembrane helices predicted for PMI2163 by TMHMM2.0 at aa 16-38, 53-75, 82-99, 109-131, 138-160, 170-192, 231-253, 263-285, 297-319, 324-346, 353-375 and 380-402
529507010542	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 9.1e-25
529507010543	Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane]; Region: MscS; COG0668
529507010544	Mechanosensitive ion channel; Region: MS_channel; pfam00924
529507010545	Signal peptide predicted for PMI2164 by SignalP 2.0 HMM (Signal peptide probability 0.279) with cleavage site probability 0.173 between residues 29 and 30
529507010546	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507010547	4 probable transmembrane helices predicted for PMI2164 by TMHMM2.0 at aa 5-22, 34-53, 68-90 and 111-133
529507010548	HMMPfam hit to PF00924, Mechanosensitive ion channel, score 3.6e-72
529507010549	PS01246 Uncharacterized protein family UPF0003 signature.
529507010550	Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, permease component [Secondary metabolites biosynthesis, transport, and catabolism]; Region: COG3127
529507010551	FtsX-like permease family; Region: FtsX; pfam02687
529507010552	HMMPfam hit to PF02687, Predicted permease, score 4.1e-09
529507010553	10 probable transmembrane helices predicted for PMI2165 by TMHMM2.0 at aa 13-35, 245-264, 293-315, 335-355, 383-405, 409-431, 452-474, 691-713, 740-762 and 777-799
529507010554	HMMPfam hit to PF02687, Predicted permease, score 1.5e-16
529507010555	HMMPfam hit to PF03929, no description, score 2.8
529507010556	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507010557	Signal peptide predicted for PMI2165 by SignalP 2.0 HMM (Signal peptide probability 0.997) with cleavage site probability 0.437 between residues 27 and 28
529507010558	putative ABC transporter ATP-binding protein YbbA; Provisional; Region: PRK10584
529507010559	ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein; Region: ABC_MJ0796_LolCDE_FtsE; cd03255
529507010560	Walker A/P-loop; other site
529507010561	ATP binding site [chemical binding]; other site
529507010562	Q-loop/lid; other site
529507010563	ABC transporter signature motif; other site
529507010564	Walker B; other site
529507010565	D-loop; other site
529507010566	H-loop/switch region; other site
529507010567	HMMPfam hit to PF00005, ABC transporter, score 3.8e-51
529507010568	PS00211 ABC transporters family signature.
529507010569	PS00017 ATP/GTP-binding site motif A (P-loop).
529507010570	Lysophospholipase L1-like subgroup of SGNH-hydrolases. The best characterized member in this family is TesA, an E. coli periplasmic protein with thioesterase, esterase, arylesterase, protease and lysophospholipase activity; Region: Lysophospholipase_L1_like; cd01822
529507010571	active site
529507010572	catalytic triad [active]
529507010573	oxyanion hole [active]
529507010574	switch loop; other site
529507010575	Signal peptide predicted for PMI2167 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.995 between residues 26 and 27
529507010576	1 probable transmembrane helix predicted for PMI2167 by TMHMM2.0 at aa 12-34
529507010577	HMMPfam hit to PF00657, GDSL-like Lipase/Acylhydrolase, score 5.3e-30
529507010578	PS01098 Lipolytic enzymes G-D-S-L family, serine active site.
529507010579	oxidoreductase; Provisional; Region: PRK08017
529507010580	17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs; Region: 17beta-HSD-like_SDR_c; cd05374
529507010581	NADP binding site [chemical binding]; other site
529507010582	active site
529507010583	steroid binding site; other site
529507010584	Signal peptide predicted for PMI2168 by SignalP 2.0 HMM (Signal peptide probability 0.852) with cleavage site probability 0.769 between residues 19 and 20
529507010585	HMMPfam hit to PF00106, short chain dehydrogenase, score 5.9e-46
529507010586	PS00061 Short-chain dehydrogenases/reductases family signature.
529507010587	Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones]; Region: COG3118
529507010588	ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain. Its gene has been sequenced from several gammaproteobacteria and actinobacteria; Region: ybbN; cd02956
529507010589	Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi; Region: TPR; cd00189
529507010590	TPR motif; other site
529507010591	binding surface
529507010592	HMMPfam hit to PF00085, Thioredoxin, score 9.3e-12
529507010593	HMMPfam hit to PF07719, no description, score 0.022
529507010594	Membrane protease subunits, stomatin/prohibitin homologs [Posttranslational modification, protein turnover, chaperones]; Region: HflC; COG0330
529507010595	Band_7_stomatin_like: A subgroup of the band 7 domain of flotillin (reggie) like proteins similar to stomatin and podicin (two lipid raft-associated integral membrane proteins). Individual proteins of this band 7 domain family may cluster to form...; Region: Band_7_stomatin_like; cd03403
529507010596	1 probable transmembrane helix predicted for PMI2170 by TMHMM2.0 at aa 7-29
529507010597	HMMPfam hit to PF01145, SPFH domain / Band, score 1.1e-74
529507010598	PS01270 Band 7 protein family signature.
529507010599	Membrane protein implicated in regulation of membrane protease activity [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion]; Region: COG1585
529507010600	3 probable transmembrane helices predicted for PMI2171 by TMHMM2.0 at aa 4-23, 30-49 and 53-75
529507010601	HMMPfam hit to PF01957, Nodulation efficiency protein D (NfeD), score 1.6e-36
529507010602	DNA-binding transcriptional regulator CueR; Provisional; Region: PRK10227
529507010603	Helix-Turn-Helix DNA binding domain of CueR-like transcription regulators; Region: HTH_CueR; cd01108
529507010604	DNA binding residues [nucleotide binding]
529507010605	dimer interface [polypeptide binding]; other site
529507010606	copper binding site [ion binding]; other site
529507010607	HMMPfam hit to PF00376, MerR family regulatory protein, score 8.2e-12
529507010608	PS00552 Bacterial regulatory proteins, merR family signature.
529507010609	Predicted helix-turn-helix motif with score 1498.000, SD 4.29 at aa 1-22, sequence MNISEIATKTGLTTKAIRFYEE
529507010610	Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones. HMA domain...; Region: HMA; cd00371
529507010611	metal-binding site [ion binding]
529507010612	Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones. HMA domain...; Region: HMA; cd00371
529507010613	metal-binding site [ion binding]
529507010614	copper exporting ATPase; Provisional; Region: copA; PRK10671
529507010615	Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones. HMA domain...; Region: HMA; cd00371
529507010616	metal-binding site [ion binding]
529507010617	Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones. HMA domain...; Region: HMA; cd00371
529507010618	metal-binding site [ion binding]
529507010619	E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122
529507010620	Haloacid dehalogenase-like hydrolases. The haloacid dehalogenase-like (HAD) superfamily includes L-2-haloacid dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, and many others; Region: HAD_like; cd01427
529507010621	motif II; other site
529507010622	HMMPfam hit to PF00403, Heavy-metal-associated domain, score 0.00057
529507010623	HMMPfam hit to PF00403, Heavy-metal-associated domain, score 7.1e-07
529507010624	HMMPfam hit to PF00403, Heavy-metal-associated domain, score 5.6e-11
529507010625	PS01047 Heavy-metal-associated domain.
529507010626	HMMPfam hit to PF00403, Heavy-metal-associated domain, score 1e-14
529507010627	PS01047 Heavy-metal-associated domain.
529507010628	8 probable transmembrane helices predicted for PMI2173 by TMHMM2.0 at aa 339-356, 366-388, 401-423, 433-452, 586-608, 613-635, 928-947 and 952-974
529507010629	HMMPfam hit to PF00122, E1-E2 ATPase, score 5.8e-89
529507010630	HMMPfam hit to PF00702, haloacid dehalogenase-like hydrolase, score 7e-38
529507010631	PS00154 E1-E2 ATPases phosphorylation site.
529507010632	PS01229 Hypothetical cof family signature 2.
529507010633	Predicted helix-turn-helix motif with score 1358.000, SD 3.81 at aa 905-926, sequence HSLHGVADAVEISKGTLRNMKQ
529507010634	YadA-like C-terminal region; Region: YadA; pfam03895
529507010635	Signal peptide predicted for PMI2174 by SignalP 2.0 HMM (Signal peptide probability 0.998) with cleavage site probability 0.990 between residues 21 and 22
529507010636	HMMPfam hit to PF03895, YadA-like C-terminal region, score 6.4e-07
529507010637	TraB family; Region: TraB; cl12050
529507010638	HMMPfam hit to PF07446, GumN protein, score 9.5e-07
529507010639	This CD includes cysteinyl-tRNA(Pro) deacylases from Haemophilus influenzae and Escherichia coli and other related bacterial proteins. These trans-acting, single-domain proteins are homologs of ProX and also the cis-acting prolyl-tRNA synthetase (ProRS)...; Region: YbaK_deacylase; cd00002
529507010640	putative deacylase active site [active]
529507010641	HMMPfam hit to PF04073, YbaK / prolyl-tRNA synthetases associated do, score 1.1e-67
529507010642	bifunctional UDP-sugar hydrolase/5'-nucleotidase periplasmic precursor; Reviewed; Region: ushA; PRK09558
529507010643	Escherichia coli UshA and related proteins, N-terminal metallophosphatase domain; Region: MPP_UshA_N; cd07405
529507010644	active site
529507010645	metal binding site [ion binding]; metal-binding site
529507010646	5'-nucleotidase, C-terminal domain; Region: 5_nucleotid_C; pfam02872
529507010647	HMMPfam hit to PF02872, 5'-nucleotidase, C-terminal domain, score 7.7e-45
529507010648	HMMPfam hit to PF00149, Calcineurin-like phosphoesterase, score 2.1e-21
529507010649	PS00786 5'-nucleotidase signature 2.
529507010650	PS00785 5'-nucleotidase signature 1.
529507010651	Signal peptide predicted for PMI2177 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.585 between residues 25 and 26
529507010652	Helix-turn-helix domain; Region: HTH_OrfB_IS605; pfam12323
529507010653	Transposase and inactivated derivatives [DNA replication, recombination, and repair]; Region: COG0675
529507010654	Probable transposase; Region: OrfB_IS605; pfam01385
529507010655	transposase, IS605 OrfB family, central region; Region: tspaseT_teng_C; TIGR01766
529507010656	HMMPfam hit to PF01385, Probable transposase, score 1.4e-129
529507010657	Transposase IS200 like; Region: Y1_Tnp; pfam01797
529507010658	HMMPfam hit to PF01797, Transposase IS200 like, score 5.3e-25
529507010659	putative cation:proton antiport protein; Provisional; Region: PRK10669
529507010660	Kef-type K+ transport system, predicted NAD-binding component [Inorganic ion transport and metabolism]; Region: RosB; COG4651
529507010661	TrkA-N domain; Region: TrkA_N; pfam02254
529507010662	11 probable transmembrane helices predicted for PMI2180 by TMHMM2.0 at aa 4-23, 30-52, 56-78, 87-109, 114-136, 149-171, 186-208, 228-247, 303-325, 337-359 and 369-388
529507010663	PS00017 ATP/GTP-binding site motif A (P-loop).
529507010664	HMMPfam hit to PF02254, TrkA-N domain, score 1.3e-25
529507010665	inosine/guanosine kinase; Provisional; Region: PRK15074
529507010666	Sugar kinases, ribokinase family [Carbohydrate transport and metabolism]; Region: RbsK; COG0524
529507010667	substrate binding site [chemical binding]; other site
529507010668	ATP binding site [chemical binding]; other site
529507010669	HMMPfam hit to PF00294, pfkB family carbohydrate kinase, score 9.5e-26
529507010670	PS00584 pfkB family of carbohydrate kinases signature 2.
529507010671	LPS O-antigen length regulator; Provisional; Region: PRK10381
529507010672	Chain length determinant protein; Region: Wzz; pfam02706
529507010673	G-rich domain on putative tyrosine kinase; Region: GNVR; pfam13807
529507010674	3 probable transmembrane helices predicted for PMI2182 by TMHMM2.0 at aa 10-27, 86-108 and 384-406
529507010675	HMMPfam hit to PF02706, Chain length determinant protein, score 1.2e-17
529507010676	PS00141 Eukaryotic and viral aspartyl proteases active site.
529507010677	ferrochelatase; Reviewed; Region: hemH; PRK00035
529507010678	Ferrochelatase, N-terminal domain: Ferrochelatase (protoheme ferrolyase or HemH) is the terminal enzyme of the heme biosynthetic pathway. It catalyzes the insertion of ferrous iron into the protoporphyrin IX ring yielding protoheme. This enzyme is...; Region: Ferrochelatase_N; cd03411
529507010679	C-terminal domain interface [polypeptide binding]; other site
529507010680	active site
529507010681	Ferrochelatase, C-terminal domain: Ferrochelatase (protoheme ferrolyase or HemH) is the terminal enzyme of the heme biosynthetic pathway. It catalyzes the insertion of ferrous iron into the protoporphyrin IX ring yielding protoheme. This enzyme is...; Region: Ferrochelatase_C; cd00419
529507010682	active site
529507010683	N-terminal domain interface [polypeptide binding]; other site
529507010684	HMMPfam hit to PF00762, Ferrochelatase, score 3.8e-127
529507010685	PS00534 Ferrochelatase signature.
529507010686	adenylate kinase; Reviewed; Region: adk; PRK00279
529507010687	Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP). This enzyme is required for the biosynthesis of ADP and is essential for...; Region: ADK; cd01428
529507010688	AMP-binding site [chemical binding]; other site
529507010689	ATP-AMP (Ap5A)-binding site [chemical binding]; other site
529507010690	HMMPfam hit to PF00406, Adenylate kinase, score 1.8e-93
529507010691	HMMPfam hit to PF05191, Adenylate kinase, active site lid, score 1.2e-19
529507010692	PS00113 Adenylate kinase signature.
529507010693	heat shock protein 90; Provisional; Region: PRK05218
529507010694	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
529507010695	ATP binding site [chemical binding]; other site
529507010696	Mg2+ binding site [ion binding]; other site
529507010697	G-X-G motif; other site
529507010698	HMMPfam hit to PF00183, Hsp90 protein, score 2.3e-91
529507010699	HMMPfam hit to PF02518, Histidine kinase-, DNA gyrase B-, and HSP90, score 5.7e-18
529507010700	PS00298 Heat shock hsp90 proteins family signature.
529507010701	phosphoribosylglycinamide formyltransferase 2; Validated; Region: purT; PRK09288
529507010702	Carbamoyl-phosphate synthase L chain, N-terminal domain; Region: CPSase_L_chain; pfam00289
529507010703	ATP-grasp domain; Region: ATP-grasp; pfam02222
529507010704	HMMPfam hit to PF02222, ATP-grasp domain, score 5.4e-26
529507010705	EamA-like transporter family; Region: EamA; cl17759
529507010706	Predicted permeases [General function prediction only]; Region: RarD; COG2962
529507010707	9 probable transmembrane helices predicted for PMI2188 by TMHMM2.0 at aa 30-52, 59-78, 93-115, 120-142, 166-188, 197-219, 234-253, 260-282 and 292-309
529507010708	HMMPfam hit to PF00892, Integral membrane protein DUF6, score 1e-08
529507010709	Sugar kinases, ribokinase family [Carbohydrate transport and metabolism]; Region: RbsK; COG0524
529507010710	Fructokinases (FRKs) mainly from bacteria and plants are enzymes with high specificity for fructose, as are all FRKs, but they catalyzes the conversion of fructose to fructose-6-phosphate, which is an entry point into glycolysis via conversion into...; Region: bac_FRK; cd01167
529507010711	putative substrate binding site [chemical binding]; other site
529507010712	putative ATP binding site [chemical binding]; other site
529507010713	HMMPfam hit to PF00294, pfkB family carbohydrate kinase, score 3.4e-77
529507010714	PS00584 pfkB family of carbohydrate kinases signature 2.
529507010715	PS00583 pfkB family of carbohydrate kinases signature 1.
529507010716	Beta-fructosidases (levanase/invertase) [Carbohydrate transport and metabolism]; Region: SacC; COG1621
529507010717	Glycosyl hydrolase family 32, beta-fructosidases; Region: GH32_B_Fructosidase; cd08996
529507010718	substrate binding [chemical binding]; other site
529507010719	active site
529507010720	Glycosyl hydrolases family 32 C terminal; Region: Glyco_hydro_32C; pfam08244
529507010721	HMMPfam hit to PF00251, Glycosyl hydrolases family, score 4.5e-166
529507010722	Transcriptional regulators [Transcription]; Region: PurR; COG1609
529507010723	Helix-turn-helix (HTH) DNA binding domain of the LacI family of transcriptional regulators; Region: HTH_LacI; cd01392
529507010724	DNA binding site [nucleotide binding]
529507010725	domain linker motif; other site
529507010726	Ligand-binding domain of DNA-binding regulatory proteins specific to sucrose that are members of the LacI-GalR family of bacterial transcription repressors; Region: PBP1_sucrose_transcription_regulator; cd06288
529507010727	putative ligand binding site [chemical binding]; other site
529507010728	putative dimerization interface [polypeptide binding]; other site
529507010729	HMMPfam hit to PF00532, Periplasmic binding proteins and sugar b, score 5.1e-47
529507010730	HMMPfam hit to PF00356, Bacterial regulatory proteins, lacI fami, score 7e-11
529507010731	Predicted helix-turn-helix motif with score 1737.000, SD 5.10 at aa 2-23, sequence ASLKDVARLASVSLMTVSRAIN
529507010732	PS00356 Bacterial regulatory proteins, lacI family signature.
529507010733	Response regulator [Signal transduction mechanisms]; Region: TtrR; COG4566
529507010734	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
529507010735	active site
529507010736	dimerization interface [polypeptide binding]; other site
529507010737	C-terminal DNA-binding domain of LuxR-like proteins. This domain contains a helix-turn-helix motif and binds DNA. Proteins belonging to this group are response regulators; some act as transcriptional activators, others as transcriptional repressors. Many...; Region: LuxR_C_like; cd06170
529507010738	DNA binding residues [nucleotide binding]
529507010739	dimerization interface [polypeptide binding]; other site
529507010740	HMMPfam hit to PF00196, Bacterial regulatory proteins, luxR family, score 3.9e-23
529507010741	Predicted helix-turn-helix motif with score 1237.000, SD 3.40 at aa 161-182, sequence NTSKEAAEKLSLSPRTVEVHRS
529507010742	Phosphatidylglycerophosphate synthase [Lipid metabolism]; Region: PgsA; COG0558
529507010743	Signal peptide predicted for PMI2193 by SignalP 2.0 HMM (Signal peptide probability 0.931) with cleavage site probability 0.802 between residues 58 and 59
529507010744	4 probable transmembrane helices predicted for PMI2193 by TMHMM2.0 at aa 34-56, 60-79, 112-134 and 185-207
529507010745	HMMPfam hit to PF01066, CDP-alcohol phosphatidyltransferase, score 0.00093
529507010746	1-acyl-sn-glycerol-3-phosphate acyltransferase [Lipid metabolism]; Region: PlsC; COG0204
529507010747	Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: AGPAT-like; Region: LPLAT_AGPAT-like; cd07989
529507010748	putative acyl-acceptor binding pocket; other site
529507010749	HMMPfam hit to PF01553, Acyltransferase, score 1.2e-09
529507010750	Predicted CDP-diglyceride synthetase/phosphatidate cytidylyltransferase [General function prediction only]; Region: COG4589
529507010751	CDP-diglyceride synthetase [Lipid metabolism]; Region: CdsA; COG0575
529507010752	Signal peptide predicted for PMI2195 by SignalP 2.0 HMM (Signal peptide probability 0.844) with cleavage site probability 0.567 between residues 30 and 31
529507010753	8 probable transmembrane helices predicted for PMI2195 by TMHMM2.0 at aa 10-32, 52-74, 94-111, 118-136, 151-173, 180-202, 222-240 and 247-269
529507010754	HMMPfam hit to PF01148, Cytidylyltransferase family, score 6e-78
529507010755	CAAX protease self-immunity; Region: Abi; pfam02517
529507010756	Signal peptide predicted for PMI2196 by SignalP 2.0 HMM (Signal peptide probability 0.998) with cleavage site probability 0.593 between residues 21 and 22
529507010757	7 probable transmembrane helices predicted for PMI2196 by TMHMM2.0 at aa 20-52, 65-87, 107-129, 142-164, 168-185, 206-238 and 248-270
529507010758	HMMPfam hit to PF02517, CAAX amino terminal protease family, score 4.1e-14
529507010759	DNA-binding transcriptional activator AllS; Provisional; Region: PRK10094
529507010760	Bacterial regulatory helix-turn-helix protein, lysR family; Region: HTH_1; pfam00126
529507010761	The substrate binding domain of LysR-type transcriptional regulators (LTTRs), a member of the type 2 periplasmic binding fold protein superfamily; Region: PBP2_LTTR_substrate; cl11398
529507010762	dimerization interface [polypeptide binding]; other site
529507010763	HMMPfam hit to PF00126, Bacterial regulatory helix-turn-helix, score 2.8e-21
529507010764	Predicted helix-turn-helix motif with score 1405.000, SD 3.97 at aa 46-67, sequence QSFTKAAEMLHKTSAAISYRIK
529507010765	HMMPfam hit to PF03466, LysR substrate binding domain, score 3.9e-10
529507010766	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507010767	phosphoglycerate transporter family protein; Region: 2A0104; TIGR00881
529507010768	putative substrate translocation pore; other site
529507010769	HMMPfam hit to PF00083, Sugar (and other) transporter, score 1.4e-05
529507010770	11 probable transmembrane helices predicted for PMI2198 by TMHMM2.0 at aa 20-42, 55-77, 97-119, 140-162, 177-195, 227-249, 264-286, 293-310, 320-342, 355-377 and 387-404
529507010771	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 1.7e-58
529507010772	carbamate kinase-like carbamoyl phosphate synthetase; Reviewed; Region: PRK12454
529507010773	AAK_CK: Carbamate kinase (CK) catalyzes both the ATP-phosphorylation of carbamate and carbamoyl phosphate (CP) utilization with the production of ATP from ADP and CP. Both CK (this CD) and nonhomologous CP synthetase synthesize carbamoyl phosphate, an...; Region: AAK_CK; cd04235
529507010774	putative substrate binding site [chemical binding]; other site
529507010775	nucleotide binding site [chemical binding]; other site
529507010776	nucleotide binding site [chemical binding]; other site
529507010777	homodimer interface [polypeptide binding]; other site
529507010778	HMMPfam hit to PF00696, Amino acid kinase family, score 9.4e-78
529507010779	Protein of unknown function (DUF2877); Region: DUF2877; pfam11392
529507010780	Protein of unknown function (DUF1116); Region: DUF1116; pfam06545
529507010781	HMMPfam hit to PF06545, Protein of unknown function (DUF1116), score 1.9e-280
529507010782	membrane protein FdrA; Validated; Region: PRK06091
529507010783	CoA binding domain; Region: CoA_binding; pfam02629
529507010784	CoA-ligase; Region: Ligase_CoA; pfam00549
529507010785	HMMPfam hit to PF06263, Bacterial FdrA protein, score 9.6e-277
529507010786	PS00213 Lipocalin signature.
529507010787	Isochorismatase family; Region: Isochorismatase; pfam00857
529507010788	YcaC related amidohydrolases; E.coli YcaC is an homooctameric hydrolase with unknown specificity. Despite its weak sequence similarity, it is structurally related to other amidohydrolases and shares conserved active site residues with them; Region: YcaC_related; cd01012
529507010789	catalytic triad [active]
529507010790	dimer interface [polypeptide binding]; other site
529507010791	conserved cis-peptide bond; other site
529507010792	HMMPfam hit to PF00857, Isochorismatase family, score 1.6e-17
529507010793	Pirin-related protein [General function prediction only]; Region: COG1741
529507010794	Pirin; Region: Pirin; pfam02678
529507010795	Pirin C-terminal cupin domain; Region: Pirin_C; pfam05726
529507010796	HMMPfam hit to PF02678, Pirin, score 4.6e-49
529507010797	HMMPfam hit to PF05726, Pirin C-terminal region, score 1.6e-36
529507010798	LysR family transcriptional regulator; Provisional; Region: PRK14997
529507010799	Bacterial regulatory helix-turn-helix protein, lysR family; Region: HTH_1; pfam00126
529507010800	The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold; Region: PBP2_CrgA_like_4; cd08473
529507010801	putative effector binding pocket; other site
529507010802	putative dimerization interface [polypeptide binding]; other site
529507010803	HMMPfam hit to PF03466, LysR substrate binding domain, score 6.1e-39
529507010804	HMMPfam hit to PF00126, Bacterial regulatory helix-turn-helix, score 1.7e-15
529507010805	Predicted helix-turn-helix motif with score 1396.000, SD 3.94 at aa 18-39, sequence GGFSQAAETLGIPKSKLSRRIA
529507010806	Di- and tricarboxylate transporters [Inorganic ion transport and metabolism]; Region: CitT; COG0471
529507010807	Anion permease ArsB/NhaD.  These permeases have been shown to translocate sodium, arsenate, antimonite, sulfate and organic anions across biological membranes in all three kingdoms of life.  A typical anion permease contains 8-13 transmembrane helices...; Region: ArsB_NhaD_permease; cd00625
529507010808	transmembrane helices; other site
529507010809	HMMPfam hit to PF00939, Sodium:sulfate symporter transmembrane, score 7.1e-182
529507010810	12 probable transmembrane helices predicted for PMI2206 by TMHMM2.0 at aa 13-32, 47-69, 90-107, 117-139, 193-215, 230-252, 273-295, 310-329, 342-361, 376-398, 410-432 and 465-487
529507010811	fimbrial operon 10
529507010812	Predicted transcriptional regulators [Transcription]; Region: HipB; COG1396
529507010813	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
529507010814	non-specific DNA binding site [nucleotide binding]; other site
529507010815	salt bridge; other site
529507010816	sequence-specific DNA binding site [nucleotide binding]; other site
529507010817	HMMPfam hit to PF01381, Helix-turn-helix, score 1.1e-08
529507010818	Predicted helix-turn-helix motif with score 1545.000, SD 4.45 at aa 39-60, sequence MTGSELGALLGVSQQHQSRFEN
529507010819	putative major fimbrial protein SthE; Provisional; Region: PRK15292
529507010820	P pilus assembly protein, pilin FimA [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimA; COG3539
529507010821	HMMPfam hit to PF00419, Fimbrial protein, score 7.5e-09
529507010822	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507010823	Signal peptide predicted for PMI2208 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.951 between residues 24 and 25
529507010824	Predicted transcriptional regulators [Transcription]; Region: HipB; COG1396
529507010825	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
529507010826	non-specific DNA binding site [nucleotide binding]; other site
529507010827	salt bridge; other site
529507010828	sequence-specific DNA binding site [nucleotide binding]; other site
529507010829	HMMPfam hit to PF01381, Helix-turn-helix, score 5.7e-13
529507010830	Predicted helix-turn-helix motif with score 2304.000, SD 7.03 at aa 40-61, sequence LTLSELAKKIGISQQQQSRYER
529507010831	P pilus assembly protein, pilin FimA [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimA; COG3539
529507010832	HMMPfam hit to PF00419, Fimbrial protein, score 3.1e-07
529507010833	Signal peptide predicted for PMI2210 by SignalP 2.0 HMM (Signal peptide probability 0.998) with cleavage site probability 0.992 between residues 19 and 20
529507010834	P pilus assembly protein, pilin FimA [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimA; COG3539
529507010835	HMMPfam hit to PF00419, Fimbrial protein, score 2.3e-16
529507010836	1 probable transmembrane helix predicted for PMI2211 by TMHMM2.0 at aa 7-29
529507010837	Signal peptide predicted for PMI2211 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.784 between residues 22 and 23
529507010838	P pilus assembly protein, porin PapC [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimD; COG3188
529507010839	PapC N-terminal domain; Region: PapC_N; pfam13954
529507010840	Type VII secretion system (T7SS), usher protein; Region: Usher; pfam00577
529507010841	PapC C-terminal domain; Region: PapC_C; pfam13953
529507010842	HMMPfam hit to PF00577, Fimbrial Usher protein, score 0
529507010843	PS01151 Fimbrial biogenesis outer membrane usher protein signature.
529507010844	Signal peptide predicted for PMI2212 by SignalP 2.0 HMM (Signal peptide probability 0.987) with cleavage site probability 0.955 between residues 22 and 23
529507010845	putative chaperone protein EcpD; Provisional; Region: PRK09926
529507010846	Gram-negative pili assembly chaperone, N-terminal domain; Region: Pili_assembly_N; pfam00345
529507010847	Gram-negative pili assembly chaperone, C-terminal domain; Region: Pili_assembly_C; pfam02753
529507010848	HMMPfam hit to PF02753, Gram-negative pili assembly chaperone, score 2.7e-13
529507010849	HMMPfam hit to PF00345, Gram-negative pili assembly chaperone, score 8.6e-54
529507010850	PS00635 Gram-negative pili assembly chaperone signature.
529507010851	1 probable transmembrane helix predicted for PMI2213 by TMHMM2.0 at aa 4-26
529507010852	Signal peptide predicted for PMI2213 by SignalP 2.0 HMM (Signal peptide probability 0.989) with cleavage site probability 0.972 between residues 19 and 20
529507010853	Fimbrial protein; Region: Fimbrial; cl01416
529507010854	HMMPfam hit to PF00419, Fimbrial protein, score 3.1e-42
529507010855	Signal peptide predicted for PMI2214 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.999 between residues 23 and 24
529507010856	Dyp-type peroxidase family; Region: Dyp_perox; cl01067
529507010857	HMMPfam hit to PF04261, Dyp-type peroxidase family, score 8.7e-92
529507010858	fimbrial operon 11
529507010859	Signal peptide predicted for PMI2216 by SignalP 2.0 HMM (Signal peptide probability 0.993) with cleavage site probability 0.770 between residues 20 and 21
529507010860	Fimbrial protein; Region: Fimbrial; pfam00419
529507010861	Signal peptide predicted for PMI2217 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.999 between residues 22 and 23
529507010862	P pilus assembly protein, pilin FimA [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimA; COG3539
529507010863	HMMPfam hit to PF00419, Fimbrial protein, score 8.4e-11
529507010864	1 probable transmembrane helix predicted for PMI2218 by TMHMM2.0 at aa 12-31
529507010865	Signal peptide predicted for PMI2218 by SignalP 2.0 HMM (Signal peptide probability 0.964) with cleavage site probability 0.872 between residues 25 and 26
529507010866	1 probable transmembrane helix predicted for PMI2219 by TMHMM2.0 at aa 7-29
529507010867	Signal peptide predicted for PMI2219 by SignalP 2.0 HMM (Signal peptide probability 0.996) with cleavage site probability 0.995 between residues 25 and 26
529507010868	P pilus assembly protein, chaperone PapD [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimC; COG3121
529507010869	Gram-negative pili assembly chaperone, N-terminal domain; Region: Pili_assembly_N; pfam00345
529507010870	Gram-negative pili assembly chaperone, C-terminal domain; Region: Pili_assembly_C; pfam02753
529507010871	HMMPfam hit to PF02753, Gram-negative pili assembly chaperone, score 3.8e-12
529507010872	HMMPfam hit to PF00345, Gram-negative pili assembly chaperone, score 4.3e-44
529507010873	PS00635 Gram-negative pili assembly chaperone signature.
529507010874	Signal peptide predicted for PMI2220 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.991 between residues 19 and 20
529507010875	putative fimbrial outer membrane usher protein StfC; Provisional; Region: PRK15284
529507010876	PapC N-terminal domain; Region: PapC_N; pfam13954
529507010877	Type VII secretion system (T7SS), usher protein; Region: Usher; pfam00577
529507010878	PapC C-terminal domain; Region: PapC_C; pfam13953
529507010879	HMMPfam hit to PF00577, Fimbrial Usher protein, score 5.2e-285
529507010880	PS01151 Fimbrial biogenesis outer membrane usher protein signature.
529507010881	Signal peptide predicted for PMI2221 by SignalP 2.0 HMM (Signal peptide probability 0.957) with cleavage site probability 0.955 between residues 23 and 24
529507010882	P pilus assembly protein, pilin FimA [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimA; COG3539
529507010883	HMMPfam hit to PF00419, Fimbrial protein, score 2.1e-11
529507010884	Signal peptide predicted for PMI2222 by SignalP 2.0 HMM (Signal peptide probability 0.997) with cleavage site probability 0.844 between residues 21 and 22
529507010885	P pilus assembly protein, pilin FimA [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimA; COG3539
529507010886	HMMPfam hit to PF00419, Fimbrial protein, score 3.7e-37
529507010887	Signal peptide predicted for PMI2223 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.979 between residues 23 and 24
529507010888	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
529507010889	non-specific DNA binding site [nucleotide binding]; other site
529507010890	salt bridge; other site
529507010891	sequence-specific DNA binding site [nucleotide binding]; other site
529507010892	HMMPfam hit to PF01381, Helix-turn-helix, score 1.5e-12
529507010893	Predicted helix-turn-helix motif with score 2046.000, SD 6.16 at aa 31-52, sequence LTGAQLGELLDVSQQQISRYEN
529507010894	Predicted metal-dependent phosphoesterases (PHP family) [General function prediction only]; Region: COG0613
529507010895	Polymerase and Histidinol Phosphatase domain of Histidinol phosphate phosphatase (HisPPase) AMP bound; Region: PHP_HisPPase_AMP; cd07438
529507010896	active site
529507010897	Polymerase and Histidinol Phosphatase domain of Histidinol phosphate phosphatase (HisPPase) AMP bound; Region: PHP_HisPPase_AMP; cd07438
529507010898	HMMPfam hit to PF02231, PHP domain N-terminal region, score 1.2e-15
529507010899	PTS system, beta-glucoside-specific IIABC component; Region: PTS-II-ABC-beta; TIGR01995
529507010900	PTS_IIB, PTS system, glucose/sucrose specific IIB subunit. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. This family...; Region: PTS_IIB_glc; cd00212
529507010901	active site turn [active]
529507010902	phosphorylation site [posttranslational modification]
529507010903	Phosphotransferase system IIC components, glucose/maltose/N-acetylglucosamine-specific [Carbohydrate transport and metabolism]; Region: PtsG; COG1263
529507010904	Phosphotransferase system IIA components [Carbohydrate transport and metabolism]; Region: NagE; COG2190
529507010905	HPr interaction site; other site
529507010906	glycerol kinase (GK) interaction site [polypeptide binding]; other site
529507010907	active site
529507010908	phosphorylation site [posttranslational modification]
529507010909	HMMPfam hit to PF00358, phosphoenolpyruvate-dependent sugar phosph, score 2.9e-49
529507010910	8 probable transmembrane helices predicted for PMI2226 by TMHMM2.0 at aa 114-136, 143-165, 210-232, 239-261, 276-298, 353-375, 390-412 and 425-447
529507010911	HMMPfam hit to PF02378, Phosphotransferase system, EIIC, score 4.8e-39
529507010912	HMMPfam hit to PF00367, phosphotransferase system, EIIB, score 1e-14
529507010913	transcriptional antiterminator BglG; Provisional; Region: PRK09772
529507010914	CAT RNA binding domain; Region: CAT_RBD; smart01061
529507010915	PRD domain; Region: PRD; pfam00874
529507010916	PRD domain; Region: PRD; pfam00874
529507010917	HMMPfam hit to PF00874, PRD domain, score 9.4e-12
529507010918	HMMPfam hit to PF00874, PRD domain, score 6.1e-13
529507010919	HMMPfam hit to PF03123, CAT RNA binding domain, score 1.1e-17
529507010920	Acetyltransferase (GNAT) domain; Region: Acetyltransf_10; pfam13673
529507010921	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cd04301
529507010922	Coenzyme A binding pocket [chemical binding]; other site
529507010923	HMMPfam hit to PF00583, Acetyltransferase (GNAT) family, score 4.2e-14
529507010924	Fic/DOC family; Region: Fic; pfam02661
529507010925	HMMPfam hit to PF02661, Fic protein family, score 4.6e-27
529507010926	Carboxylate/Amino Acid/Amine Transporter; Region: 2A78; TIGR00950
529507010927	10 probable transmembrane helices predicted for PMI2231 by TMHMM2.0 at aa 7-29, 34-56, 69-91, 95-114, 127-144, 154-176, 189-211, 221-243, 250-269 and 279-301
529507010928	HMMPfam hit to PF00892, Integral membrane protein DUF6, score 1.9e-18
529507010929	HMMPfam hit to PF00892, Integral membrane protein DUF6, score 6.1e-07
529507010930	Signal peptide predicted for PMI2231 by SignalP 2.0 HMM (Signal peptide probability 0.950) with cleavage site probability 0.732 between residues 27 and 28
529507010931	Transcriptional regulator [Transcription]; Region: AcrR; COG1309
529507010932	Bacterial regulatory proteins, tetR family; Region: TetR_N; pfam00440
529507010933	HMMPfam hit to PF00440, Bacterial regulatory proteins, tetR family, score 1.8e-15
529507010934	DNA mismatch repair protein MutS; Provisional; Region: PRK05399
529507010935	MutS domain I; Region: MutS_I; pfam01624
529507010936	MutS domain II; Region: MutS_II; pfam05188
529507010937	MutS domain III; Region: MutS_III; pfam05192
529507010938	ATP-binding cassette domain of MutS1 homolog; Region: ABC_MutS1; cd03284
529507010939	Walker A/P-loop; other site
529507010940	ATP binding site [chemical binding]; other site
529507010941	Q-loop/lid; other site
529507010942	ABC transporter signature motif; other site
529507010943	Walker B; other site
529507010944	D-loop; other site
529507010945	H-loop/switch region; other site
529507010946	HMMPfam hit to PF01624, MutS domain I, score 1.4e-73
529507010947	HMMPfam hit to PF05188, MutS domain II, score 1.9e-43
529507010948	HMMPfam hit to PF05192, MutS domain III, score 1.6e-92
529507010949	HMMPfam hit to PF05190, MutS family domain IV, score 6.6e-41
529507010950	HMMPfam hit to PF00488, MutS domain V, score 7e-168
529507010951	PS00017 ATP/GTP-binding site motif A (P-loop).
529507010952	PS00486 DNA mismatch repair proteins mutS family signature.
529507010953	RNA polymerase sigma factor RpoS; Validated; Region: PRK05657
529507010954	Sigma-70 factor, region 1.2; Region: Sigma70_r1_2; pfam00140
529507010955	Sigma-70 region 2; Region: Sigma70_r2; pfam04542
529507010956	Sigma-70 region 3; Region: Sigma70_r3; pfam04539
529507010957	Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs). A SF is a dissociable subunit of RNA polymerase, it directs bacterial or...; Region: Sigma70_r4; cd06171
529507010958	DNA binding residues [nucleotide binding]
529507010959	HMMPfam hit to PF04545, Sigma-70, region, score 4.7e-19
529507010960	PS00716 Sigma-70 factors family signature 2.
529507010961	Predicted helix-turn-helix motif with score 1415.000, SD 4.01 at aa 284-305, sequence ETLEDVGREIGLTRERVRQIQV
529507010962	HMMPfam hit to PF04539, Sigma-70 region, score 2.1e-27
529507010963	HMMPfam hit to PF04542, Sigma-70 region, score 4.3e-26
529507010964	PS00715 Sigma-70 factors family signature 1.
529507010965	HMMPfam hit to PF00140, Sigma-70 factor, region, score 9.2e-10
529507010966	Lysine Motif is a small domain involved in binding peptidoglycan; Region: LysM; cd00118
529507010967	Peptidase family M23; Region: Peptidase_M23; pfam01551
529507010968	HMMPfam hit to PF01551, Peptidase family M23, score 8.8e-44
529507010969	HMMPfam hit to PF01476, LysM domain, score 5e-14
529507010970	Signal peptide predicted for PMI2237 by SignalP 2.0 HMM (Signal peptide probability 0.647) with cleavage site probability 0.632 between residues 27 and 28
529507010971	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507010972	protein-L-isoaspartate O-methyltransferase; Reviewed; Region: pcm; PRK00312
529507010973	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
529507010974	S-adenosylmethionine binding site [chemical binding]; other site
529507010975	HMMPfam hit to PF01135, Protein-L-isoaspartate(D-aspartate) O-methyl, score 5e-90
529507010976	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507010977	PS00339 Aminoacyl-transfer RNA synthetases class-II signature 2.
529507010978	5'(3')-nucleotidase/polyphosphatase; Provisional; Region: surE; PRK00346
529507010979	HMMPfam hit to PF01975, Survival protein SurE, score 5.8e-89
529507010980	tRNA pseudouridine synthase D; Reviewed; Region: truD; PRK00984
529507010981	Pseudouridine synthase, similar to Escherichia coli TruD; Region: PseudoU_synth_EcTruD; cd02575
529507010982	Permutation of conserved domain; other site
529507010983	active site
529507010984	Pseudouridine synthases catalyze the isomerization of specific uridines in an RNA molecule to pseudouridines (5-ribosyluracil, psi); Region: PseudoU_synth; cl00130
529507010985	HMMPfam hit to PF01142, tRNA pseudouridine synthase D (TruD), score 1.4e-139
529507010986	PS01268 Uncharacterized protein family UPF0024 signature.
529507010987	MECDP_synthase (2-C-methyl-D-erythritol-2,4-cyclodiphosphate synthase), encoded by the ispF gene, catalyzes the formation of 2-C-methyl-D-erythritol 2,4-cyclodiphosphate (MEC) in the non-mevalonate deoxyxylulose (DOXP) pathway for isoprenoid biosynthesis; Region: MECDP_synthase; cd00554
529507010988	homotrimer interaction site [polypeptide binding]; other site
529507010989	zinc binding site [ion binding]; other site
529507010990	CDP-binding sites; other site
529507010991	HMMPfam hit to PF02542, YgbB family, score 1.5e-96
529507010992	CDP-ME synthetase is involved in mevalonate-independent isoprenoid production; Region: CDP-ME_synthetase; cd02516
529507010993	substrate binding site; other site
529507010994	dimer interface; other site
529507010995	HMMPfam hit to PF01128, Uncharacterized protein family UPF0007, score 2.3e-84
529507010996	cell division protein FtsB; Reviewed; Region: ftsB; PRK00888
529507010997	Septum formation initiator [Cell division and chromosome partitioning]; Region: COG2919
529507010998	HMMPfam hit to PF04977, Septum formation initiator, score 2e-31
529507010999	1 probable transmembrane helix predicted for PMI2243 by TMHMM2.0 at aa 5-27
529507011000	Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS). The end-product PAPS is a biologically "activated" sulfate form...; Region: APSK; cd02027
529507011001	ligand-binding site [chemical binding]; other site
529507011002	HMMPfam hit to PF01583, Adenylylsulphate kinase, score 3.8e-104
529507011003	PS00017 ATP/GTP-binding site motif A (P-loop).
529507011004	sulfate adenylyltransferase subunit 1; Provisional; Region: cysN; PRK05124
529507011005	CysN, together with protein CysD, forms the ATP sulfurylase (ATPS) complex; Region: CysN_ATPS; cd04166
529507011006	CysD dimerization site [polypeptide binding]; other site
529507011007	G1 box; other site
529507011008	putative GEF interaction site [polypeptide binding]; other site
529507011009	GTP/Mg2+ binding site [chemical binding]; other site
529507011010	Switch I region; other site
529507011011	G2 box; other site
529507011012	G3 box; other site
529507011013	Switch II region; other site
529507011014	G4 box; other site
529507011015	G5 box; other site
529507011016	CysN_NodQ_II: This subfamily represents the domain II of the large subunit of ATP sulfurylase (ATPS): CysN or the N-terminal portion of NodQ, found mainly in proteobacteria and homologous to the domain II of EF-Tu. Escherichia coli ATPS consists of CysN...; Region: CysN_NodQ_II; cd03695
529507011017	TCysN_NoDQ_II: This subfamily represents the domain II of the large subunit of ATP sulfurylase (ATPS): CysN or the N-terminal portion of NodQ, found mainly in proteobacteria and homologous to the domain II of EF-Tu. Escherichia coli ATPS consists of CysN...; Region: CysN_NoDQ_III; cd04095
529507011018	HMMPfam hit to PF03144, Elongation factor Tu domain, score 1.7e-09
529507011019	HMMPfam hit to PF00009, Elongation factor Tu GTP binding domain, score 1.1e-66
529507011020	PS00301 GTP-binding elongation factors signature.
529507011021	PS00017 ATP/GTP-binding site motif A (P-loop).
529507011022	sulfate adenylyltransferase, small subunit; Region: CysD; TIGR02039
529507011023	This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase. PAPS reductase is part of the adenine nucleotide alpha hydrolases superfamily also including N type ATP PPases and ATP sulphurylases. A highly...; Region: PAPS_reductase; cd01713
529507011024	Active Sites [active]
529507011025	HMMPfam hit to PF01507, Phosphoadenosine phosphosulfate reductase, score 1.3e-91
529507011026	siroheme synthase; Provisional; Region: cysG; PRK10637
529507011027	Putative NAD(P)-binding; Region: NAD_binding_7; pfam13241
529507011028	Sirohaem synthase dimerisation region; Region: CysG_dimeriser; pfam10414
529507011029	Uroporphyrin-III C-methyltransferase (S-Adenosyl-L-methionine:uroporphyrinogen III methyltransferase, SUMT); Region: SUMT; cd11642
529507011030	active site
529507011031	SAM binding site [chemical binding]; other site
529507011032	homodimer interface [polypeptide binding]; other site
529507011033	HMMPfam hit to PF00590, Tetrapyrrole (Corrin/Porphyrin) Methylas, score 2.7e-81
529507011034	PS00839 Uroporphyrin-III C-methyltransferase signature 1.
529507011035	3'-phosphoadenosine 5'-phosphosulfate sulfotransferase (PAPS reductase)/FAD synthetase and related enzymes [Amino acid transport and metabolism / Coenzyme metabolism]; Region: CysH; COG0175
529507011036	This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase. PAPS reductase is part of the adenine nucleotide alpha hydrolases superfamily also including N type ATP PPases and ATP sulphurylases. A highly...; Region: PAPS_reductase; cd01713
529507011037	Active Sites [active]
529507011038	HMMPfam hit to PF01507, Phosphoadenosine phosphosulfate reductase, score 4.3e-76
529507011039	sulfite reductase subunit beta; Provisional; Region: PRK13504
529507011040	Nitrite/Sulfite reductase ferredoxin-like half domain; Region: NIR_SIR_ferr; pfam03460
529507011041	Nitrite/Sulfite reductase ferredoxin-like half domain; Region: NIR_SIR_ferr; pfam03460
529507011042	PS00365 Nitrite and sulfite reductases iron-sulfur/siroheme-binding site.
529507011043	HMMPfam hit to PF03460, Nitrite/Sulfite reductase ferredoxin-lik, score 3.8e-19
529507011044	HMMPfam hit to PF01077, Nitrite and sulphite reductase 4Fe-4S do, score 2.6e-58
529507011045	HMMPfam hit to PF03460, Nitrite/Sulfite reductase ferredoxin-lik, score 6.3e-19
529507011046	sulfite reductase subunit alpha; Provisional; Region: cysJ; PRK10953
529507011047	Flavodoxin; Region: Flavodoxin_1; pfam00258
529507011048	Cytochrome p450- like alpha subunits of E. coli sulfite reductase (SiR) multimerize with beta subunits to catalyze the NADPH dependent reduction of sulfite to sulfide. Beta subunits have an Fe4S4 cluster and a siroheme, while the alpha subunits (cysJ...; Region: SiR; cd06199
529507011049	FAD binding pocket [chemical binding]; other site
529507011050	FAD binding motif [chemical binding]; other site
529507011051	catalytic residues [active]
529507011052	NAD binding pocket [chemical binding]; other site
529507011053	phosphate binding motif [ion binding]; other site
529507011054	beta-alpha-beta structure motif; other site
529507011055	HMMPfam hit to PF00175, Oxidoreductase NAD-binding domain, score 2.9e-40
529507011056	HMMPfam hit to PF00667, FAD binding domain, score 1.8e-53
529507011057	HMMPfam hit to PF00258, Flavodoxin, score 3.7e-33
529507011058	Tunnelling fold (T-fold). The five known T-folds are found in five different enzymes with different functions: dihydroneopterin-triphosphate epimerase (DHNTPE), dihydroneopterin aldolase (DHNA) , GTP cyclohydrolase I (GTPCH-1),  6-pyrovoyl...; Region: TFold; cl00263
529507011059	active site
529507011060	HMMPfam hit to PF01242, 6-pyruvoyl tetrahydropterin synthase, score 3.2e-64
529507011061	Organic radical activating enzymes [Posttranslational modification, protein turnover, chaperones]; Region: NrdG; COG0602
529507011062	putative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE; Region: rSAM_QueE_Ecoli; TIGR04322
529507011063	HMMPfam hit to PF04055, Radical SAM superfamily, score 0.0025
529507011064	putative proline-specific permease; Provisional; Region: proY; PRK10580
529507011065	Signal peptide predicted for PMI2253 by SignalP 2.0 HMM (Signal peptide probability 0.985) with cleavage site probability 0.877 between residues 36 and 37
529507011066	12 probable transmembrane helices predicted for PMI2253 by TMHMM2.0 at aa 13-35, 40-62, 92-114, 124-146, 153-175, 199-221, 242-264, 279-301, 331-353, 357-379, 399-421 and 426-448
529507011067	HMMPfam hit to PF00324, Amino acid permease, score 3.2e-129
529507011068	PS00218 Amino acid permeases signature.
529507011069	methionine gamma-lyase; Provisional; Region: PRK07503
529507011070	CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis. This pathway is unique to microorganisms and plants, rendering the enzyme an attractive target for the development of...; Region: CGS_like; cd00614
529507011071	homodimer interface [polypeptide binding]; other site
529507011072	substrate-cofactor binding pocket; other site
529507011073	pyridoxal 5'-phosphate binding site [chemical binding]; other site
529507011074	catalytic residue [active]
529507011075	HMMPfam hit to PF01053, Cys/Met metabolism PLP-dependent enzy, score 4.2e-218
529507011076	Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only]; Region: HcaD; COG0446
529507011077	hypothetical protein; Provisional; Region: PRK05421
529507011078	putative phosphate binding site [ion binding]; other site
529507011079	putative catalytic site [active]
529507011080	putative phosphate binding site [ion binding]; other site
529507011081	putative metal binding site [ion binding]; other site
529507011082	HMMPfam hit to PF03372, Endonuclease/Exonuclease/phosphatase fa, score 5.6e-23
529507011083	D,D-heptose 1,7-bisphosphate phosphatase; Validated; Region: PRK08942
529507011084	Haloacid dehalogenase-like hydrolases. The haloacid dehalogenase-like (HAD) superfamily includes L-2-haloacid dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, and many others; Region: HAD_like; cd01427
529507011085	active site
529507011086	motif I; other site
529507011087	motif II; other site
529507011088	DL-methionine transporter ATP-binding subunit; Provisional; Region: metN; PRK11153
529507011089	ATP-binding cassette domain of methionine transporter; Region: ABC_MetN_methionine_transporter; cd03258
529507011090	Walker A/P-loop; other site
529507011091	ATP binding site [chemical binding]; other site
529507011092	Q-loop/lid; other site
529507011093	ABC transporter signature motif; other site
529507011094	Walker B; other site
529507011095	D-loop; other site
529507011096	H-loop/switch region; other site
529507011097	This domain is found at the C-terminus of ABC transporter proteins involved in D-methionine transport as well as a number of ferredoxin-like proteins; Region: NIL; smart00930
529507011098	HMMPfam hit to PF00005, ABC transporter, score 6e-74
529507011099	PS00017 ATP/GTP-binding site motif A (P-loop).
529507011100	PS00211 ABC transporters family signature.
529507011101	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
529507011102	dimer interface [polypeptide binding]; other site
529507011103	conserved gate region; other site
529507011104	ABC-ATPase subunit interface; other site
529507011105	HMMPfam hit to PF00528, Binding-protein-dependent transport syst, score 3.7e-23
529507011106	5 probable transmembrane helices predicted for PMI2260 by TMHMM2.0 at aa 21-40, 55-77, 82-104, 146-168 and 181-203
529507011107	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
529507011108	DL-methionine transporter substrate-binding subunit; Provisional; Region: metQ; PRK11063
529507011109	lipoprotein, YaeC family; Region: TIGR00363
529507011110	Signal peptide predicted for PMI2261 by SignalP 2.0 HMM (Signal peptide probability 0.998) with cleavage site probability 0.584 between residues 21 and 22
529507011111	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507011112	HMMPfam hit to PF03180, NLPA lipoprotein, score 1.4e-133
529507011113	outer membrane lipoprotein; Reviewed; Region: rcsF; PRK10781
529507011114	Signal peptide predicted for PMI2262 by SignalP 2.0 HMM (Signal peptide probability 0.986) with cleavage site probability 0.691 between residues 21 and 22
529507011115	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507011116	Escherichia coli YaeB and related proteins; Region: UPF0066; cd09281
529507011117	homodimer interaction site [polypeptide binding]; other site
529507011118	cofactor binding site; other site
529507011119	HMMPfam hit to PF01980, Uncharacterised protein family UPF0066, score 7.2e-51
529507011120	PS01318 Uncharacterized protein family UPF0066 signature.
529507011121	prolyl-tRNA synthetase; Provisional; Region: PRK09194
529507011122	Prolyl-tRNA synthetase (ProRS) class II core catalytic domain. ProRS is a homodimer. It is responsible for the attachment of proline to the 3' OH group of ribose of the appropriate tRNA. This domain is primarily responsible for ATP-dependent...; Region: ProRS_core_prok; cd00779
529507011123	dimer interface [polypeptide binding]; other site
529507011124	motif 1; other site
529507011125	active site
529507011126	motif 2; other site
529507011127	INS is an amino acid-editing domain inserted (INS) into the bacterial class II prolyl-tRNA synthetase (ProRS) however, this CD is not exclusively bacterial. It is also found at the N-terminus of the eukaryotic/archaea-like ProRS's of yeasts and...; Region: ProRS-INS; cd04334
529507011128	putative deacylase active site [active]
529507011129	Class II tRNA amino-acyl synthetase-like catalytic core domain. Class II amino acyl-tRNA synthetases (aaRS) share a common fold and generally attach an amino acid to the 3' OH of ribose of the appropriate tRNA.   PheRS is an exception in that it...; Region: class_II_aaRS-like_core; cl00268
529507011130	active site
529507011131	motif 3; other site
529507011132	ProRS Prolyl-anticodon binding domain, short version found predominantly in bacteria. ProRS belongs to class II aminoacyl-tRNA synthetases (aaRS). This alignment contains the anticodon binding domain, which is responsible for specificity in tRNA-binding; Region: ProRS_anticodon_short; cd00861
529507011133	anticodon binding site; other site
529507011134	HMMPfam hit to PF00587, tRNA synthetase class II core domain (, score 2.5e-60
529507011135	PS00179 Aminoacyl-transfer RNA synthetases class-II signature 1.
529507011136	HMMPfam hit to PF04073, YbaK / prolyl-tRNA synthetases associa, score 5.3e-07
529507011137	HMMPfam hit to PF03129, Anticodon binding domain, score 1.7e-26
529507011138	lipoprotein involved with copper homeostasis and adhesion; Provisional; Region: PRK10523
529507011139	NlpE N-terminal domain; Region: NlpE; pfam04170
529507011140	HMMPfam hit to PF04170, Uncharacterized lipoprotein NlpE involved in, score 3.3e-23
529507011141	PS00283 Soybean trypsin inhibitor (Kunitz) protease inhibitors family signature.
529507011142	Signal peptide predicted for PMI2265 by SignalP 2.0 HMM (Signal peptide probability 0.992) with cleavage site probability 0.746 between residues 23 and 24
529507011143	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507011144	Modulator of Rho-dependent transcription termination (ROF); Region: ROF; cl09210
529507011145	HMMPfam hit to PF07073, Modulator of Rho-dependent transcription ter, score 3.7e-28
529507011146	tRNA(Ile)-lysidine synthetase; Provisional; Region: tilS; PRK10660
529507011147	N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning]. This is a subfamily of Adenine nucleotide alpha hydrolases superfamily.Adeninosine nucleotide alpha hydrolases...; Region: PP-ATPase; cd01992
529507011148	Ligand Binding Site [chemical binding]; other site
529507011149	TilS substrate binding domain; Region: TilS; pfam09179
529507011150	TilS substrate C-terminal domain; Region: TilS_C; pfam11734
529507011151	HMMPfam hit to PF01171, PP-loop family, score 2.7e-87
529507011152	3-ketoacyl-(acyl-carrier-protein) reductase; Validated; Region: fabG; PRK05653
529507011153	classical (c) SDRs; Region: SDR_c; cd05233
529507011154	NAD(P) binding site [chemical binding]; other site
529507011155	active site
529507011156	HMMPfam hit to PF00106, short chain dehydrogenase, score 1.9e-76
529507011157	PS00061 Short-chain dehydrogenases/reductases family signature.
529507011158	acetyl-CoA carboxylase carboxyltransferase subunit alpha; Validated; Region: PRK05724
529507011159	acetyl-CoA carboxylase carboxyltransferase alpha subunit; Provisional; Region: accA; CHL00198
529507011160	HMMPfam hit to PF03255, Acetyl co-enzyme A carboxylase carboxyltrans, score 1.5e-98
529507011161	DNA polymerase III subunit alpha; Validated; Region: dnaE; PRK05673
529507011162	Polymerase and Histidinol Phosphatase domain of alpha-subunit of bacterial polymerase III DnaE1; Region: PHP_PolIIIA_DnaE1; cd07433
529507011163	putative active site [active]
529507011164	putative PHP Thumb interface [polypeptide binding]; other site
529507011165	DnaE_OBF: A subfamily of OB folds corresponding to the C-terminal OB-fold nucleic acid binding domain of Thermus aquaticus and Escherichia coli type C replicative DNA polymerase III alpha subunit (DnaE). The DNA polymerase holoenzyme of E. coli contains...; Region: DnaE_OBF; cd04485
529507011166	generic binding surface II; other site
529507011167	generic binding surface I; other site
529507011168	HMMPfam hit to PF01336, OB-fold nucleic acid binding domain, score 2.3e-13
529507011169	HMMPfam hit to PF07733, Bacterial DNA polymerase III alpha sub, score 2.5e-304
529507011170	HMMPfam hit to PF02811, PHP domain C-terminal region, score 3.5e-29
529507011171	HMMPfam hit to PF02231, PHP domain N-terminal region, score 4.6e-28
529507011172	bacterial Ribonuclease HII-like; Region: RNase_HII_bacteria_HII_like; cd07182
529507011173	RNA/DNA hybrid binding site [nucleotide binding]; other site
529507011174	active site
529507011175	HMMPfam hit to PF01351, Ribonuclease HII, score 1.5e-85
529507011176	lipid-A-disaccharide synthase; Reviewed; Region: lpxB; PRK00025
529507011177	ipid-A-disaccharide synthase; Provisional; Region: PRK14089
529507011178	HMMPfam hit to PF02684, Lipid-A-disaccharide synthetase, score 2.9e-194
529507011179	UDP-N-acetylglucosamine acyltransferase; Provisional; Region: PRK05289
529507011180	UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc. It is the first enzyme in the lipid A biosynthetic...; Region: LbH_UDP-GlcNAc_AT; cd03351
529507011181	active site
529507011182	PS00101 Hexapeptide-repeat containing-transferases signature.
529507011183	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 21
529507011184	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507011185	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 15
529507011186	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 0.42
529507011187	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 21
529507011188	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 2.7
529507011189	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 1
529507011190	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 0.22
529507011191	PS00101 Hexapeptide-repeat containing-transferases signature.
529507011192	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 0.00017
529507011193	FabZ is a 17kD beta-hydroxyacyl-acyl carrier protein (ACP) dehydratase that primarily catalyzes the dehydration of beta-hydroxyacyl-ACP to trans-2-acyl-ACP, the third step in the elongation phase of the bacterial/ plastid, type II, fatty-acid...; Region: FabZ; cd01288
529507011194	HMMPfam hit to PF03061, Thioesterase superfamily, score 3.4e-21
529507011195	UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional; Region: lpxD; PRK00892
529507011196	UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase, LpxD; Region: LpxD; pfam04613
529507011197	UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2; Region: LbH_LpxD; cd03352
529507011198	trimer interface [polypeptide binding]; other site
529507011199	active site
529507011200	UDP-GlcNAc binding site [chemical binding]; other site
529507011201	lipid binding site [chemical binding]; lipid-binding site
529507011202	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 14
529507011203	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 0.98
529507011204	PS00101 Hexapeptide-repeat containing-transferases signature.
529507011205	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 0.014
529507011206	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 0.21
529507011207	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 0.092
529507011208	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 0.24
529507011209	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 0.0032
529507011210	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507011211	PS00101 Hexapeptide-repeat containing-transferases signature.
529507011212	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 0.017
529507011213	HMMPfam hit to PF04613, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a, score 7.4e-45
529507011214	periplasmic chaperone; Provisional; Region: PRK10780
529507011215	Outer membrane protein (OmpH-like); Region: OmpH; smart00935
529507011216	HMMPfam hit to PF03938, Outer membrane protein (OmpH-like), score 1.4e-30
529507011217	Signal peptide predicted for PMI2276 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.993 between residues 47 and 48
529507011218	outer membrane protein assembly factor YaeT; Provisional; Region: PRK11067
529507011219	Surface antigen variable number repeat; Region: Surf_Ag_VNR; pfam07244
529507011220	Surface antigen variable number repeat; Region: Surf_Ag_VNR; pfam07244
529507011221	Surface antigen variable number repeat; Region: Surf_Ag_VNR; pfam07244
529507011222	Surface antigen variable number repeat; Region: Surf_Ag_VNR; pfam07244
529507011223	Surface antigen; Region: Bac_surface_Ag; pfam01103
529507011224	HMMPfam hit to PF01103, Surface antigen, score 4.4e-77
529507011225	HMMPfam hit to PF07244, Surface antigen variable number repeat, score 7.8e-08
529507011226	HMMPfam hit to PF07244, Surface antigen variable number repeat, score 1.8e-08
529507011227	HMMPfam hit to PF07244, Surface antigen variable number repeat, score 1e-08
529507011228	HMMPfam hit to PF07244, Surface antigen variable number repeat, score 4.3e-08
529507011229	HMMPfam hit to PF07244, Surface antigen variable number repeat, score 6.2e-09
529507011230	Signal peptide predicted for PMI2277 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.934 between residues 20 and 21
529507011231	zinc metallopeptidase RseP; Provisional; Region: PRK10779
529507011232	RseP-like Site-2 proteases (S2P), zinc metalloproteases (MEROPS family M50A), cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. In Escherichia coli, the S2P homolog...; Region: S2P-M50_PDZ_RseP-like; cd06163
529507011233	active site
529507011234	PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms. May be responsible for substrate recognition and/or binding, as most PDZ...; Region: PDZ_metalloprotease; cd00989
529507011235	protein binding site [polypeptide binding]; other site
529507011236	PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms. May be responsible for substrate recognition and/or binding, as most PDZ...; Region: PDZ_metalloprotease; cd00989
529507011237	protein binding site [polypeptide binding]; other site
529507011238	RseP-like Site-2 proteases (S2P), zinc metalloproteases (MEROPS family M50A), cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. In Escherichia coli, the S2P homolog...; Region: S2P-M50_PDZ_RseP-like; cd06163
529507011239	putative substrate binding region [chemical binding]; other site
529507011240	HMMPfam hit to PF02163, Peptidase family M50, score 3.8e-72
529507011241	4 probable transmembrane helices predicted for PMI2278 by TMHMM2.0 at aa 7-29, 97-119, 376-398 and 426-445
529507011242	HMMPfam hit to PF00595, PDZ domain (Also known as DHR or GLGF), score 0.0002
529507011243	PS00142 Neutral zinc metallopeptidases, zinc-binding region signature.
529507011244	CDP-diglyceride synthase; Provisional; Region: cdsA; PRK11624
529507011245	CDP-diglyceride synthetase [Lipid metabolism]; Region: CdsA; COG0575
529507011246	8 probable transmembrane helices predicted for PMI2279 by TMHMM2.0 at aa 7-41, 56-74, 87-106, 121-143, 150-172, 192-213, 220-237 and 266-285
529507011247	HMMPfam hit to PF01148, Cytidylyltransferase family, score 2.9e-73
529507011248	PS01315 Phosphatidate cytidylyltransferase signature.
529507011249	Signal peptide predicted for PMI2279 by SignalP 2.0 HMM (Signal peptide probability 0.978) with cleavage site probability 0.461 between residues 29 and 30
529507011250	Undecaprenyl pyrophosphate synthase [Lipid metabolism]; Region: UppS; COG0020
529507011251	Cis (Z)-Isoprenyl Diphosphate Synthases (cis-IPPS); homodimers which catalyze the successive 1'-4 condensation of the isopentenyl diphosphate (IPP) molecule to trans,trans-farnesyl diphosphate (FPP) or to cis,trans-FPP to form long-chain polyprenyl...; Region: CIS_IPPS; cl00230
529507011252	catalytic residue [active]
529507011253	putative FPP diphosphate  binding site; other site
529507011254	putative FPP binding hydrophobic cleft; other site
529507011255	dimer interface [polypeptide binding]; other site
529507011256	putative IPP diphosphate binding site; other site
529507011257	HMMPfam hit to PF01255, undecaprenyl diphosphate syntha, score 4.2e-133
529507011258	PS01066 Undecaprenyl pyrophosphate synthetase family signature.
529507011259	1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional; Region: PRK05447
529507011260	1-deoxy-D-xylulose 5-phosphate reductoisomerase; Region: DXP_reductoisom; pfam02670
529507011261	1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal; Region: DXP_redisom_C; pfam08436
529507011262	DXP reductoisomerase C-terminal domain; Region: DXPR_C; pfam13288
529507011263	HMMPfam hit to PF02670, 1-deoxy-D-xylulose 5-phosphate reduct, score 2.3e-224
529507011264	ribosome recycling factor; Reviewed; Region: frr; PRK00083
529507011265	Ribosome recycling factor (RRF). Ribosome recycling factor dissociates the posttermination complex, composed of the ribosome, deacylated tRNA, and mRNA, after termination of translation.  Thus ribosomes are "recycled" and ready for another...; Region: RRF; cd00520
529507011266	hinge region; other site
529507011267	HMMPfam hit to PF01765, Ribosome recycling factor, score 2.6e-94
529507011268	UMP kinase (UMPK)-Ec, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and...; Region: AAK_UMPK-PyrH-Ec; cd04254
529507011269	putative nucleotide binding site [chemical binding]; other site
529507011270	uridine monophosphate binding site [chemical binding]; other site
529507011271	homohexameric interface [polypeptide binding]; other site
529507011272	HMMPfam hit to PF00696, Amino acid kinase family, score 1.6e-65
529507011273	elongation factor Ts; Provisional; Region: tsf; PRK09377
529507011274	UBA/TS-N domain; Region: UBA; pfam00627
529507011275	Elongation factor TS; Region: EF_TS; pfam00889
529507011276	Elongation factor TS; Region: EF_TS; pfam00889
529507011277	HMMPfam hit to PF00889, Elongation factor TS, score 4.3e-106
529507011278	PS01127 Elongation factor Ts signature 2.
529507011279	HMMPfam hit to PF00627, UBA/TS-N domain, score 1.9e-11
529507011280	PS01126 Elongation factor Ts signature 1.
529507011281	Ribosomal protein S2 (RPS2), involved in formation of the translation initiation complex, where it might contact the messenger RNA and several components of the ribosome. It has been shown that in Escherichia coli RPS2 is essential for the binding of...; Region: RPS2; cd01425
529507011282	rRNA interaction site [nucleotide binding]; other site
529507011283	S8 interaction site; other site
529507011284	putative laminin-1 binding site; other site
529507011285	HMMPfam hit to PF00318, Ribosomal protein S2, score 1.3e-126
529507011286	PS00963 Ribosomal protein S2 signature 2.
529507011287	PS00962 Ribosomal protein S2 signature 1.
529507011288	Methionine Aminopeptidase 1. E.C. 3.4.11.18. Also known as methionyl aminopeptidase and Peptidase M. Catalyzes release of N-terminal amino acids, preferentially methionine, from peptides and arylamides; Region: MetAP1; cd01086
529507011289	active site
529507011290	HMMPfam hit to PF00557, metallopeptidase family M24, score 3e-101
529507011291	PS00680 Methionine aminopeptidase subfamily 1 signature.
529507011292	PII uridylyl-transferase; Provisional; Region: PRK05007
529507011293	Nucleotidyltransferase (NT) domain of Escherichia coli adenylyltransferase (GlnE), Escherichia coli uridylyl transferase (GlnD), and similar proteins; Region: NT_GlnE_GlnD_like; cd05401
529507011294	metal binding triad; other site
529507011295	GlnD PII-uridylyltransferase; Region: GlnD_UR_UTase; pfam08335
529507011296	Metal dependent phosphohydrolases with conserved 'HD' motif; Region: HDc; cd00077
529507011297	Zn2+ binding site [ion binding]; other site
529507011298	Mg2+ binding site [ion binding]; other site
529507011299	ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains; Region: ACT_UUR-like_1; cd04900
529507011300	C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains; Region: ACT_ACR-UUR-like_2; cd04899
529507011301	HMMPfam hit to PF01909, Nucleotidyltransferase domain, score 2.1e-07
529507011302	HMMPfam hit to PF01966, HD domain, score 4.3e-19
529507011303	HMMPfam hit to PF01842, ACT domain, score 7.6e-06
529507011304	HMMPfam hit to PF01842, ACT domain, score 3.2e-08
529507011305	2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional; Region: dapD; PRK11830
529507011306	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA; Region: LbH_THP_succinylT; cd03350
529507011307	trimer interface [polypeptide binding]; other site
529507011308	active site
529507011309	substrate binding site [chemical binding]; other site
529507011310	CoA binding site [chemical binding]; other site
529507011311	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 34
529507011312	PS00101 Hexapeptide-repeat containing-transferases signature.
529507011313	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 0.77
529507011314	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 3
529507011315	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 0.34
529507011316	hypothetical protein; Provisional; Region: PRK13677
529507011317	flavodoxin; Provisional; Region: PRK08105
529507011318	HMMPfam hit to PF00258, Flavodoxin, score 1.2e-20
529507011319	Signal peptide predicted for PMI2290 by SignalP 2.0 HMM (Signal peptide probability 0.696) with cleavage site probability 0.617 between residues 19 and 20
529507011320	PTS system glucose-specific transporter subunits IIBC; Provisional; Region: PRK11089
529507011321	Phosphotransferase system IIC components, glucose/maltose/N-acetylglucosamine-specific [Carbohydrate transport and metabolism]; Region: PtsG; COG1263
529507011322	PTS_IIB, PTS system, glucose/sucrose specific IIB subunit. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. This family...; Region: PTS_IIB_glc; cd00212
529507011323	active site turn [active]
529507011324	phosphorylation site [posttranslational modification]
529507011325	10 probable transmembrane helices predicted for PMI2292 by TMHMM2.0 at aa 20-42, 49-71, 81-103, 116-138, 153-172, 248-270, 280-302, 309-331, 354-376 and 443-460
529507011326	HMMPfam hit to PF00367, phosphotransferase system, EIIB, score 1.6e-13
529507011327	HMMPfam hit to PF02378, Phosphotransferase system, EIIC, score 2.9e-98
529507011328	Signal peptide predicted for PMI2292 by SignalP 2.0 HMM (Signal peptide probability 0.943) with cleavage site probability 0.717 between residues 49 and 50
529507011329	Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis]; Region: RluA; COG0564
529507011330	tRNA pseudouridine isomerase C; Region: PseudoU_synth_TruC; cd02563
529507011331	probable active site [active]
529507011332	HMMPfam hit to PF00849, RNA pseudouridylate synthase, score 1.9e-49
529507011333	PS01129 Rlu family of pseudouridine synthase signature.
529507011334	tRNA pseudouridine synthase C; Region: DUF446; pfam04287
529507011335	HMMPfam hit to PF04287, Domain of unknown function, DUF446, score 1e-41
529507011336	SecY interacting protein Syd; Provisional; Region: PRK04968
529507011337	HMMPfam hit to PF07348, Syd protein, score 2.6e-86
529507011338	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG2904
529507011339	7-cyano-7-deazaguanine reductase; Provisional; Region: queF; PRK11792
529507011340	Enzyme related to GTP cyclohydrolase I [General function prediction only]; Region: COG0780
529507011341	HMMPfam hit to PF01227, GTP cyclohydrolase I, score 5.2e-08
529507011342	Predicted Rossmann fold nucleotide-binding protein [General function prediction only]; Region: COG1611
529507011343	Domain of unknown function (DUF3412); Region: DUF3412; pfam11892
529507011344	HMMPfam hit to PF03641, Possible lysine decarboxylase, score 7.5e-54
529507011345	flap endonuclease-like protein; Provisional; Region: PRK09482
529507011346	PIN domain of the 5'-3' exonuclease of Taq DNA polymerase I and homologs; Region: PIN_53EXO; cd09859
529507011347	active site
529507011348	metal binding site 1 [ion binding]; metal-binding site
529507011349	putative 5' ssDNA interaction site; other site
529507011350	metal binding site 3; metal-binding site
529507011351	metal binding site 2 [ion binding]; metal-binding site
529507011352	H3TH domain of the 5'-3' exonuclease of Taq DNA polymerase I and homologs; Region: H3TH_53EXO; cd09898
529507011353	putative DNA binding site [nucleotide binding]; other site
529507011354	putative metal binding site [ion binding]; other site
529507011355	HMMPfam hit to PF02739, 5'-3' exonuclease, N-terminal resolvase-, score 3.4e-21
529507011356	HMMPfam hit to PF01367, 5'-3' exonuclease, C-terminal SAM fold, score 1.7e-18
529507011357	putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional; Region: PRK11760
529507011358	FtsJ-like methyltransferase; Region: FtsJ; pfam01728
529507011359	Protein of unknown function (DUF423); Region: DUF423; cl01008
529507011360	4 probable transmembrane helices predicted for PMI2300 by TMHMM2.0 at aa 5-24, 39-61, 66-88 and 98-120
529507011361	HMMPfam hit to PF04241, Protein of unknown function (DUF423), score 9.2e-31
529507011362	Signal peptide predicted for PMI2300 by SignalP 2.0 HMM (Signal peptide probability 0.993) with cleavage site probability 0.649 between residues 24 and 25
529507011363	DNA-binding transcriptional activator GcvA; Provisional; Region: PRK11139
529507011364	Bacterial regulatory helix-turn-helix protein, lysR family; Region: HTH_1; pfam00126
529507011365	The C-terminal substrate domain of LysR-type GcdR, TrPI, HvR and beta-lactamase regulators, and that of other closely related homologs; contains the type 2 periplasmic binding fold; Region: PBP2_GcdR_TrpI_HvrB_AmpR_like; cd08432
529507011366	dimerization interface [polypeptide binding]; other site
529507011367	substrate binding pocket [chemical binding]; other site
529507011368	HMMPfam hit to PF03466, LysR substrate binding domain, score 4.3e-46
529507011369	HMMPfam hit to PF00126, Bacterial regulatory helix-turn-helix, score 4.9e-21
529507011370	PS00044 Bacterial regulatory proteins, lysR family signature.
529507011371	Predicted helix-turn-helix motif with score 1894.000, SD 5.64 at aa 21-42, sequence LSFTKAAEELFVTQAAVSHQIK
529507011372	Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones]; Region: csdA; COG0520
529507011373	Cysteine desulfurase (SufS)-like. This family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD correspond to cysteine desulfurase (SufS) and selenocysteine lyase. SufS...; Region: SufS_like; cd06453
529507011374	pyridoxal 5'-phosphate binding pocket [chemical binding]; other site
529507011375	catalytic residue [active]
529507011376	HMMPfam hit to PF00266, Aminotransferase class-V, score 2.1e-10
529507011377	PS00595 Aminotransferases class-V pyridoxal-phosphate attachment site.
529507011378	Fe-S metabolism associated domain; Region: SufE; cl00951
529507011379	HMMPfam hit to PF02657, Fe-S metabolism associated domain, score 3.4e-49
529507011380	sulfur acceptor protein CsdL; Provisional; Region: PRK15116
529507011381	Family of activating enzymes (E1) of ubiquitin-like proteins related to the E.coli hypothetical protein ygdL. The common reaction mechanism catalyzed by E1-like enzymes begins with a nucleophilic attack of the C-terminal carboxylate of the ubiquitin-like...; Region: YgdL_like; cd00755
529507011382	putative ATP binding site [chemical binding]; other site
529507011383	putative substrate interface [chemical binding]; other site
529507011384	1 probable transmembrane helix predicted for PMI2304 by TMHMM2.0 at aa 235-257
529507011385	HMMPfam hit to PF00899, ThiF family, score 9.6e-53
529507011386	murein transglycosylase A; Provisional; Region: mltA; PRK11162
529507011387	MltA specific insert domain; Region: MltA; pfam03562
529507011388	3D domain; Region: 3D; pfam06725
529507011389	HMMPfam hit to PF06725, 3D domain, score 2.3e-33
529507011390	HMMPfam hit to PF03562, MltA N-terminal domain, score 3.5e-99
529507011391	Signal peptide predicted for PMI2305 by SignalP 2.0 HMM (Signal peptide probability 0.951) with cleavage site probability 0.560 between residues 27 and 28
529507011392	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507011393	N-acetylmuramoyl-l-alanine amidase II; Provisional; Region: PRK10431
529507011394	AMIN domain; Region: AMIN; pfam11741
529507011395	N-acetylmuramoyl-L-alanine amidase or MurNAc-LAA (also known as peptidoglycan aminohydrolase, NAMLA amidase, NAMLAA, Amidase 3, and peptidoglycan amidase; EC 3.5.1.28) is an autolysin that hydrolyzes the amide bond between N-acetylmuramoyl and L-amino...; Region: MurNAc-LAA; cd02696
529507011396	active site
529507011397	metal binding site [ion binding]; metal-binding site
529507011398	HMMPfam hit to PF01520, N-acetylmuramoyl-L-alanine amidase, score 4e-69
529507011399	1 probable transmembrane helix predicted for PMI2306 by TMHMM2.0 at aa 20-42
529507011400	Signal peptide predicted for PMI2306 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.958 between residues 31 and 32
529507011401	N-acetylglutamate synthase; Validated; Region: PRK05279
529507011402	AAK_NAGS-ABP: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the arginine-biosynthesis pathway (ABP) found in gamma- and beta-proteobacteria and higher plant chloroplasts. Domain architecture of these NAGS consisted of an...; Region: AAK_NAGS-ABP; cd04237
529507011403	putative feedback inhibition sensing region; other site
529507011404	putative nucleotide binding site [chemical binding]; other site
529507011405	putative substrate binding site [chemical binding]; other site
529507011406	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cd04301
529507011407	Coenzyme A binding pocket [chemical binding]; other site
529507011408	HMMPfam hit to PF00696, Amino acid kinase family, score 9e-27
529507011409	HMMPfam hit to PF00583, Acetyltransferase (GNAT) family, score 5.5e-07
529507011410	exonuclease V subunit alpha; Provisional; Region: recD; PRK10875
529507011411	AAA domain; Region: AAA_30; pfam13604
529507011412	Family description; Region: UvrD_C_2; pfam13538
529507011413	PS00017 ATP/GTP-binding site motif A (P-loop).
529507011414	exonuclease V subunit beta; Provisional; Region: recB; PRK10876
529507011415	PD-(D/E)XK nuclease superfamily; Region: PDDEXK_1; pfam12705
529507011416	HMMPfam hit to PF00580, UvrD/REP helicase, score 2.1e-86
529507011417	PS00017 ATP/GTP-binding site motif A (P-loop).
529507011418	protease3; Provisional; Region: PRK15101
529507011419	Insulinase (Peptidase family M16); Region: Peptidase_M16; pfam00675
529507011420	Peptidase M16 inactive domain; Region: Peptidase_M16_C; pfam05193
529507011421	Peptidase M16 inactive domain; Region: Peptidase_M16_C; pfam05193
529507011422	HMMPfam hit to PF05193, Peptidase M16 inactive domain, score 1.7e-14
529507011423	HMMPfam hit to PF05193, Peptidase M16 inactive domain, score 4.4e-26
529507011424	HMMPfam hit to PF00675, Insulinase (Peptidase family M16), score 2.6e-44
529507011425	PS00143 Insulinase family, zinc-binding region signature.
529507011426	Signal peptide predicted for PMI2310 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.999 between residues 23 and 24
529507011427	Exonuclease V gamma subunit [DNA replication, recombination, and repair]; Region: RecC; COG1330
529507011428	exonuclease V subunit gamma; Provisional; Region: recC; PRK11069
529507011429	HMMPfam hit to PF04257, Exodeoxyribonuclease V, gamma subunit, score 0
529507011430	Signal peptide predicted for PMI2312 by SignalP 2.0 HMM (Signal peptide probability 0.893) with cleavage site probability 0.777 between residues 25 and 26
529507011431	Protein of unknown function (DUF2509); Region: DUF2509; cl11672
529507011432	1 probable transmembrane helix predicted for PMI2313 by TMHMM2.0 at aa 13-35
529507011433	hypothetical protein; Provisional; Region: PRK10557
529507011434	1 probable transmembrane helix predicted for PMI2314 by TMHMM2.0 at aa 13-35
529507011435	hypothetical protein; Provisional; Region: PRK10506
529507011436	1 probable transmembrane helix predicted for PMI2315 by TMHMM2.0 at aa 15-37
529507011437	Nucleotidyl transferase of unknown function (DUF1814); Region: DUF1814; pfam08843
529507011438	Domain of unknown function (DUF4095); Region: DUF4095; pfam13338
529507011439	thymidylate synthase; Reviewed; Region: thyA; PRK01827
529507011440	Thymidylate synthase and pyrimidine hydroxymethylase: Thymidylate synthase (TS) and deoxycytidylate hydroxymethylase (dCMP-HMase) are homologs that catalyze analogous alkylation of C5 of pyrimidine nucleotides. Both enzymes are involved in the...; Region: TS_Pyrimidine_HMase; cd00351
529507011441	dimerization interface [polypeptide binding]; other site
529507011442	active site
529507011443	HMMPfam hit to PF00303, Thymidylate synthase, score 6.6e-130
529507011444	prolipoprotein diacylglyceryl transferase; Reviewed; Region: PRK00052
529507011445	HMMPfam hit to PF01790, Prolipoprotein diacylglyceryl transferase, score 1.4e-142
529507011446	7 probable transmembrane helices predicted for PMI2319 by TMHMM2.0 at aa 20-42, 62-84, 99-116, 123-145, 200-219, 226-243 and 258-280
529507011447	PS01311 Prolipoprotein diacylglyceryl transferase signature.
529507011448	fused phosphoenolpyruvate-protein phosphotransferase PtsP/GAF domain; Provisional; Region: PRK11061
529507011449	GAF domain; Region: GAF; pfam01590
529507011450	PEP-utilising enzyme, N-terminal; Region: PEP-utilisers_N; pfam05524
529507011451	PEP-utilising enzyme, mobile domain; Region: PEP-utilizers; pfam00391
529507011452	PEP-utilising enzyme, TIM barrel domain; Region: PEP-utilizers_C; pfam02896
529507011453	HMMPfam hit to PF02896, PEP-utilising enzyme, TIM barrel doma, score 1.3e-124
529507011454	PS00742 PEP-utilizing enzymes signature 2.
529507011455	HMMPfam hit to PF00391, PEP-utilising enzyme, mobile domain, score 1.4e-16
529507011456	HMMPfam hit to PF05524, PEP-utilising enzyme, N-terminal, score 3.9e-32
529507011457	HMMPfam hit to PF01590, GAF domain, score 6.9e-28
529507011458	Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily. Members of this family are well represented in a variety of prokaryotic and eukaryotic organisms. Phylogenetic analysis reveals two distinct subgroups where plant...; Region: Ap4A_hydrolase_plant_like; cd03671
529507011459	putative active site [active]
529507011460	Ap4A binding site [chemical binding]; other site
529507011461	nudix motif; other site
529507011462	putative metal binding site [ion binding]; other site
529507011463	HMMPfam hit to PF00293, NUDIX domain, score 5.5e-31
529507011464	PS00893 mutT domain signature.
529507011465	ABC-type thiamine transport system, periplasmic component [Coenzyme metabolism]; Region: TbpA; COG4143
529507011466	thiamine transporter substrate binding subunit; Provisional; Region: tbpA; PRK11205
529507011467	Signal peptide predicted for PMI2322 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.700 between residues 25 and 26
529507011468	HMMPfam hit to PF01547, Bacterial extracellular solute-binding prot, score 0.0017
529507011469	thiamine transporter membrane protein; Reviewed; Region: thiP; PRK09433
529507011470	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
529507011471	dimer interface [polypeptide binding]; other site
529507011472	conserved gate region; other site
529507011473	putative PBP binding loops; other site
529507011474	ABC-ATPase subunit interface; other site
529507011475	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
529507011476	dimer interface [polypeptide binding]; other site
529507011477	conserved gate region; other site
529507011478	putative PBP binding loops; other site
529507011479	ABC-ATPase subunit interface; other site
529507011480	Signal peptide predicted for PMI2323 by SignalP 2.0 HMM (Signal peptide probability 0.989) with cleavage site probability 0.380 between residues 24 and 25
529507011481	12 probable transmembrane helices predicted for PMI2323 by TMHMM2.0 at aa 5-27, 47-69, 82-104, 119-141, 193-215, 235-252, 285-302, 322-344, 365-387, 397-416, 458-480 and 500-517
529507011482	HMMPfam hit to PF00528, Binding-protein-dependent transport syst, score 1.7e-06
529507011483	HMMPfam hit to PF00528, Binding-protein-dependent transport syst, score 0.0021
529507011484	thiamine transporter ATP-binding subunit; Provisional; Region: thiQ; PRK10771
529507011485	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
529507011486	Walker A/P-loop; other site
529507011487	ATP binding site [chemical binding]; other site
529507011488	Q-loop/lid; other site
529507011489	ABC transporter signature motif; other site
529507011490	Walker B; other site
529507011491	D-loop; other site
529507011492	H-loop/switch region; other site
529507011493	HMMPfam hit to PF00005, ABC transporter, score 7.7e-67
529507011494	PS00017 ATP/GTP-binding site motif A (P-loop).
529507011495	PS00211 ABC transporters family signature.
529507011496	Helix-turn-helix domain; Region: HTH_17; pfam12728
529507011497	Predicted helix-turn-helix motif with score 1557.000, SD 4.49 at aa 121-142, sequence LTTQEAADILNMSRPTFVKLLD
529507011498	PIN domain; Region: PIN_3; pfam13470
529507011499	DNA polymerase II; Reviewed; Region: PRK05762
529507011500	DEDDy 3'-5' exonuclease domain of Escherichia coli DNA polymerase II and similar bacterial family-B DNA polymerases; Region: DNA_polB_II_exo; cd05784
529507011501	active site
529507011502	catalytic site [active]
529507011503	substrate binding site [chemical binding]; other site
529507011504	DNA polymerase type-II subfamily catalytic domain. Bacteria contain five DNA polymerases (I, II, III, IV and V). DNA polymerase II (Pol II) is a prototype for the B-family of polymerases. The role of Pol II in a variety of cellular activities, such as...; Region: POLBc_Pol_II; cd05537
529507011505	active site
529507011506	metal-binding site
529507011507	HMMPfam hit to PF03104, DNA polymerase family B, exonuclease do, score 6.5e-26
529507011508	HMMPfam hit to PF00136, DNA polymerase family B, score 5e-65
529507011509	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507011510	PS00116 DNA polymerase family B signature.
529507011511	ATP-dependent helicase HepA; Validated; Region: PRK04914
529507011512	DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region; Region: DEXDc; cd00046
529507011513	ATP binding site [chemical binding]; other site
529507011514	putative Mg++ binding site [ion binding]; other site
529507011515	Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may...; Region: HELICc; cd00079
529507011516	nucleotide binding region [chemical binding]; other site
529507011517	ATP-binding site [chemical binding]; other site
529507011518	HMMPfam hit to PF04851, Type III restriction enzyme, res subunit, score 1.4e-06
529507011519	HMMPfam hit to PF00176, SNF2 family N-terminal domain, score 1.4e-59
529507011520	HMMPfam hit to PF00271, Helicase conserved C-terminal domain, score 7.2e-18
529507011521	Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis]; Region: RluA; COG0564
529507011522	Pseudouridine synthase, RsuA/RluD family; Region: PseudoU_synth_RluCD_like; cd02869
529507011523	active site
529507011524	HMMPfam hit to PF00849, RNA pseudouridylate synthase, score 1.6e-59
529507011525	PS01129 Rlu family of pseudouridine synthase signature.
529507011526	Dna-J like membrane chaperone protein; Provisional; Region: djlA; PRK09430
529507011527	N-terminal tellurium resistance protein terB-like domain of heat shock DnaJ-like proteins; Region: terB_like_DjlA; cd07316
529507011528	putative metal binding site [ion binding]; other site
529507011529	DnaJ domain or J-domain.  DnaJ/Hsp40 (heat shock protein 40) proteins are highly conserved and play crucial roles in protein translation, folding, unfolding, translocation, and degradation. They act primarily by stimulating the ATPase activity of Hsp70s; Region: DnaJ; cd06257
529507011530	HMMPfam hit to PF00226, DnaJ domain, score 2.4e-12
529507011531	1 probable transmembrane helix predicted for PMI2330 by TMHMM2.0 at aa 7-29
529507011532	LPS assembly outer membrane complex protein LptD; Provisional; Region: PRK03761
529507011533	OstA-like protein; Region: OstA; pfam03968
529507011534	Organic solvent tolerance protein; Region: OstA_C; pfam04453
529507011535	Signal peptide predicted for PMI2331 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.996 between residues 24 and 25
529507011536	HMMPfam hit to PF04453, Organic solvent tolerance protein, score 5.8e-116
529507011537	Predicted helix-turn-helix motif with score 1017.000, SD 2.65 at aa 568-589, sequence FYDSELVERFNISVGQIYFFER
529507011538	peptidyl-prolyl cis-trans isomerase SurA; Provisional; Region: PRK10770
529507011539	SurA N-terminal domain; Region: SurA_N; pfam09312
529507011540	PPIC-type PPIASE domain; Region: Rotamase; pfam00639
529507011541	PPIC-type PPIASE domain; Region: Rotamase; pfam00639
529507011542	Signal peptide predicted for PMI2332 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.985 between residues 25 and 26
529507011543	1 probable transmembrane helix predicted for PMI2332 by TMHMM2.0 at aa 20-42
529507011544	HMMPfam hit to PF00639, PPIC-type PPIASE domain, score 1.7e-31
529507011545	PS01096 PpiC-type peptidyl-prolyl cis-trans isomerase signature.
529507011546	HMMPfam hit to PF00639, PPIC-type PPIASE domain, score 1.4e-41
529507011547	PS01096 PpiC-type peptidyl-prolyl cis-trans isomerase signature.
529507011548	4-hydroxythreonine-4-phosphate dehydrogenase; Reviewed; Region: pdxA; PRK00232
529507011549	4-hydroxythreonine-4-phosphate dehydrogenase; Validated; Region: pdxA; PRK03743
529507011550	HMMPfam hit to PF04166, Pyridoxal phosphate biosynthetic protein Pdx, score 7e-167
529507011551	16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed; Region: ksgA; PRK00274
529507011552	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
529507011553	S-adenosylmethionine binding site [chemical binding]; other site
529507011554	HMMPfam hit to PF00398, Ribosomal RNA adenine dimethylase, score 6.2e-88
529507011555	PS01131 Ribosomal RNA adenine dimethylases signature.
529507011556	CO2+/MG2+ efflux protein ApaG; Reviewed; Region: apaG; PRK05461
529507011557	HMMPfam hit to PF04379, Protein of unknown function (DUF525), score 1.4e-68
529507011558	diadenosine tetraphosphatase; Reviewed; Region: apaH; PRK00166
529507011559	Escherichia coli ApaH and related proteins, metallophosphatase domain; Region: MPP_ApaH; cd07422
529507011560	active site
529507011561	metal binding site [ion binding]; metal-binding site
529507011562	HMMPfam hit to PF00149, Calcineurin-like phosphoesterase, score 1.4e-18
529507011563	Dihydrofolate reductase [Coenzyme metabolism]; Region: FolA; COG0262
529507011564	Dihydrofolate reductase (DHFR). Reduces 7,8-dihydrofolate to 5,6,7,8-tetrahydrofolate with NADPH as a cofactor. This is an essential step in the biosynthesis of deoxythymidine phosphate since 5,6,7,8-tetrahydrofolate is required to regenerate 5; Region: DHFR; cd00209
529507011565	folate binding site [chemical binding]; other site
529507011566	NADP+ binding site [chemical binding]; other site
529507011567	HMMPfam hit to PF00186, Dihydrofolate reductase, score 2e-48
529507011568	Helix-turn-helix domain; Region: HTH_OrfB_IS605; pfam12323
529507011569	Transposase and inactivated derivatives [DNA replication, recombination, and repair]; Region: COG0675
529507011570	Probable transposase; Region: OrfB_IS605; pfam01385
529507011571	transposase, IS605 OrfB family, central region; Region: tspaseT_teng_C; TIGR01766
529507011572	HMMPfam hit to PF07282, transposase DNA-binding domai, score 2.5e-33
529507011573	HMMPfam hit to PF01385, Probable transposase, score 1.1e-132
529507011574	Transposase IS200 like; Region: Y1_Tnp; pfam01797
529507011575	1 probable transmembrane helix predicted for PMI2339 by TMHMM2.0 at aa 7-24
529507011576	HMMPfam hit to PF01797, Transposase IS200 like, score 2.7e-28
529507011577	Peptidase S8 family domain in Autotransporter serine proteases; Region: Peptidases_S8_Autotransporter_serine_protease_like; cd04848
529507011578	catalytic triad [active]
529507011579	putative active site [active]
529507011580	Autotransporter-associated beta strand repeat; Region: Autotrns_rpt; pfam12951
529507011581	Uncharacterized protein with a C-terminal OMP (outer membrane protein) domain [Function unknown]; Region: COG4625
529507011582	Autotransporter beta-domain; Region: Autotransporter; pfam03797
529507011583	HMMPfam hit to PF03797, Autotransporter beta-domain, score 3e-11
529507011584	PS00017 ATP/GTP-binding site motif A (P-loop).
529507011585	HMMPfam hit to PF00082, Subtilase family, score 3.1e-28
529507011586	PS00138 Serine proteases, subtilase family, serine active site.
529507011587	PS00137 Serine proteases, subtilase family, histidine active site.
529507011588	Signal peptide predicted for PMI2341 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.998 between residues 40 and 41
529507011589	1 probable transmembrane helix predicted for PMI2341 by TMHMM2.0 at aa 21-40
529507011590	FtsI repressor; Provisional; Region: PRK10883
529507011591	Multicopper oxidase; Region: Cu-oxidase_3; pfam07732
529507011592	Multicopper oxidase; Region: Cu-oxidase_2; pfam07731
529507011593	HMMPfam hit to PF07731, Multicopper oxidase, score 2.2e-06
529507011594	HMMPfam hit to PF07732, Multicopper oxidase, score 4.1e-39
529507011595	Signal peptide predicted for PMI2342 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.964 between residues 27 and 28
529507011596	1-acyl-sn-glycerol-3-phosphate acyltransferase; Provisional; Region: PRK15018
529507011597	Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: AGPAT-like; Region: LPLAT_AGPAT-like; cd07989
529507011598	putative acyl-acceptor binding pocket; other site
529507011599	HMMPfam hit to PF01553, Acyltransferase, score 8e-47
529507011600	1 probable transmembrane helix predicted for PMI2343 by TMHMM2.0 at aa 2-24
529507011601	DNA topoisomerase IV subunit A; Validated; Region: PRK05561
529507011602	DNA Topoisomerase, subtype IIA; domain A'; bacterial DNA topoisomerase IV (C subunit, ParC), bacterial DNA gyrases (A subunit, GyrA),mammalian DNA toposiomerases II. DNA topoisomerases are essential enzymes that regulate the conformational changes...; Region: TOP4c; cd00187
529507011603	CAP-like domain; other site
529507011604	active site
529507011605	primary dimer interface [polypeptide binding]; other site
529507011606	HMMPfam hit to PF03989, DNA gyrase C-terminal domain, beta-prop, score 3.8e-05
529507011607	HMMPfam hit to PF03989, DNA gyrase C-terminal domain, beta-prop, score 0.0021
529507011608	HMMPfam hit to PF03989, DNA gyrase C-terminal domain, beta-prop, score 0.028
529507011609	HMMPfam hit to PF03989, DNA gyrase C-terminal domain, beta-prop, score 0.24
529507011610	HMMPfam hit to PF00521, DNA gyrase/topoisomerase IV, subunit A, score 3e-247
529507011611	DNA topoisomerase IV subunit B; Reviewed; Region: PRK05559
529507011612	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
529507011613	ATP binding site [chemical binding]; other site
529507011614	Mg2+ binding site [ion binding]; other site
529507011615	G-X-G motif; other site
529507011616	TopoIIA_Trans_DNA_gyrase: Transducer domain, having a ribosomal S5 domain 2-like fold, of the type found in proteins of the type IIA family of DNA topoisomerases similar to the B subunits of E. coli DNA gyrase and E. coli Topoisomerase IV which are; Region: TopoII_Trans_DNA_gyrase; cd00822
529507011617	anchoring element; other site
529507011618	dimer interface [polypeptide binding]; other site
529507011619	ATP binding site [chemical binding]; other site
529507011620	Topoisomerase-primase domain. This is a nucleotidyl transferase/hydrolase domain found in type IA, type IIA and type IIB topoisomerases, bacterial DnaG-type primases, small primase-like proteins from bacteria and archaea, OLD family nucleases from...; Region: TOPRIM; cl00718
529507011621	active site
529507011622	metal binding site [ion binding]; metal-binding site
529507011623	DNA gyrase B subunit, carboxyl terminus; Region: DNA_gyraseB_C; pfam00986
529507011624	HMMPfam hit to PF00986, DNA gyrase B subunit, carboxyl terminus, score 1.7e-29
529507011625	PS00177 DNA topoisomerase II signature.
529507011626	HMMPfam hit to PF00204, DNA gyrase B, score 8.1e-55
529507011627	HMMPfam hit to PF02518, Histidine kinase-, DNA gyrase B-, and H, score 6.7e-28
529507011628	esterase YqiA; Provisional; Region: PRK11071
529507011629	HMMPfam hit to PF05728, Uncharacterised protein family (UPF0227), score 2.3e-90
529507011630	Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain; Region: MPP_GpdQ; cd07402
529507011631	Calcineurin-like phosphoesterase; Region: Metallophos; pfam00149
529507011632	active site
529507011633	metal binding site [ion binding]; metal-binding site
529507011634	hexamer interface [polypeptide binding]; other site
529507011635	HMMPfam hit to PF00149, Calcineurin-like phosphoesterase, score 3.1e-17
529507011636	ADP-ribose pyrophosphatase NudF; Provisional; Region: nudF; PRK10729
529507011637	ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate. Like other members of the Nudix hydrolase superfamily, it requires a divalent cation, such as Mg2+; Region: ADPRase_NUDT5; cd03424
529507011638	dimer interface [polypeptide binding]; other site
529507011639	ADP-ribose binding site [chemical binding]; other site
529507011640	active site
529507011641	nudix motif; other site
529507011642	metal binding site [ion binding]; metal-binding site
529507011643	HMMPfam hit to PF00293, NUDIX domain, score 1.2e-20
529507011644	outer membrane channel protein; Reviewed; Region: tolC; PRK09465
529507011645	Signal peptide predicted for PMI2349 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.989 between residues 22 and 23
529507011646	HMMPfam hit to PF02321, Outer membrane efflux protein, score 7.1e-37
529507011647	HMMPfam hit to PF02321, Outer membrane efflux protein, score 3.8e-49
529507011648	hypothetical protein; Provisional; Region: PRK11653
529507011649	Signal peptide predicted for PMI2350 by SignalP 2.0 HMM (Signal peptide probability 0.992) with cleavage site probability 0.560 between residues 38 and 39
529507011650	1 probable transmembrane helix predicted for PMI2350 by TMHMM2.0 at aa 21-38
529507011651	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507011652	Glutathionylspermidine synthase [Amino acid transport and metabolism]; Region: Gsp; COG0754
529507011653	HMMPfam hit to PF03738, Glutathionylspermidine synthase, score 7.5e-229
529507011654	The Class III extradiol dioxygenase, 4,5-DOPA Dioxygenase, catalyzes the incorporation of both atoms of molecular oxygen into 4,5-dihydroxy-phenylalanine; Region: 45_DOPA_Dioxygenase; cd07363
529507011655	Catalytic LigB subunit of aromatic ring-opening dioxygenase; Region: LigB; pfam02900
529507011656	putative active site [active]
529507011657	metal binding site [ion binding]; metal-binding site
529507011658	HMMPfam hit to PF02900, Catalytic LigB subunit of aromatic ring-open, score 2.8e-63
529507011659	3,4-dihydroxy-2-butanone 4-phosphate synthase; Provisional; Region: ribB; PRK03353
529507011660	3,4-dihydroxy-2-butanone 4-phosphate synthase [Coenzyme metabolism]; Region: RibB; COG0108
529507011661	HMMPfam hit to PF00926, 3,4-dihydroxy-2-butanone 4-phosphate sy, score 3.3e-129
529507011662	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG2960
529507011663	HMMPfam hit to PF04380, Protein of unknown function (DUF526), score 2.2e-38
529507011664	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
529507011665	AAA domain; Region: AAA_21; pfam13304
529507011666	Walker A/P-loop; other site
529507011667	ATP binding site [chemical binding]; other site
529507011668	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
529507011669	Walker B; other site
529507011670	D-loop; other site
529507011671	H-loop/switch region; other site
529507011672	PS00017 ATP/GTP-binding site motif A (P-loop).
529507011673	RT_Bac_retron_II: Reverse transcriptases (RTs) in bacterial retrotransposons or retrons. The polymerase reaction of this enzyme leads to the production of a unique RNA-DNA complex called msDNA (multicopy single-stranded (ss)DNA) in which a small ssDNA...; Region: RT_Bac_retron_II; cd03487
529507011674	Reverse transcriptase (RNA-dependent DNA polymerase); Region: RVT_1; pfam00078
529507011675	putative active site [active]
529507011676	putative NTP binding site [chemical binding]; other site
529507011677	putative nucleic acid binding site [nucleotide binding]; other site
529507011678	HMMPfam hit to PF00078, Reverse transcriptase (RNA-dependent DNA pol, score 1.3e-07
529507011679	bifunctional heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase; Provisional; Region: PRK11316
529507011680	RfaE encodes a bifunctional ADP-heptose synthase involved in the biosynthesis of the lipopolysaccharide (LPS) core precursor ADP-L-glycero-D-manno-heptose. LPS plays an important role in maintaining the structural integrity of the bacterial outer...; Region: RfaE_like; cd01172
529507011681	putative ribose interaction site [chemical binding]; other site
529507011682	putative ADP binding site [chemical binding]; other site
529507011683	rfaE bifunctional protein, domain II; Region: rfaE_dom_II; TIGR02199
529507011684	active site
529507011685	nucleotide binding site [chemical binding]; other site
529507011686	HIGH motif; other site
529507011687	KMSKS motif; other site
529507011688	HMMPfam hit to PF01467, Cytidylyltransferase, score 1.2e-25
529507011689	HMMPfam hit to PF00294, pfkB family carbohydrate kinase, score 4.8e-56
529507011690	PS00583 pfkB family of carbohydrate kinases signature 1.
529507011691	bifunctional glutamine-synthetase adenylyltransferase/deadenyltransferase; Reviewed; Region: PRK11072
529507011692	Nucleotidyltransferase (NT) domain of Escherichia coli adenylyltransferase (GlnE), Escherichia coli uridylyl transferase (GlnD), and similar proteins; Region: NT_GlnE_GlnD_like; cd05401
529507011693	metal binding triad; other site
529507011694	GlnD PII-uridylyltransferase; Region: GlnD_UR_UTase; pfam08335
529507011695	Nucleotidyltransferase (NT) domain of Escherichia coli adenylyltransferase (GlnE), Escherichia coli uridylyl transferase (GlnD), and similar proteins; Region: NT_GlnE_GlnD_like; cd05401
529507011696	metal binding triad; other site
529507011697	GlnD PII-uridylyltransferase; Region: GlnD_UR_UTase; pfam08335
529507011698	HMMPfam hit to PF03710, Glutamate-ammonia ligase adenylyltransferase, score 1.8e-123
529507011699	HMMPfam hit to PF03710, Glutamate-ammonia ligase adenylyltransferase, score 1.3e-121
529507011700	Uncharacterized conserved protein [Function unknown]; Region: COG3025
529507011701	Uncharacterized subgroup of the CYTH-like superfamily having an associated CHAD domain; Region: CYTH-like_Pase_CHAD; cd07756
529507011702	putative active site [active]
529507011703	putative metal binding residues [ion binding]; other site
529507011704	signature motif; other site
529507011705	putative triphosphate binding site [ion binding]; other site
529507011706	HMMPfam hit to PF01928, CYTH domain, score 3.1e-42
529507011707	Bacterial SH3 domain homologues; Region: SH3b; smart00287
529507011708	SH3 domain protein; Region: SH3_and_anchor; TIGR04211
529507011709	Signal peptide predicted for PMI2361 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 1.000 between residues 22 and 23
529507011710	1 probable transmembrane helix predicted for PMI2361 by TMHMM2.0 at aa 218-240
529507011711	multifunctional tRNA nucleotidyl transferase/2'3'-cyclic phosphodiesterase/2'nucleotidase/phosphatase; Reviewed; Region: cca; PRK10885
529507011712	Nucleotidyltransferase (NT) domain of ClassII CCA-adding enzymes; Region: NT_ClassII-CCAase; cd05398
529507011713	active site
529507011714	NTP binding site [chemical binding]; other site
529507011715	metal binding triad [ion binding]; metal-binding site
529507011716	Probable RNA and SrmB- binding site of polymerase A; Region: PolyA_pol_RNAbd; pfam12627
529507011717	Metal dependent phosphohydrolases with conserved 'HD' motif; Region: HDc; cd00077
529507011718	Zn2+ binding site [ion binding]; other site
529507011719	Mg2+ binding site [ion binding]; other site
529507011720	HMMPfam hit to PF01743, Poly A polymerase family, score 7.1e-62
529507011721	HMMPfam hit to PF01966, HD domain, score 8.4e-13
529507011722	Dihydroneopterin aldolase (DHNA) and 7,8-dihydroneopterin triphosphate epimerase domain (DHNTPE); these enzymes have been designated folB and folX, respectively. Folate derivatives are essential cofactors in the biosynthesis of purines, pyrimidines, and...; Region: DHNA_DHNTPE; cd00534
529507011723	homooctamer interface [polypeptide binding]; other site
529507011724	active site
529507011725	HMMPfam hit to PF02152, Dihydroneopterin aldolase, score 6.3e-45
529507011726	putative glycerol-3-phosphate acyltransferase PlsY; Provisional; Region: PRK00220
529507011727	Signal peptide predicted for PMI2364 by SignalP 2.0 HMM (Signal peptide probability 0.750) with cleavage site probability 0.673 between residues 20 and 21
529507011728	5 probable transmembrane helices predicted for PMI2364 by TMHMM2.0 at aa 5-27, 53-75, 80-102, 109-131 and 136-158
529507011729	HMMPfam hit to PF02660, Domain of unknown function DUF, score 9.1e-100
529507011730	Demethylmenaquinone methyltransferase; Region: Methyltransf_6; cl00480
529507011731	Prephenate dehydratase; Region: PDT; pfam00800
529507011732	Cupin domain; Region: Cupin_2; pfam07883
529507011733	HMMPfam hit to PF07883, Cupin domain, score 5.8e-14
529507011734	Class-II DAHP synthetase family; Region: DAHP_synth_2; pfam01474
529507011735	HMMPfam hit to PF01474, Class-II DAHP synthetase family, score 8.9e-184
529507011736	UGMP family protein; Validated; Region: PRK09604
529507011737	Inactive homolog of metal-dependent proteases, putative molecular chaperone [Posttranslational modification, protein turnover, chaperones]; Region: COG1214; cl17884
529507011738	HMMPfam hit to PF00814, Glycoprotease family, score 9.9e-25
529507011739	PS01016 Glycoprotease family signature.
529507011740	30S ribosomal protein S21; Reviewed; Region: rpsU; PRK00270
529507011741	HMMPfam hit to PF01165, Ribosomal protein S21, score 2.5e-35
529507011742	PS01181 Ribosomal protein S21 signature.
529507011743	DNA primase; Validated; Region: dnaG; PRK05667
529507011744	CHC2 zinc finger; Region: zf-CHC2; pfam01807
529507011745	DNA primase catalytic core, N-terminal domain; Region: Toprim_N; pfam08275
529507011746	TOPRIM_DnaG_primases: The topoisomerase-primase (TORPIM) nucleotidyl transferase/hydrolase domain found in the active site regions of proteins similar to Escherichia coli DnaG. Primases synthesize RNA primers for the initiation of DNA replication. DnaG...; Region: TOPRIM_DnaG_primases; cd03364
529507011747	active site
529507011748	metal binding site [ion binding]; metal-binding site
529507011749	interdomain interaction site; other site
529507011750	DnaB-helicase binding domain of primase; Region: DnaB_bind; pfam10410
529507011751	DNA primase DnaG DnaB-binding; Region: DnaG_DnaB_bind; pfam08278
529507011752	HMMPfam hit to PF01807, CHC2 zinc finger, score 3.5e-63
529507011753	HMMPfam hit to PF01751, Toprim domain, score 6.5e-24
529507011754	RNA polymerase sigma factor RpoD; Validated; Region: PRK05658
529507011755	Sigma-70 factor, region 1.1; Region: Sigma70_r1_1; pfam03979
529507011756	Sigma-70 factor, region 1.2; Region: Sigma70_r1_2; pfam00140
529507011757	Sigma-70, non-essential region; Region: Sigma70_ner; pfam04546
529507011758	Sigma-70 region 2; Region: Sigma70_r2; pfam04542
529507011759	Sigma-70 region 3; Region: Sigma70_r3; pfam04539
529507011760	Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs). A SF is a dissociable subunit of RNA polymerase, it directs bacterial or...; Region: Sigma70_r4; cd06171
529507011761	DNA binding residues [nucleotide binding]
529507011762	HMMPfam hit to PF03979, Sigma-70 factor, region, score 3.9e-43
529507011763	HMMPfam hit to PF00140, Sigma-70 factor, region, score 2.5e-15
529507011764	HMMPfam hit to PF04546, Sigma-70, non-essential region, score 5.4e-114
529507011765	HMMPfam hit to PF04542, Sigma-70 region, score 1.8e-28
529507011766	PS00715 Sigma-70 factors family signature 1.
529507011767	HMMPfam hit to PF04539, Sigma-70 region, score 5.5e-41
529507011768	HMMPfam hit to PF04545, Sigma-70, region, score 2.1e-21
529507011769	Predicted helix-turn-helix motif with score 1917.000, SD 5.72 at aa 583-604, sequence HTLEEVGKQFDVTRERIRQIEA
529507011770	PS00716 Sigma-70 factors family signature 2.
529507011771	1 probable transmembrane helix predicted for PMI2373 by TMHMM2.0 at aa 4-26
529507011772	Predicted helix-turn-helix motif with score 983.000, SD 2.53 at aa 200-221, sequence GSQIFDNEVYSVTEEQLRQWLD
529507011773	Bestrophin, RFP-TM, chloride channel; Region: Bestrophin; cl01544
529507011774	HMMPfam hit to PF05249, Uncharacterised protein family (UPF0187), score 6.7e-127
529507011775	3 probable transmembrane helices predicted for PMI2374 by TMHMM2.0 at aa 20-42, 47-69 and 219-241
529507011776	1 probable transmembrane helix predicted for PMI2375 by TMHMM2.0 at aa 25-47
529507011777	Signal peptide predicted for PMI2375 by SignalP 2.0 HMM (Signal peptide probability 0.793) with cleavage site probability 0.283 between residues 44 and 45
529507011778	Cytochrome oxidase subunit II; Region: Cyto_ox_2; pfam02322
529507011779	cytochrome d ubiquinol oxidase subunit 2; Provisional; Region: PRK15003; cl12219
529507011780	cytochrome d ubiquinol oxidase subunit 2; Provisional; Region: PRK15003; cl12219
529507011781	HMMPfam hit to PF02322, Cytochrome oxidase subunit II, score 1.4e-138
529507011782	8 probable transmembrane helices predicted for PMI2376 by TMHMM2.0 at aa 5-23, 74-96, 117-139, 159-181, 194-216, 231-253, 260-282 and 302-324
529507011783	Bacterial Cytochrome Ubiquinol Oxidase; Region: Bac_Ubq_Cox; pfam01654
529507011784	HMMPfam hit to PF01654, Bacterial Cytochrome Ubiquinol Oxidase, score 3.6e-213
529507011785	9 probable transmembrane helices predicted for PMI2377 by TMHMM2.0 at aa 15-37, 56-78, 98-120, 127-149, 186-208, 221-238, 323-345, 357-379 and 410-432
529507011786	oxidoreductase alpha (molybdopterin) subunit; Region: Fdhalpha-like; TIGR01701
529507011787	The MopB_ydeP CD includes a group of related uncharacterized bacterial molybdopterin-binding oxidoreductase-like domains with a putative molybdopterin cofactor binding site. These members belong to the molybdopterin_binding (MopB) superfamily of proteins; Region: MopB_ydeP; cd02767
529507011788	putative molybdopterin cofactor binding site [chemical binding]; other site
529507011789	The MopB_CT_ydeP CD includes a group of related uncharacterized bacterial molybdopterin-binding oxidoreductase-like domains with a putative molybdopterin cofactor binding site. This CD is of the conserved molybdopterin_binding C-terminal (MopB_CT) region...; Region: MopB_CT_ydeP; cd02787
529507011790	putative molybdopterin cofactor binding site; other site
529507011791	HMMPfam hit to PF00384, Molybdopterin oxidoreductase, score 4.7e-09
529507011792	HMMPfam hit to PF01568, Molydopterin dinucleotide binding dom, score 6.8e-08
529507011793	Transcriptional regulator [Transcription]; Region: LysR; COG0583
529507011794	Bacterial regulatory helix-turn-helix protein, lysR family; Region: HTH_1; pfam00126
529507011795	The substrate binding domain of LysR-type transcriptional regulators (LTTRs), a member of the type 2 periplasmic binding fold protein superfamily; Region: PBP2_LTTR_substrate; cd05466
529507011796	dimerization interface [polypeptide binding]; other site
529507011797	HMMPfam hit to PF03466, LysR substrate binding domain, score 1.1e-20
529507011798	HMMPfam hit to PF00126, Bacterial regulatory helix-turn-helix, score 4.1e-05
529507011799	Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Region: MA; smart00283
529507011800	Methyl-accepting chemotaxis protein (MCP), signaling domain; Region: MCP_signal; cd11386
529507011801	dimer interface [polypeptide binding]; other site
529507011802	putative CheW interface [polypeptide binding]; other site
529507011803	HMMPfam hit to PF00015, Methyl-accepting chemotaxis protein (MCP) s, score 3.9e-64
529507011804	HMMPfam hit to PF00672, HAMP domain, score 4.6e-05
529507011805	2 probable transmembrane helices predicted for PMI2380 by TMHMM2.0 at aa 15-34 and 182-204
529507011806	Signal peptide predicted for PMI2380 by SignalP 2.0 HMM (Signal peptide probability 0.622) with cleavage site probability 0.237 between residues 29 and 30
529507011807	Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Region: MA; smart00283
529507011808	Methyl-accepting chemotaxis protein (MCP), signaling domain; Region: MCP_signal; cd11386
529507011809	dimer interface [polypeptide binding]; other site
529507011810	putative CheW interface [polypeptide binding]; other site
529507011811	HMMPfam hit to PF00015, Methyl-accepting chemotaxis protein (MCP) s, score 4e-63
529507011812	HMMPfam hit to PF00672, HAMP domain, score 2.4e-05
529507011813	2 probable transmembrane helices predicted for PMI2381 by TMHMM2.0 at aa 26-47 and 195-217
529507011814	Signal peptide predicted for PMI2381 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.364 between residues 25 and 26
529507011815	haloacid dehalogenase-like hydrolase; Region: HAD; cl17202
529507011816	Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1 [Signal transduction mechanisms]; Region: TerZ; COG2310
529507011817	Uncharacterized proteins involved in stress response, similar to tellurium resistance terD; Region: TerD_like; cd06974
529507011818	putative metal binding site [ion binding]; other site
529507011819	HMMPfam hit to PF02342, Bacterial stress protein, score 2.1e-70
529507011820	Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1 [Signal transduction mechanisms]; Region: TerZ; COG2310
529507011821	Uncharacterized proteins involved in stress response, similar to tellurium resistance terD; Region: TerD_like; cd06974
529507011822	putative metal binding site [ion binding]; other site
529507011823	HMMPfam hit to PF02342, Bacterial stress protein, score 3.4e-70
529507011824	Integral membrane protein TerC family; Region: TerC; cl10468
529507011825	9 probable transmembrane helices predicted for PMI2385 by TMHMM2.0 at aa 10-29, 42-61, 81-100, 107-129, 133-155, 215-237, 252-272, 285-302 and 312-334
529507011826	HMMPfam hit to PF03741, Integral membrane protein TerC family, score 8.8e-86
529507011827	tellurite resistance protein terB; Region: terB; cd07176
529507011828	putative metal binding site [ion binding]; other site
529507011829	HMMPfam hit to PF05099, Tellurite resistance protein TerB, score 3.3e-83
529507011830	Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1 [Signal transduction mechanisms]; Region: TerZ; COG2310
529507011831	Uncharacterized proteins involved in stress response, similar to tellurium resistance terD; Region: TerD_like; cd06974
529507011832	putative metal binding site [ion binding]; other site
529507011833	Uncharacterized protein involved in stress response [General function prediction only]; Region: COG4110
529507011834	Uncharacterized proteins involved in stress response, similar to tellurium resistance terD; Region: TerD_like; cd06974
529507011835	putative metal binding site [ion binding]; other site
529507011836	HMMPfam hit to PF02342, Bacterial stress protein, score 1.1e-15
529507011837	HMMPfam hit to PF02342, Bacterial stress protein, score 3.1e-28
529507011838	Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1 [Signal transduction mechanisms]; Region: TerZ; COG2310
529507011839	Uncharacterized proteins involved in stress response, similar to tellurium resistance terD; Region: TerD_like; cd06974
529507011840	putative metal binding site [ion binding]; other site
529507011841	HMMPfam hit to PF02342, Bacterial stress protein, score 1.3e-48
529507011842	Phosphoribosyl transferase (PRT)-type I domain; Region: PRTases_typeI; cd06223
529507011843	active site
529507011844	Protein of unknown function (DUF3706); Region: DUF3706; pfam12500
529507011845	HAD-superfamily hydrolase, subfamily IIB; Region: HAD-SF-IIB; TIGR01484
529507011846	Protein of unknown function (DUF2983); Region: DUF2983; pfam11202
529507011847	Citrate lyase beta subunit [Carbohydrate transport and metabolism]; Region: CitE; COG2301
529507011848	PS00017 ATP/GTP-binding site motif A (P-loop).
529507011849	Gram-negative bacterial tonB protein; Region: TonB; pfam03544
529507011850	HMMPfam hit to PF03544, Gram-negative bacterial tonB protein, score 9.8e-09
529507011851	Signal peptide predicted for PMI2394 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.996 between residues 24 and 25
529507011852	1 probable transmembrane helix predicted for PMI2394 by TMHMM2.0 at aa 5-24
529507011853	ADP-ribose pyrophosphatase [Nucleotide transport and metabolism]; Region: COG1051
529507011854	nudix motif; other site
529507011855	Uncharacterized conserved protein [General function prediction only]; Region: COG4111
529507011856	HMMPfam hit to PF00293, NUDIX domain, score 3.5e-13
529507011857	The band 7 domain of flotillin (reggie) like proteins. This group contains proteins similar to stomatin, prohibitin, flotillin, HlfK/C and podicin.  Many of these band 7 domain-containing proteins are lipid raft-associated.  Individual proteins of this...; Region: Band_7; cd02106
529507011858	NADH kinase; Region: PLN02929
529507011859	tetracycline repressor protein TetR; Provisional; Region: PRK13756
529507011860	Bacterial regulatory proteins, tetR family; Region: TetR_N; pfam00440
529507011861	Tetracyclin repressor, C-terminal all-alpha domain; Region: TetR_C; pfam02909
529507011862	HMMPfam hit to PF02909, Tetracyclin repressor, C-terminal all-alpha, score 2.5e-66
529507011863	HMMPfam hit to PF00440, Bacterial regulatory proteins, tetR family, score 1.4e-14
529507011864	PS01081 Bacterial regulatory proteins, tetR family signature.
529507011865	Predicted helix-turn-helix motif with score 2218.000, SD 6.74 at aa 25-46, sequence LTTRKLAQKLGVEQPTLYWHVK
529507011866	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507011867	Major Facilitator Superfamily; Region: MFS_1; pfam07690
529507011868	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507011869	HMMPfam hit to PF00083, Sugar (and other) transporter, score 0.00012
529507011870	11 probable transmembrane helices predicted for PMI2399 by TMHMM2.0 at aa 7-29, 39-61, 73-95, 99-118, 130-152, 157-179, 211-233, 248-270, 291-313, 338-360 and 367-386
529507011871	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 7.8e-55
529507011872	PS00216 Sugar transport proteins signature 1.
529507011873	Phage holin family 2; Region: Phage_holin_2; pfam04550
529507011874	HMMPfam hit to PF04550, Phage holin family, score 7.3e-24
529507011875	3 probable transmembrane helices predicted for PMI2400 by TMHMM2.0 at aa 25-44, 51-73 and 78-100
529507011876	Ogr/Delta-like zinc finger; Region: Ogr_Delta; pfam04606
529507011877	dihydroxyacetone kinase subunit DhaK; Provisional; Region: PRK11468
529507011878	Dak1 domain; Region: Dak1; pfam02733
529507011879	HMMPfam hit to PF02733, Dak1 domain, score 3.8e-180
529507011880	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507011881	dihydroxyacetone kinase subunit DhaL; Provisional; Region: PRK10005
529507011882	HMMPfam hit to PF02734, DAK2 domain, score 4.4e-79
529507011883	dihydroxyacetone kinase subunit M; Provisional; Region: PRK11377
529507011884	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG3412
529507011885	active site
529507011886	active pocket/dimerization site; other site
529507011887	phosphorylation site [posttranslational modification]
529507011888	Histidine-containing phosphocarrier protein (HPr)-like proteins. HPr is a central component of the bacterial phosphoenolpyruvate sugar phosphotransferase system (PTS). The PTS catalyses the phosphorylation of sugar substrates during their translocation...; Region: PTS-HPr_like; cd00367
529507011889	dimerization domain swap beta strand [polypeptide binding]; other site
529507011890	regulatory protein interface [polypeptide binding]; other site
529507011891	active site
529507011892	regulatory phosphorylation site [posttranslational modification]; other site
529507011893	PEP-utilising enzyme, N-terminal; Region: PEP-utilisers_N; pfam05524
529507011894	PEP-utilising enzyme, mobile domain; Region: PEP-utilizers; pfam00391
529507011895	HMMPfam hit to PF03610, PTS system fructose IIA component, score 2e-32
529507011896	HMMPfam hit to PF00381, PTS HPr component phosphorylation sit, score 2e-12
529507011897	HMMPfam hit to PF05524, PEP-utilising enzyme, N-terminal, score 2.2e-20
529507011898	HMMPfam hit to PF00391, PEP-utilising enzyme, mobile domain, score 4.6e-07
529507011899	Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms]; Region: AtoC; COG2204
529507011900	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
529507011901	active site
529507011902	phosphorylation site [posttranslational modification]
529507011903	intermolecular recognition site; other site
529507011904	dimerization interface [polypeptide binding]; other site
529507011905	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cl17189
529507011906	Bacterial regulatory protein, Fis family; Region: HTH_8; pfam02954
529507011907	HMMPfam hit to PF02954, Bacterial regulatory protein, Fis fam, score 1.7e-12
529507011908	PS00688 Sigma-54 interaction domain C-terminal part signature.
529507011909	HMMPfam hit to PF00158, Sigma-54 interaction domain, score 7.5e-14
529507011910	HMMPfam hit to PF00072, Response regulator receiver domain, score 2.6e-33
529507011911	Signal transduction histidine kinase regulating phosphoglycerate transport system [Signal transduction mechanisms]; Region: COG4192
529507011912	HAMP domain; Region: HAMP; pfam00672
529507011913	dimerization interface [polypeptide binding]; other site
529507011914	Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via...; Region: HisKA; cd00082
529507011915	dimer interface [polypeptide binding]; other site
529507011916	phosphorylation site [posttranslational modification]
529507011917	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
529507011918	ATP binding site [chemical binding]; other site
529507011919	Mg2+ binding site [ion binding]; other site
529507011920	G-X-G motif; other site
529507011921	HMMPfam hit to PF02518, Histidine kinase-, DNA gyrase B-, and HSP90, score 4.3e-25
529507011922	HMMPfam hit to PF00512, His Kinase A (phosphoacceptor) domain, score 0.00076
529507011923	HMMPfam hit to PF00672, HAMP domain, score 1.8e-06
529507011924	2 probable transmembrane helices predicted for PMI2406 by TMHMM2.0 at aa 15-37 and 325-347
529507011925	Signal peptide predicted for PMI2406 by SignalP 2.0 HMM (Signal peptide probability 0.962) with cleavage site probability 0.792 between residues 43 and 44
529507011926	Bacterial extracellular solute-binding protein; Region: SBP_bac_11; pfam13531
529507011927	ABC-type Fe3+ transport system, periplasmic component [Inorganic ion transport and metabolism]; Region: AfuA; COG1840
529507011928	HMMPfam hit to PF01547, Bacterial extracellular solute-binding prot, score 9.4e-05
529507011929	Signal peptide predicted for PMI2407 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.997 between residues 23 and 24
529507011930	Sugar phosphate permease [Carbohydrate transport and metabolism]; Region: UhpC; COG2271
529507011931	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507011932	putative substrate translocation pore; other site
529507011933	10 probable transmembrane helices predicted for PMI2408 by TMHMM2.0 at aa 28-50, 60-82, 103-125, 181-203, 248-267, 282-304, 317-336, 346-368, 375-397 and 417-439
529507011934	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 6.5e-44
529507011935	pyruvate kinase; Provisional; Region: PRK05826
529507011936	Pyruvate kinase (PK):  Large allosteric enzyme that regulates glycolysis through binding of the substrate, phosphoenolpyruvate, and one or more allosteric effectors. Like other allosteric enzymes, PK has a high substrate affinity R state and a low...; Region: Pyruvate_Kinase; cl17342
529507011937	domain interfaces; other site
529507011938	active site
529507011939	HMMPfam hit to PF00224, Pyruvate kinase, barrel domain, score 1.8e-173
529507011940	HMMPfam hit to PF02887, Pyruvate kinase, alpha/beta domain, score 6e-05
529507011941	hypothetical protein; Provisional; Region: PRK11019
529507011942	HMMPfam hit to PF01258, Prokaryotic dksA/traR C4-type zinc finge, score 2e-18
529507011943	Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism]; Region: GadB; COG0076
529507011944	pyridoxal 5'-phosphate binding pocket [chemical binding]; other site
529507011945	catalytic residue [active]
529507011946	HMMPfam hit to PF00282, Pyridoxal-dependent decarboxylase conse, score 8e-11
529507011947	Predicted helix-turn-helix motif with score 1071.000, SD 2.83 at aa 153-174, sequence VTIKKVAKLVGYDPEVASGVFT
529507011948	H+/citrate symporter [Energy production and conversion]; Region: CitM; COG2851
529507011949	Citrate transporter; Region: CitMHS; pfam03600
529507011950	10 probable transmembrane helices predicted for PMI2412 by TMHMM2.0 at aa 20-39, 46-68, 78-95, 108-130, 134-151, 158-180, 200-219, 264-295, 310-332 and 438-457
529507011951	purine nucleoside phosphorylase; Reviewed; Region: deoD; PRK05819
529507011952	Uridine phosphorylase [Nucleotide transport and metabolism]; Region: Udp; COG2820
529507011953	HMMPfam hit to PF01048, Phosphorylase family, score 9.1e-114
529507011954	PS01232 Purine and other phosphorylases family 1 signature.
529507011955	phosphopentomutase; Provisional; Region: PRK05362
529507011956	Metalloenzyme superfamily; Region: Metalloenzyme; pfam01676
529507011957	HMMPfam hit to PF01676, Metalloenzyme superfamily, score 5.9e-47
529507011958	thymidine phosphorylase; Reviewed; Region: deoA; PRK05820
529507011959	Glycosyl transferase family, helical bundle domain; Region: Glycos_trans_3N; pfam02885
529507011960	Glycosyl transferase family, a/b domain; Region: Glycos_transf_3; pfam00591
529507011961	Pyrimidine nucleoside phosphorylase C-terminal domain; Region: PYNP_C; smart00941
529507011962	HMMPfam hit to PF07831, Pyrimidine nucleoside phosphorylase C, score 5.9e-30
529507011963	HMMPfam hit to PF00591, Glycosyl transferase family, a/b doma, score 2e-78
529507011964	PS00647 Thymidine and pyrimidine-nucleoside phosphorylases signature.
529507011965	HMMPfam hit to PF02885, Glycosyl transferase family, helical, score 2e-21
529507011966	2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family; Region: DeoC; cd00959
529507011967	intersubunit interface [polypeptide binding]; other site
529507011968	active site
529507011969	catalytic residue [active]
529507011970	HMMPfam hit to PF01791, Deoxyribose-phosphate aldolase, score 2e-79
529507011971	Nucleoside permease [Nucleotide transport and metabolism]; Region: NupC; COG1972
529507011972	Na+ dependent nucleoside transporter N-terminus; Region: Nucleos_tra2_N; pfam01773
529507011973	Nucleoside recognition; Region: Gate; pfam07670
529507011974	Na+ dependent nucleoside transporter C-terminus; Region: Nucleos_tra2_C; pfam07662
529507011975	8 probable transmembrane helices predicted for PMI2418 by TMHMM2.0 at aa 5-27, 32-54, 102-124, 179-201, 275-297, 304-326, 371-393 and 414-436
529507011976	HMMPfam hit to PF07662, Na+ dependent nucleoside transporter C, score 2.1e-108
529507011977	HMMPfam hit to PF07670, Nucleoside recognition, score 4.5e-18
529507011978	HMMPfam hit to PF01773, Na+ dependent nucleoside transporter N, score 6.2e-30
529507011979	Signal peptide predicted for PMI2418 by SignalP 2.0 HMM (Signal peptide probability 0.816) with cleavage site probability 0.639 between residues 26 and 27
529507011980	TatD like proteins;  E.coli TatD is a cytoplasmic protein, shown to have magnesium dependent DNase activity; Region: TatD_DNAse; cd01310
529507011981	active site
529507011982	HMMPfam hit to PF01026, TatD related DNase, score 5.5e-94
529507011983	PS01091 Uncharacterized protein family UPF0006 signature 3.
529507011984	PS01090 Uncharacterized protein family UPF0006 signature 2.
529507011985	PS01137 Uncharacterized protein family UPF0006 signature 1.
529507011986	Predicted esterase of the alpha-beta hydrolase superfamily [General function prediction only]; Region: COG4667
529507011987	Hypothetical patatin similar to yjju protein of Escherichia coli; Region: Pat_hypo_Ecoli_yjju_like; cd07208
529507011988	active site
529507011989	nucleophile elbow; other site
529507011990	HMMPfam hit to PF01734, Patatin-like phospholipase, score 1.2e-17
529507011991	periplasmic protein; Provisional; Region: PRK10568
529507011992	HMMPfam hit to PF04972, phospholipid-binding domain, score 2.8e-07
529507011993	Signal peptide predicted for PMI2421 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.994 between residues 27 and 28
529507011994	peptide chain release factor 3; Provisional; Region: prfC; PRK00741
529507011995	Release Factor 3 (RF3) protein involved in the terminal step of translocation in bacteria; Region: RF3; cd04169
529507011996	G1 box; other site
529507011997	putative GEF interaction site [polypeptide binding]; other site
529507011998	GTP/Mg2+ binding site [chemical binding]; other site
529507011999	Switch I region; other site
529507012000	G2 box; other site
529507012001	G3 box; other site
529507012002	Switch II region; other site
529507012003	G4 box; other site
529507012004	G5 box; other site
529507012005	RF3_II: this subfamily represents the domain II of bacterial Release Factor 3 (RF3). Termination of protein synthesis by the ribosome requires two release factor (RF) classes. The class II RF3 is a GTPase that removes class I RFs (RF1 or RF2) from the...; Region: RF3_II; cd03689
529507012006	HMMPfam hit to PF03144, Elongation factor Tu domain, score 1.6e-09
529507012007	HMMPfam hit to PF00009, Elongation factor Tu GTP binding domain, score 1.5e-59
529507012008	PS00301 GTP-binding elongation factors signature.
529507012009	Conjugative-transposon-like mobile genetic element (high GC region).
529507012010	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
529507012011	SOS-response transcriptional repressors (RecA-mediated autopeptidases) [Transcription / Signal transduction mechanisms]; Region: LexA; COG1974
529507012012	non-specific DNA binding site [nucleotide binding]; other site
529507012013	salt bridge; other site
529507012014	sequence-specific DNA binding site [nucleotide binding]; other site
529507012015	Peptidase S24 LexA-like proteins are involved in the SOS response leading to the repair of single-stranded DNA within the bacterial cell. This family includes: the lambda repressor CI/C2 family and related bacterial prophage repressor proteins; LexA (EC...; Region: S24_LexA-like; cd06529
529507012016	Catalytic site [active]
529507012017	HMMPfam hit to PF00717, Peptidase S24-like, score 1.9e-19
529507012018	HMMPfam hit to PF01381, Helix-turn-helix, score 2.6e-08
529507012019	Predicted helix-turn-helix motif with score 1944.000, SD 5.81 at aa 17-38, sequence VTQSELARRIGIKQQSISQICS
529507012020	Uncharacterized protein conserved in bacteria, prophage-related [Function unknown]; Region: COG4197
529507012021	Predicted helix-turn-helix motif with score 1310.000, SD 3.65 at aa 19-40, sequence GGQSALARAINSKQQNVWFWLN
529507012022	PS00017 ATP/GTP-binding site motif A (P-loop).
529507012023	Lytic Transglycosylase (LT)  and Goose Egg White Lysozyme (GEWL) domain. Members include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as, the eukaryotic "goose-type" lysozymes (GEWL).  LTs...; Region: LT_GEWL; cd00254
529507012024	N-acetyl-D-glucosamine binding site [chemical binding]; other site
529507012025	catalytic residue [active]
529507012026	Signal peptide predicted for PMI2427 by SignalP 2.0 HMM (Signal peptide probability 0.996) with cleavage site probability 0.797 between residues 23 and 24
529507012027	HMMPfam hit to PF01464, Transglycosylase SLT domain, score 1.1e-06
529507012028	Flagellar transcriptional activator (FlhD); Region: FlhD; cl05012
529507012029	Flagellar transcriptional activator (FlhC); Region: FlhC; cl05036
529507012030	Nitric oxide reductase large subunit [Inorganic ion transport and metabolism]; Region: NorB; COG3256
529507012031	Signal peptide predicted for PMI2430 by SignalP 2.0 HMM (Signal peptide probability 0.997) with cleavage site probability 0.439 between residues 39 and 40
529507012032	4 probable transmembrane helices predicted for PMI2430 by TMHMM2.0 at aa 20-39, 49-67, 74-91 and 95-114
529507012033	TraG-like protein, N-terminal region; Region: TraG_N; pfam07916
529507012034	HMMPfam hit to PF07916, TraG-like protein, N-terminal region, score 1.2e-229
529507012035	2 probable transmembrane helices predicted for PMI2431 by TMHMM2.0 at aa 333-355 and 362-384
529507012036	Conjugative relaxosome accessory transposon protein; Region: TraH; pfam06122
529507012037	HMMPfam hit to PF06122, TraH protein, score 5.2e-240
529507012038	Signal peptide predicted for PMI2432 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.877 between residues 22 and 23
529507012039	TraF-like protein; Region: TraF-like; TIGR02740
529507012040	F plasmid transfer operon protein; Region: TraF; pfam13728
529507012041	Signal peptide predicted for PMI2433 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.999 between residues 29 and 30
529507012042	1 probable transmembrane helix predicted for PMI2433 by TMHMM2.0 at aa 5-27
529507012043	Part of AAA domain; Region: AAA_19; pfam13245
529507012044	Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair]; Region: UvrD; COG0210
529507012045	Family description; Region: UvrD_C_2; pfam13538
529507012046	HMMPfam hit to PF00580, UvrD/REP helicase, score 5.8e-11
529507012047	PS00017 ATP/GTP-binding site motif A (P-loop).
529507012048	Protein of unknown function (DUF2813); Region: DUF2813; pfam11398
529507012049	AAA domain; Region: AAA_21; pfam13304
529507012050	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
529507012051	ABC transporter signature motif; other site
529507012052	Walker B; other site
529507012053	D-loop; other site
529507012054	H-loop/switch region; other site
529507012055	TOPRIM_OLD: topoisomerase-primase (TOPRIM) nucleotidyl transferase/hydrolase domain of the type found in bacterial and archaeal nucleases of the OLD (overcome lysogenization defect) family.  The bacteriophage P2 OLD protein, which has DNase as well as...; Region: TOPRIM_OLD; cd01026
529507012056	putative active site [active]
529507012057	putative metal-binding site [ion binding]; other site
529507012058	PS00017 ATP/GTP-binding site motif A (P-loop).
529507012059	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG4643
529507012060	Zinc-binding domain of primase-helicase; Region: Prim_Zn_Ribbon; pfam08273
529507012061	Toprim domain; Region: Toprim_3; pfam13362
529507012062	hypothetical protein; Reviewed; Region: PRK00024
529507012063	Mov34/MPN/PAD-1 family; Region: MPN_DUF2466; cd08071
529507012064	MPN+ (JAMM) motif; other site
529507012065	Zinc-binding site [ion binding]; other site
529507012066	HMMPfam hit to PF04002, RadC, DNA repair protein, score 2.4e-67
529507012067	PS01302 DNA repair protein radC family signature.
529507012068	Cobalamin biosynthesis protein CobT; Region: CobT; pfam06213
529507012069	Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF). Typically, the vWA domain is made up of approximately 200 amino acid residues folded into a classic a/b para-rossmann type of...; Region: vWFA; cl00057
529507012070	metal ion-dependent adhesion site (MIDAS); other site
529507012071	Protein of unknown function (DUF3150); Region: DUF3150; pfam11348
529507012072	WGR domain; Region: WGR; cl01581
529507012073	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
529507012074	Walker A motif; other site
529507012075	ATP binding site [chemical binding]; other site
529507012076	Walker B motif; other site
529507012077	arginine finger; other site
529507012078	CbbQ/NirQ/NorQ C-terminal; Region: CbbQ_C; pfam08406
529507012079	HMMPfam hit to PF07728, ATPase family associated with various cellul, score 4.8e-15
529507012080	PS00017 ATP/GTP-binding site motif A (P-loop).
529507012081	YqaJ-like viral recombinase domain; Region: YqaJ; cl09232
529507012082	1 probable transmembrane helix predicted for PMI2447 by TMHMM2.0 at aa 7-24
529507012083	Signal peptide predicted for PMI2447 by SignalP 2.0 HMM (Signal peptide probability 0.995) with cleavage site probability 0.696 between residues 23 and 24
529507012084	RecT family; Region: RecT; cl04285
529507012085	HMMPfam hit to PF03837, RecT family, score 3.3e-15
529507012086	Single-stranded DNA-binding protein [DNA replication, recombination, and repair]; Region: Ssb; COG0629
529507012087	SSB_OBF: A subfamily of OB folds similar to the OB fold of ssDNA-binding protein (SSB). SSBs bind with high affinity to ssDNA. They bind to and protect ssDNA intermediates during DNA metabolic pathways. All bacterial and eukaryotic SSBs studied to date...; Region: SSB_OBF; cd04496
529507012088	dimer interface [polypeptide binding]; other site
529507012089	ssDNA binding site [nucleotide binding]; other site
529507012090	tetramer (dimer of dimers) interface [polypeptide binding]; other site
529507012091	HMMPfam hit to PF00436, Single-strand binding protein family, score 1.2e-12
529507012092	1 probable transmembrane helix predicted for PMI2450 by TMHMM2.0 at aa 4-26
529507012093	Endonuclease I; Region: Endonuclease_1; pfam04231
529507012094	Signal peptide predicted for PMI2452 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.991 between residues 21 and 22
529507012095	1 probable transmembrane helix predicted for PMI2452 by TMHMM2.0 at aa 5-27
529507012096	HMMPfam hit to PF04231, Endonuclease I, score 3.2e-87
529507012097	PS00041 Bacterial regulatory proteins, araC family signature.
529507012098	Dynamin family; Region: Dynamin_N; pfam00350
529507012099	Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases); Region: Ras_like_GTPase; cl17170
529507012100	G1 box; other site
529507012101	GTP/Mg2+ binding site [chemical binding]; other site
529507012102	G2 box; other site
529507012103	Switch I region; other site
529507012104	3 probable transmembrane helices predicted for PMI2454 by TMHMM2.0 at aa 588-610, 617-639 and 643-665
529507012105	PS00017 ATP/GTP-binding site motif A (P-loop).
529507012106	2 probable transmembrane helices predicted for PMI2455 by TMHMM2.0 at aa 13-35 and 55-77
529507012107	conjugal transfer mating pair stabilization protein TraN; Provisional; Region: PRK14876
529507012108	conjugal transfer mating pair stabilization protein TraN; Provisional; Region: PRK14876
529507012109	HMMPfam hit to PF06986, Mating pair stabilisation protein TraN, score 1.6e-19
529507012110	HMMPfam hit to PF06986, Mating pair stabilisation protein TraN, score 4.5e-17
529507012111	Signal peptide predicted for PMI2456 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.779 between residues 27 and 28
529507012112	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507012113	TraU protein; Region: TraU; pfam06834
529507012114	HMMPfam hit to PF06834, TraU protein, score 4.6e-228
529507012115	Signal peptide predicted for PMI2457 by SignalP 2.0 HMM (Signal peptide probability 0.998) with cleavage site probability 0.846 between residues 28 and 29
529507012116	Type-F conjugative transfer system pilin assembly protein; Region: TrbC_Ftype; pfam09673
529507012117	Sex factor F TraW protein N terminal; Region: TraW_N; cl10149
529507012118	Signal peptide predicted for PMI2458 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.996 between residues 23 and 24
529507012119	Signal peptidase, peptidase S26; Region: Peptidase_S26; pfam10502
529507012120	The S24, S26 LexA/signal peptidase superfamily contains LexA-related and type I signal peptidase families. The S24 LexA protein domains include: the lambda repressor CI/C2 family and related bacterial prophage repressor proteins; LexA (EC 3.4.21.88), the...; Region: Peptidase_S24_S26; cl10465
529507012121	Predicted helix-turn-helix motif with score 1108.000, SD 2.96 at aa 112-133, sequence STGMALAQRLGVAESQFSRSLT
529507012122	PS00760 Signal peptidases I lysine active site.
529507012123	1 probable transmembrane helix predicted for PMI2459 by TMHMM2.0 at aa 13-32
529507012124	Signal peptide predicted for PMI2459 by SignalP 2.0 HMM (Signal peptide probability 0.981) with cleavage site probability 0.660 between residues 31 and 32
529507012125	1 probable transmembrane helix predicted for PMI2460 by TMHMM2.0 at aa 7-29
529507012126	Signal peptide predicted for PMI2460 by SignalP 2.0 HMM (Signal peptide probability 0.938) with cleavage site probability 0.257 between residues 24 and 25
529507012127	F pilus assembly Type-IV secretion system for plasmid transfer; Region: TraC_F_IV; pfam11130
529507012128	type-IV secretion system protein TraC; Region: TraC-F-type; TIGR02746
529507012129	TraM recognition site of TraD and TraG; Region: TraG-D_C; cl17375
529507012130	PS00017 ATP/GTP-binding site motif A (P-loop).
529507012131	protein disulfide isomerase II DsbC; Provisional; Region: PRK10877
529507012132	DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold. They function as protein disulfide isomerases and chaperones in the bacterial periplasm to correct non-native disulfide bonds...; Region: DsbA_DsbC_DsbG; cd03020
529507012133	dimerization domain [polypeptide binding]; other site
529507012134	dimer interface [polypeptide binding]; other site
529507012135	catalytic residues [active]
529507012136	Signal peptide predicted for PMI2462 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.999 between residues 19 and 20
529507012137	Nucleotidyl transferase of unknown function (DUF1814); Region: DUF1814; pfam08843
529507012138	1 probable transmembrane helix predicted for PMI2463 by TMHMM2.0 at aa 13-35
529507012139	Protein of unknwon function (DUF2893); Region: DUF2893; pfam11459
529507012140	2 probable transmembrane helices predicted for PMI2465 by TMHMM2.0 at aa 13-35 and 50-72
529507012141	Signal peptide predicted for PMI2465 by SignalP 2.0 HMM (Signal peptide probability 0.998) with cleavage site probability 0.988 between residues 32 and 33
529507012142	Type IV conjugative transfer system lipoprotein (TraV); Region: TraV; pfam09676
529507012143	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507012144	Bacterial conjugation TrbI-like protein; Region: TrbI; pfam03743
529507012145	HMMPfam hit to PF06447, TraB pilus assembly protein, score 1.7e-223
529507012146	1 probable transmembrane helix predicted for PMI2467 by TMHMM2.0 at aa 16-33
529507012147	conjugal transfer protein TraK; Provisional; Region: PRK13736; cl05878
529507012148	TraK protein; Region: TraK; pfam06586
529507012149	Signal peptide predicted for PMI2468 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.992 between residues 30 and 31
529507012150	TraE protein; Region: TraE; cl05060
529507012151	Signal peptide predicted for PMI2469 by SignalP 2.0 HMM (Signal peptide probability 0.934) with cleavage site probability 0.437 between residues 40 and 41
529507012152	1 probable transmembrane helix predicted for PMI2469 by TMHMM2.0 at aa 21-40
529507012153	TraL protein; Region: TraL; cl06278
529507012154	1 probable transmembrane helix predicted for PMI2470 by TMHMM2.0 at aa 29-51
529507012155	replicative DNA helicase; Provisional; Region: PRK05973
529507012156	Domain of unknown function (DUF4400); Region: DUF4400; pfam14348
529507012157	4 probable transmembrane helices predicted for PMI2473 by TMHMM2.0 at aa 9-28, 123-145, 165-187 and 191-210
529507012158	conjugative coupling factor TraD, SXT/TOL subfamily; Region: SXT_TraD; TIGR03743
529507012159	TraM recognition site of TraD and TraG; Region: TraG-D_C; cl17375
529507012160	PS00017 ATP/GTP-binding site motif A (P-loop).
529507012161	Signal peptide predicted for PMI2475 by SignalP 2.0 HMM (Signal peptide probability 0.839) with cleavage site probability 0.828 between residues 31 and 32
529507012162	Putative helicase; Region: TraI_2; pfam07514
529507012163	integrating conjugative element relaxase, PFL_4751 family; Region: ICE_TraI_Pfluor; TIGR03760
529507012164	HMMPfam hit to PF07514, helicase, score 9.4e-189
529507012165	UvrD/REP helicase N-terminal domain; Region: UvrD-helicase; pfam00580
529507012166	Part of AAA domain; Region: AAA_19; pfam13245
529507012167	Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair]; Region: UvrD; COG0210
529507012168	Family description; Region: UvrD_C_2; pfam13538
529507012169	HMMPfam hit to PF00580, UvrD/REP helicase, score 7.1e-09
529507012170	PS00017 ATP/GTP-binding site motif A (P-loop).
529507012171	Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only]; Region: COG1205
529507012172	DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region; Region: DEXDc; cd00046
529507012173	ATP binding site [chemical binding]; other site
529507012174	putative Mg++ binding site [ion binding]; other site
529507012175	Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may...; Region: HELICc; cd00079
529507012176	ATP-binding site [chemical binding]; other site
529507012177	Domain of unknown function (DUF1998); Region: DUF1998; pfam09369
529507012178	HMMPfam hit to PF00271, Helicase conserved C-terminal domain, score 1.4e-13
529507012179	PS00190 Cytochrome c family heme-binding site signature.
529507012180	HMMPfam hit to PF00270, DEAD/DEAH box helicase, score 1.5e-16
529507012181	Type II restriction enzyme, methylase subunits [Defense mechanisms]; Region: COG1002
529507012182	PS00092 N-6 Adenine-specific DNA methylases signature.
529507012183	Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair]; Region: HepA; COG0553
529507012184	DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region; Region: DEXDc; cd00046
529507012185	ATP binding site [chemical binding]; other site
529507012186	putative Mg++ binding site [ion binding]; other site
529507012187	Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may...; Region: HELICc; cd00079
529507012188	nucleotide binding region [chemical binding]; other site
529507012189	ATP-binding site [chemical binding]; other site
529507012190	HMMPfam hit to PF00271, Helicase conserved C-terminal domain, score 1.6e-12
529507012191	HMMPfam hit to PF00176, SNF2 family N-terminal domain, score 1.8e-07
529507012192	PS00108 Serine/Threonine protein kinases active-site signature.
529507012193	HMMPfam hit to PF04851, Type III restriction enzyme, res subunit, score 6.6e-07
529507012194	Predicted transcriptional regulator [Transcription]; Region: COG2378
529507012195	WYL domain; Region: WYL; pfam13280
529507012196	DNA polymerase III subunit epsilon; Validated; Region: PRK09182
529507012197	DEDDh 3'-5' exonuclease domain family; Region: DEDDh; cd06127
529507012198	active site
529507012199	catalytic site [active]
529507012200	substrate binding site [chemical binding]; other site
529507012201	HMMPfam hit to PF00929, Exonuclease, score 1.8e-08
529507012202	SOS-response transcriptional repressors (RecA-mediated autopeptidases) [Transcription / Signal transduction mechanisms]; Region: LexA; COG1974
529507012203	Peptidase S24 LexA-like proteins are involved in the SOS response leading to the repair of single-stranded DNA within the bacterial cell. This family includes: the lambda repressor CI/C2 family and related bacterial prophage repressor proteins; LexA (EC...; Region: S24_LexA-like; cd06529
529507012204	Catalytic site [active]
529507012205	HMMPfam hit to PF00717, Peptidase S24-like, score 1.6e-19
529507012206	DNA polymerase V subunit UmuC; Reviewed; Region: umuC; PRK03609
529507012207	umuC subunit of DNA Polymerase V; Region: PolY_Pol_V_umuC; cd01700
529507012208	active site
529507012209	DNA binding site [nucleotide binding]
529507012210	Domain of unknown function (DUF4113); Region: DUF4113; pfam13438
529507012211	HMMPfam hit to PF00817, impB/mucB/samB family, score 8.7e-166
529507012212	Plasmid segregation protein ParM and similar proteins; Region: ParM_like; cd10227
529507012213	PRTRC system protein D; Region: PRTRC_D; TIGR03739
529507012214	Mg binding site [ion binding]; other site
529507012215	nucleotide binding site [chemical binding]; other site
529507012216	putative protofilament interface [polypeptide binding]; other site
529507012217	Bacteriophage P4 integrase. P4-like integrases are found in temperate bacteriophages, integrative plasmids, pathogenicity and symbiosis islands, and other mobile genetic elements.  They share the same fold in their catalytic domain and the overall...; Region: INT_P4; cd00801
529507012218	Integrase [DNA replication, recombination, and repair]; Region: XerC; COG0582
529507012219	active site
529507012220	Int/Topo IB signature motif; other site
529507012221	HMMPfam hit to PF00589, Phage integrase family, score 2.7e-07
529507012222	Prophage CP4-57 regulatory protein (AlpA); Region: Phage_AlpA; cl17523
529507012223	N-terminus of peptide chain release factor 3 generated by the insertion of the conjugative element; N-terminus of peptide chain release factor 3 (fragment)
529507012224	Domain of unknown function (DUF4095); Region: DUF4095; pfam13338
529507012225	Nucleotidyl transferase of unknown function (DUF1814); Region: DUF1814; pfam08843
529507012226	ribosomal-protein-alanine N-acetyltransferase; Provisional; Region: rimI; PRK09491
529507012227	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cd04301
529507012228	Coenzyme A binding pocket [chemical binding]; other site
529507012229	HMMPfam hit to PF00583, Acetyltransferase (GNAT) family, score 2.9e-17
529507012230	DNA polymerase III subunit psi; Validated; Region: PRK06856
529507012231	HMMPfam hit to PF03603, DNA polymerase III psi subunit, score 4.4e-11
529507012232	16S ribosomal RNA m2G1207 methyltransferase; Provisional; Region: rsmC; PRK09489
529507012233	Methyltransferase small domain N-terminal; Region: MTS_N; pfam08468
529507012234	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
529507012235	S-adenosylmethionine binding site [chemical binding]; other site
529507012236	HMMPfam hit to PF05175, Methyltransferase small domain, score 1.7e-05
529507012237	PS00092 N-6 Adenine-specific DNA methylases signature.
529507012238	HMMPfam hit to PF05175, Methyltransferase small domain, score 1.5e-17
529507012239	2 probable transmembrane helices predicted for PMI2497 by TMHMM2.0 at aa 30-52 and 67-89
529507012240	Signal peptide predicted for PMI2497 by SignalP 2.0 HMM (Signal peptide probability 0.852) with cleavage site probability 0.565 between residues 41 and 42
529507012241	Acetyltransferase (GNAT) domain; Region: Acetyltransf_10; pfam13673
529507012242	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cd04301
529507012243	Coenzyme A binding pocket [chemical binding]; other site
529507012244	HMMPfam hit to PF00583, Acetyltransferase (GNAT) family, score 1.8e-11
529507012245	Na+/phosphate symporter [Inorganic ion transport and metabolism]; Region: NptA; COG1283
529507012246	Na+/Pi-cotransporter; Region: Na_Pi_cotrans; pfam02690
529507012247	PhoU domain; Region: PhoU; pfam01895
529507012248	PS00343 Gram-positive cocci surface proteins 'anchoring' hexapeptide.
529507012249	8 probable transmembrane helices predicted for PMI2499 by TMHMM2.0 at aa 4-26, 67-89, 99-121, 134-156, 171-193, 206-228, 238-260 and 273-295
529507012250	HMMPfam hit to PF02690, Na+/Pi-cotransporter, score 7e-55
529507012251	alkaline phosphatase; Provisional; Region: PRK10518
529507012252	Alkaline phosphatase homologues; alkaline phosphatases are non-specific phosphomonoesterases that catalyze the hydrolysis reaction via a phosphoseryl intermediate to produce inorganic phosphate and the corresponding alcohol, optimally at high pH; Region: alkPPc; cd00016
529507012253	dimer interface [polypeptide binding]; other site
529507012254	active site
529507012255	HMMPfam hit to PF00245, Alkaline phosphatase, score 1.1e-120
529507012256	PS00017 ATP/GTP-binding site motif A (P-loop).
529507012257	PS00123 Alkaline phosphatase active site.
529507012258	1 probable transmembrane helix predicted for PMI2500 by TMHMM2.0 at aa 9-31
529507012259	Signal peptide predicted for PMI2500 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.867 between residues 27 and 28
529507012260	Helix-turn-helix domain; Region: HTH_OrfB_IS605; pfam12323
529507012261	Transposase and inactivated derivatives [DNA replication, recombination, and repair]; Region: COG0675
529507012262	Probable transposase; Region: OrfB_IS605; pfam01385
529507012263	transposase, IS605 OrfB family, central region; Region: tspaseT_teng_C; TIGR01766
529507012264	HMMPfam hit to PF07282, transposase DNA-binding domai, score 2.8e-34
529507012265	HMMPfam hit to PF01385, Probable transposase, score 7.8e-130
529507012266	Transposase IS200 like; Region: Y1_Tnp; pfam01797
529507012267	HMMPfam hit to PF01797, Transposase IS200 like, score 2.3e-41
529507012268	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507012269	enterobactin/ferric enterobactin esterase; Provisional; Region: PRK10439
529507012270	Domain of unknown function (DUF3327); Region: DUF3327; pfam11806
529507012271	Predicted hydrolase of the alpha/beta superfamily [General function prediction only]; Region: COG2819
529507012272	HMMPfam hit to PF00756, esterase, score 7.4e-29
529507012273	Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi; Region: TPR; cd00189
529507012274	TPR motif; other site
529507012275	binding surface
529507012276	Uncharacterized conserved protein [Function unknown]; Region: COG1434
529507012277	YdcF-like. YdcF-like is a large family of mainly bacterial proteins, with a few members found in fungi, plants, and archaea. Escherichia coli YdcF has been shown to bind S-adenosyl-L-methionine (AdoMet), but a biochemical function has not been...; Region: YdcF-like; cd06259
529507012278	putative active site [active]
529507012279	HMMPfam hit to PF02698, DUF218 domain, score 3.8e-38
529507012280	Signal peptide predicted for PMI2504 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.980 between residues 33 and 34
529507012281	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
529507012282	non-specific DNA binding site [nucleotide binding]; other site
529507012283	salt bridge; other site
529507012284	bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional; Region: PRK08099
529507012285	sequence-specific DNA binding site [nucleotide binding]; other site
529507012286	nucleotidyl transferase superfamily; Region: nt_trans; cl00015
529507012287	active site
529507012288	nucleotide binding site [chemical binding]; other site
529507012289	HIGH motif; other site
529507012290	KMSKS motif; other site
529507012291	Predicted ATPase/kinase involved in NAD metabolism [Coenzyme metabolism]; Region: NadR; COG3172
529507012292	PS00687 Aldehyde dehydrogenases glutamic acid active site.
529507012293	PS00017 ATP/GTP-binding site motif A (P-loop).
529507012294	HMMPfam hit to PF01381, Helix-turn-helix, score 6.7e-09
529507012295	Predicted helix-turn-helix motif with score 1538.000, SD 4.43 at aa 16-37, sequence YTLQQVADESQMTKGYLSQLIN
529507012296	DNA repair protein RadA; Provisional; Region: PRK11823
529507012297	Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of...; Region: Sms; cd01121
529507012298	Walker A motif/ATP binding site; other site
529507012299	ATP binding site [chemical binding]; other site
529507012300	Walker B motif; other site
529507012301	Subunit ChlI of Mg-chelatase; Region: ChlI; pfam13541
529507012302	PS00017 ATP/GTP-binding site motif A (P-loop).
529507012303	PS00190 Cytochrome c family heme-binding site signature.
529507012304	phosphoserine phosphatase; Provisional; Region: serB; PRK11133
529507012305	Haloacid dehalogenase-like hydrolases. The haloacid dehalogenase-like (HAD) superfamily includes L-2-haloacid dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, and many others; Region: HAD_like; cd01427
529507012306	motif II; other site
529507012307	HMMPfam hit to PF00702, haloacid dehalogenase-like hydrolase, score 1.6e-26
529507012308	hypothetical protein; Provisional; Region: PRK11246
529507012309	Signal peptide predicted for PMI2508 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.451 between residues 40 and 41
529507012310	2 probable transmembrane helices predicted for PMI2508 by TMHMM2.0 at aa 15-34 and 169-191
529507012311	hypothetical protein; Provisional; Region: PRK10977
529507012312	glycine radical enzyme activase, YjjW family; Region: activase_YjjW; TIGR04041
529507012313	anaerobic ribonucleotide reductase-activating protein; Provisional; Region: nrdG; cl15804
529507012314	Radical SAM superfamily. Enzymes of this family generate radicals by combining a 4Fe-4S cluster and S-adenosylmethionine (SAM) in close proximity. They are characterized by a conserved CxxxCxxC motif, which coordinates the conserved iron-sulfur cluster; Region: Radical_SAM; cd01335
529507012315	FeS/SAM binding site; other site
529507012316	PS01087 Radical activating enzymes signature.
529507012317	HMMPfam hit to PF04055, Radical SAM superfamily, score 7.7e-12
529507012318	PS00190 Cytochrome c family heme-binding site signature.
529507012319	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 0.00099
529507012320	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
529507012321	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
529507012322	probable extracellular repeat, HAF family; Region: HAF_rpt; TIGR02913
529507012323	Autotransporter beta-domain; Region: Autotransporter; pfam03797
529507012324	putative bacteriocin export ABC transporter, lactococcin 972 group; Region: L_ocin_972_ABC; TIGR03608
529507012325	ATP-binding cassette domain of nickel/oligopeptides specific transporters; Region: ABC_NikE_OppD_transporters; cd03257
529507012326	Walker A/P-loop; other site
529507012327	ATP binding site [chemical binding]; other site
529507012328	Q-loop/lid; other site
529507012329	ABC transporter signature motif; other site
529507012330	Walker B; other site
529507012331	D-loop; other site
529507012332	H-loop/switch region; other site
529507012333	HMMPfam hit to PF00005, ABC transporter, score 5.9e-22
529507012334	PS00211 ABC transporters family signature.
529507012335	PS00017 ATP/GTP-binding site motif A (P-loop).
529507012336	ATP-binding cassette domain of nickel/oligopeptides specific transporters; Region: ABC_NikE_OppD_transporters; cd03257
529507012337	nickel import ATP-binding protein NikD; Region: nickel_nikD; TIGR02770
529507012338	Walker A/P-loop; other site
529507012339	ATP binding site [chemical binding]; other site
529507012340	Q-loop/lid; other site
529507012341	ABC transporter signature motif; other site
529507012342	Walker B; other site
529507012343	D-loop; other site
529507012344	H-loop/switch region; other site
529507012345	HMMPfam hit to PF00005, ABC transporter, score 1.7e-28
529507012346	PS00017 ATP/GTP-binding site motif A (P-loop).
529507012347	ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism]; Region: DppC; COG1173
529507012348	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
529507012349	dimer interface [polypeptide binding]; other site
529507012350	conserved gate region; other site
529507012351	ABC-ATPase subunit interface; other site
529507012352	HMMPfam hit to PF00528, Binding-protein-dependent transport syst, score 9.4e-24
529507012353	5 probable transmembrane helices predicted for PMI2514 by TMHMM2.0 at aa 10-29, 69-91, 106-128, 189-211 and 231-253
529507012354	PS00215 Mitochondrial energy transfer proteins signature.
529507012355	ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism]; Region: DppB; COG0601
529507012356	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
529507012357	dimer interface [polypeptide binding]; other site
529507012358	conserved gate region; other site
529507012359	putative PBP binding loops; other site
529507012360	ABC-ATPase subunit interface; other site
529507012361	HMMPfam hit to PF00528, Binding-protein-dependent transport syst, score 5.2e-47
529507012362	6 probable transmembrane helices predicted for PMI2515 by TMHMM2.0 at aa 12-34, 72-94, 106-128, 148-170, 190-212 and 294-316
529507012363	The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold; Region: PBP2_NikA_DppA_OppA_like_19; cd08518
529507012364	Bacterial extracellular solute-binding proteins, family 5 Middle; Region: SBP_bac_5; pfam00496
529507012365	HMMPfam hit to PF00496, Bacterial extracellular solute-binding prot, score 4.1e-75
529507012366	Signal peptide predicted for PMI2516 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.873 between residues 28 and 29
529507012367	putative glycosyl transferase; Provisional; Region: PRK10073
529507012368	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold; Region: Glyco_tranf_GTA_type; cd00761
529507012369	active site
529507012370	HMMPfam hit to PF00535, Glycosyl transferase, score 4.4e-37
529507012371	coenzyme F420-reducing hydrogenase delta subunit (putative coenzyme F420 hydrogenase processing subunit); Region: frhD; TIGR00130
529507012372	Endopeptidases belonging to membrane-bound hydrogen evolving hydrogenase group. In hydrogenase 3 from E coli, the maturation of the large subunit (HycE) requires the cleavage of a C-terminal peptide by the endopeptidase HycI, before the final formation...; Region: H2MP_MemB-H2evol; cd06067
529507012373	nickel binding site [ion binding]; other site
529507012374	HMMPfam hit to PF01750, Hydrogenase maturation protease, score 9.8e-27
529507012375	formate hydrogenlyase maturation protein HycH; Provisional; Region: PRK15084
529507012376	HMMPfam hit to PF07450, Formate hydrogenlyase maturation protein Hyc, score 2e-65
529507012377	Ni,Fe-hydrogenase III small subunit [Energy production and conversion]; Region: COG3260
529507012378	HMMPfam hit to PF01058, NADH ubiquinone oxidoreductase, 20 Kd sub, score 1.1e-46
529507012379	hydrogenase 4 subunit H; Validated; Region: PRK08222
529507012380	The HCP family of iron-sulfur proteins includes hybrid cluster protein (HCP), acetyl-CoA synthase (ACS), and carbon monoxide dehydrogenase (CODH), all of which contain [Fe4-S4] metal clusters at their active sites. These proteins have a conserved...; Region: HCP_like; cl14655
529507012381	PS00190 Cytochrome c family heme-binding site signature.
529507012382	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 2.2e-06
529507012383	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
529507012384	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 5.6e-07
529507012385	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
529507012386	Ni,Fe-hydrogenase III component G [Energy production and conversion]; Region: HycE; COG3262
529507012387	NADH dehydrogenase subunit D; Validated; Region: PRK06075; cl17338
529507012388	Ni,Fe-hydrogenase III large subunit [Energy production and conversion]; Region: HycE; COG3261
529507012389	HMMPfam hit to PF00346, Respiratory-chain NADH dehydrogenase,, score 3.2e-14
529507012390	PS00535 Respiratory chain NADH dehydrogenase 49 Kd subunit signature.
529507012391	HMMPfam hit to PF00329, Respiratory-chain NADH dehydrogenase,, score 7.4e-26
529507012392	hydrogenase 4 subunit F; Validated; Region: PRK06458
529507012393	NADH-Ubiquinone/plastoquinone (complex I), various chains; Region: Oxidored_q1; pfam00361
529507012394	12 probable transmembrane helices predicted for PMI2523 by TMHMM2.0 at aa 4-26, 33-55, 75-97, 118-140, 164-186, 216-238, 253-275, 288-307, 322-344, 382-404, 419-437 and 457-479
529507012395	HMMPfam hit to PF00361, NADH-Ubiquinone/plastoquinone (complex I), score 2.4e-59
529507012396	Signal peptide predicted for PMI2523 by SignalP 2.0 HMM (Signal peptide probability 0.998) with cleavage site probability 0.576 between residues 29 and 30
529507012397	hydrogenase 4 membrane subunit; Provisional; Region: hyfE; PRK11492
529507012398	HMMPfam hit to PF00420, NADH-ubiquinone/plastoquinone oxidoreduct, score 1.2e-08
529507012399	6 probable transmembrane helices predicted for PMI2524 by TMHMM2.0 at aa 5-24, 28-50, 57-79, 92-114, 127-149 and 176-195
529507012400	hydrogenase 4 subunit D; Validated; Region: PRK06525
529507012401	NADH-Ubiquinone/plastoquinone (complex I), various chains; Region: Oxidored_q1; pfam00361
529507012402	14 probable transmembrane helices predicted for PMI2525 by TMHMM2.0 at aa 6-25, 32-54, 83-105, 118-138, 142-159, 172-191, 211-233, 246-268, 273-295, 302-324, 334-353, 374-396, 416-438 and 459-481
529507012403	HMMPfam hit to PF00361, NADH-Ubiquinone/plastoquinone (complex I), score 3.7e-55
529507012404	PS00339 Aminoacyl-transfer RNA synthetases class-II signature 2.
529507012405	Signal peptide predicted for PMI2525 by SignalP 2.0 HMM (Signal peptide probability 0.744) with cleavage site probability 0.248 between residues 30 and 31
529507012406	Formate hydrogenlyase subunit 4 [Energy production and conversion]; Region: HyfC; COG0650
529507012407	NADH dehydrogenase; Region: NADHdh; cl00469
529507012408	HMMPfam hit to PF00146, NADH dehydrogenase, score 1.1e-41
529507012409	8 probable transmembrane helices predicted for PMI2526 by TMHMM2.0 at aa 10-32, 72-94, 99-121, 141-163, 178-197, 233-252, 257-279 and 292-314
529507012410	PS00668 Respiratory-chain NADH dehydrogenase subunit 1 signature 2.
529507012411	hydrogenase 4 subunit B; Validated; Region: PRK06521
529507012412	NADH-Ubiquinone/plastoquinone (complex I), various chains; Region: Oxidored_q1; pfam00361
529507012413	16 probable transmembrane helices predicted for PMI2527 by TMHMM2.0 at aa 5-24, 31-53, 79-101, 108-130, 134-153, 165-187, 202-224, 237-259, 272-294, 301-323, 338-360, 373-395, 429-451, 472-494, 529-551 and 651-670
529507012414	HMMPfam hit to PF00361, NADH-Ubiquinone/plastoquinone (complex I), score 4.4e-50
529507012415	Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion]; Region: HycB; COG1142
529507012416	4Fe-4S binding domain; Region: Fer4; pfam00037
529507012417	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 5.9e-08
529507012418	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
529507012419	Ribose/Galactose Isomerase; Region: LacAB_rpiB; pfam02502
529507012420	HMMPfam hit to PF02502, Ribose/Galactose Isomerase, score 1.5e-12
529507012421	elongation factor P; Validated; Region: PRK00529
529507012422	Elongation factor P (EF-P) KOW-like domain; Region: EFP_N; pfam08207
529507012423	S1_EF-P_repeat_1: Translation elongation factor P (EF-P), S1-like RNA-binding domain, repeat 1. EF-P stimulates the peptidyltransferase activity in the prokaryotic 70S ribosome. EF-P enhances the synthesis of certain dipeptides with...; Region: S1_EF-P_repeat_1; cd04470
529507012424	RNA binding site [nucleotide binding]; other site
529507012425	S1_EF-P_repeat_2: Translation elongation factor P (EF-P), S1-like RNA-binding domain, repeat 1. EF-P stimulates the peptidyltransferase activity in the prokaryotic 70S ribosome. EF-P enhances the synthesis of certain dipeptides with...; Region: S1_EF-P_repeat_2; cd05794
529507012426	RNA binding site [nucleotide binding]; other site
529507012427	HMMPfam hit to PF01132, Elongation factor P (EF-P), score 1e-112
529507012428	PS01275 Elongation factor P signature.
529507012429	Lysine 2,3-aminomutase [Amino acid transport and metabolism]; Region: KamA; COG1509
529507012430	Radical SAM superfamily. Enzymes of this family generate radicals by combining a 4Fe-4S cluster and S-adenosylmethionine (SAM) in close proximity. They are characterized by a conserved CxxxCxxC motif, which coordinates the conserved iron-sulfur cluster; Region: Radical_SAM; cd01335
529507012431	FeS/SAM binding site; other site
529507012432	HMMPfam hit to PF04055, Radical SAM superfamily, score 4.4e-13
529507012433	fimbrial operon 12
529507012434	P pilus assembly protein, porin PapC [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimD; COG3188
529507012435	PapC N-terminal domain; Region: PapC_N; pfam13954
529507012436	Type VII secretion system (T7SS), usher protein; Region: Usher; pfam00577
529507012437	PapC C-terminal domain; Region: PapC_C; pfam13953
529507012438	HMMPfam hit to PF00577, Fimbrial Usher protein, score 1.3e-273
529507012439	Signal peptide predicted for PMI2533 by SignalP 2.0 HMM (Signal peptide probability 0.794) with cleavage site probability 0.490 between residues 26 and 27
529507012440	P pilus assembly protein, chaperone PapD [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimC; COG3121
529507012441	Gram-negative pili assembly chaperone, N-terminal domain; Region: Pili_assembly_N; pfam00345
529507012442	Gram-negative pili assembly chaperone, C-terminal domain; Region: Pili_assembly_C; pfam02753
529507012443	HMMPfam hit to PF00345, Gram-negative pili assembly chaperone, score 4.2e-16
529507012444	Signal peptide predicted for PMI2534 by SignalP 2.0 HMM (Signal peptide probability 0.994) with cleavage site probability 0.897 between residues 31 and 32
529507012445	P pilus assembly protein, chaperone PapD [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimC; COG3121
529507012446	Gram-negative pili assembly chaperone, N-terminal domain; Region: Pili_assembly_N; pfam00345
529507012447	Gram-negative pili assembly chaperone, C-terminal domain; Region: Pili_assembly_C; pfam02753
529507012448	HMMPfam hit to PF02753, Gram-negative pili assembly chaperone, score 1.4e-22
529507012449	HMMPfam hit to PF00345, Gram-negative pili assembly chaperone, score 4.6e-19
529507012450	1 probable transmembrane helix predicted for PMI2535 by TMHMM2.0 at aa 7-24
529507012451	Signal peptide predicted for PMI2535 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.957 between residues 23 and 24
529507012452	Fimbrial protein; Region: Fimbrial; pfam00419
529507012453	Signal peptide predicted for PMI2536 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.746 between residues 24 and 25
529507012454	1 probable transmembrane helix predicted for PMI2536 by TMHMM2.0 at aa 7-24
529507012455	Signal peptide predicted for PMI2537 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.500 between residues 27 and 28
529507012456	P pilus assembly protein, chaperone PapD [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimC; COG3121
529507012457	Gram-negative pili assembly chaperone, N-terminal domain; Region: Pili_assembly_N; pfam00345
529507012458	Gram-negative pili assembly chaperone, C-terminal domain; Region: Pili_assembly_C; pfam02753
529507012459	HMMPfam hit to PF02753, Gram-negative pili assembly chaperone, score 2e-19
529507012460	HMMPfam hit to PF00345, Gram-negative pili assembly chaperone, score 1.2e-19
529507012461	1 probable transmembrane helix predicted for PMI2538 by TMHMM2.0 at aa 7-29
529507012462	Signal peptide predicted for PMI2538 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.998 between residues 27 and 28
529507012463	P pilus assembly protein, pilin FimA [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimA; COG3539
529507012464	HMMPfam hit to PF00419, Fimbrial protein, score 1.8e-05
529507012465	Signal peptide predicted for PMI2539 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.994 between residues 25 and 26
529507012466	atypical (a) SDRs, subgroup 5; Region: SDR_a5; cd05243
529507012467	NADH(P)-binding; Region: NAD_binding_10; pfam13460
529507012468	NAD(P) binding site [chemical binding]; other site
529507012469	putative active site [active]
529507012470	Domain of unknown function (DUF4156); Region: DUF4156; pfam13698
529507012471	Signal peptide predicted for PMI2541 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.209 between residues 27 and 28
529507012472	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507012473	3 probable transmembrane helices predicted for PMI2542 by TMHMM2.0 at aa 10-29, 89-106 and 129-151
529507012474	chaperonin GroEL; Reviewed; Region: groEL; PRK12849
529507012475	GroEL_like type I chaperonin. Chaperonins are involved in productive folding of proteins. They share a common general morphology, a double toroid of 2 stacked rings, each composed of 7-9 subunits. The symmetry of type I is seven-fold and they are found...; Region: GroEL; cd03344
529507012476	ring oligomerisation interface [polypeptide binding]; other site
529507012477	ATP/Mg binding site [chemical binding]; other site
529507012478	stacking interactions; other site
529507012479	hinge regions; other site
529507012480	HMMPfam hit to PF00118, TCP-1/cpn60 chaperonin family, score 4e-191
529507012481	PS00296 Chaperonins cpn60 signature.
529507012482	Chaperonin 10 Kd subunit (cpn10 or GroES); Cpn10 cooperates with chaperonin 60 (cpn60 or GroEL), an ATPase, to assist the folding and assembly of proteins and is found in eubacterial cytosol, as well as in the matrix of mitochondria and chloroplasts. It...; Region: cpn10; cd00320
529507012483	oligomerisation interface [polypeptide binding]; other site
529507012484	mobile loop; other site
529507012485	roof hairpin; other site
529507012486	HMMPfam hit to PF00166, Chaperonin 10 Kd subunit, score 4.3e-50
529507012487	PS00681 Chaperonins cpn10 signature.
529507012488	Protein affecting phage T7 exclusion by the F plasmid [General function prediction only]; Region: FxsA; COG3030
529507012489	HMMPfam hit to PF04186, FxsA cytoplasmic membrane protein, score 2e-42
529507012490	3 probable transmembrane helices predicted for PMI2545 by TMHMM2.0 at aa 2-24, 28-47 and 78-100
529507012491	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507012492	aspartate ammonia-lyase; Provisional; Region: aspA; PRK12273
529507012493	Aspartase; Region: Aspartase; cd01357
529507012494	active sites [active]
529507012495	tetramer interface [polypeptide binding]; other site
529507012496	HMMPfam hit to PF00206, Lyase, score 9.9e-167
529507012497	PS00163 Fumarate lyases signature.
529507012498	Anaerobic C4-dicarboxylate transporter [General function prediction only]; Region: DcuB; COG2704
529507012499	anaerobic C4-dicarboxylate transporter; Reviewed; Region: PRK09412
529507012500	HMMPfam hit to PF03605, Anaerobic c4-dicarboxylate membrane transpo, score 3.8e-217
529507012501	11 probable transmembrane helices predicted for PMI2547 by TMHMM2.0 at aa 15-37, 50-72, 87-109, 130-152, 172-194, 229-251, 266-285, 292-314, 334-353, 366-388 and 418-440
529507012502	putative transcriptional regulator; Provisional; Region: PRK11640
529507012503	mobile element
529507012504	DNA breaking-rejoining enzymes, intergrase/recombinases, C-terminal catalytic domain. The tyrosine recombinase/integrase family share the same catalytic domain containing six conserved active site residues. The best-studied members of this diverse family...; Region: INT_REC_C; cd01182
529507012505	active site
529507012506	catalytic residues [active]
529507012507	DNA binding site [nucleotide binding]
529507012508	Int/Topo IB signature motif; other site
529507012509	HMMPfam hit to PF00589, Phage integrase family, score 6.8e-10
529507012510	HMMPfam hit to PF02899, Phage integrase, N-terminal SAM-like, score 0.36
529507012511	integrating conjugative element relaxase, PFL_4751 family; Region: ICE_TraI_Pfluor; TIGR03760
529507012512	Protein of unknown function (DUF1528); Region: DUF1528; pfam07515
529507012513	HMMPfam hit to PF07515, Protein of unknown function (DUF1528), score 6.2e-08
529507012514	HMMPfam hit to PF07514, helicase, score 1.2e-12
529507012515	1 probable transmembrane helix predicted for PMI2551 by TMHMM2.0 at aa 42-64
529507012516	Protein of unknown function (DUF1281); Region: DUF1281; pfam06924
529507012517	PS00290 Immunoglobulins and major histocompatibility complex proteins signature.
529507012518	Protein of unknown function (DUF1219); Region: DUF1219; pfam06755
529507012519	Antirestriction protein [DNA replication, recombination, and repair]; Region: COG4227
529507012520	Domain of unknown function (DUF1738); Region: DUF1738; pfam08401
529507012521	1 probable transmembrane helix predicted for PMI2556 by TMHMM2.0 at aa 114-133
529507012522	1 probable transmembrane helix predicted for PMI2559 by TMHMM2.0 at aa 20-42
529507012523	Signal peptide predicted for PMI2562 by SignalP 2.0 HMM (Signal peptide probability 0.682) with cleavage site probability 0.566 between residues 28 and 29
529507012524	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely...; Region: SGNH_hydrolase; cd00229
529507012525	active site
529507012526	catalytic triad [active]
529507012527	oxyanion hole [active]
529507012528	Signal peptide predicted for PMI2563 by SignalP 2.0 HMM (Signal peptide probability 0.993) with cleavage site probability 0.992 between residues 20 and 21
529507012529	Phage integrase, N-terminal; Region: Integrase_l_N; pfam12834
529507012530	Integrase; Region: Integrase_1; pfam12835
529507012531	1 probable transmembrane helix predicted for PMI2568 by TMHMM2.0 at aa 4-23
529507012532	1 probable transmembrane helix predicted for PMI2569 by TMHMM2.0 at aa 51-73
529507012533	TraG-like protein, N-terminal region; Region: TraG_N; pfam07916
529507012534	5 probable transmembrane helices predicted for PMI2570 by TMHMM2.0 at aa 13-35, 69-91, 362-384, 389-408 and 445-467
529507012535	2 probable transmembrane helices predicted for PMI2571 by TMHMM2.0 at aa 13-35 and 55-74
529507012536	Signal peptide predicted for PMI2571 by SignalP 2.0 HMM (Signal peptide probability 0.992) with cleavage site probability 0.898 between residues 31 and 32
529507012537	integrating conjugative element protein, PFL_4711 family; Region: conj_TIGR03755
529507012538	Signal peptide predicted for PMI2572 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.668 between residues 25 and 26
529507012539	integrating conjugative element protein, PFL_4710 family; Region: conj_TIGR03756
529507012540	HMMPfam hit to PF07513, Protein of unknown function (DUF1527), score 4.2e-186
529507012541	Signal peptide predicted for PMI2573 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.753 between residues 37 and 38
529507012542	Protein of unknown function (DUF1525); Region: DUF1525; pfam07511
529507012543	HMMPfam hit to PF07511, Protein of unknown function (DUF1525), score 2.6e-23
529507012544	1 probable transmembrane helix predicted for PMI2574 by TMHMM2.0 at aa 30-52
529507012545	Signal peptide predicted for PMI2574 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.803 between residues 25 and 26
529507012546	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507012547	Left-handed beta-roll, including virulence factors and various other proteins; Region: LbR-like; cl17507
529507012548	trimer interface [polypeptide binding]; other site
529507012549	YadA-like C-terminal region; Region: YadA; pfam03895
529507012550	HMMPfam hit to PF03895, YadA-like C-terminal region, score 2.5e-06
529507012551	HMMPfam hit to PF05658, Hep_Hag, score 3.6e-05
529507012552	HMMPfam hit to PF05658, Hep_Hag, score 2.6e-05
529507012553	HMMPfam hit to PF05658, Hep_Hag, score 0.023
529507012554	Signal peptide predicted for PMI2575 by SignalP 2.0 HMM (Signal peptide probability 0.993) with cleavage site probability 0.966 between residues 23 and 24
529507012555	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507012556	conjugative transfer ATPase, PFL_4706 family; Region: traC_PFL_4706; TIGR03744
529507012557	F pilus assembly Type-IV secretion system for plasmid transfer; Region: TraC_F_IV; pfam11130
529507012558	PS00017 ATP/GTP-binding site motif A (P-loop).
529507012559	conjugative transfer region lipoprotein, TIGR03751 family; Region: conj_TIGR03751
529507012560	Signal peptide predicted for PMI2577 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.873 between residues 26 and 27
529507012561	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507012562	integrating conjugative element protein, PFL_4705 family; Region: conj_TIGR03752
529507012563	PS00215 Mitochondrial energy transfer proteins signature.
529507012564	Signal peptide predicted for PMI2579 by SignalP 2.0 HMM (Signal peptide probability 0.807) with cleavage site probability 0.260 between residues 20 and 21
529507012565	Protein of unknown function (DUF3438); Region: DUF3438; pfam11920
529507012566	Signal peptide predicted for PMI2580 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.882 between residues 29 and 30
529507012567	integrating conjugative element protein, PFL_4703 family; Region: conj_TIGR03746
529507012568	Signal peptide predicted for PMI2581 by SignalP 2.0 HMM (Signal peptide probability 0.973) with cleavage site probability 0.820 between residues 34 and 35
529507012569	conjugative transfer region protein, TIGR03750 family; Region: conj_TIGR03750
529507012570	2 probable transmembrane helices predicted for PMI2582 by TMHMM2.0 at aa 26-45 and 50-72
529507012571	Protein of unknown function (DUF2976); Region: DUF2976; cl12739
529507012572	3 probable transmembrane helices predicted for PMI2583 by TMHMM2.0 at aa 25-47, 74-96 and 108-130
529507012573	Signal peptide predicted for PMI2583 by SignalP 2.0 HMM (Signal peptide probability 0.993) with cleavage site probability 0.986 between residues 47 and 48
529507012574	Protein of unknown function (DUF3262); Region: DUF3262; pfam11660
529507012575	2 probable transmembrane helices predicted for PMI2584 by TMHMM2.0 at aa 20-42 and 62-78
529507012576	integrative conjugative element protein, RAQPRD family; Region: ICE_RAQPRD; TIGR01690
529507012577	Plasmid protein of unknown function (Plasmid_RAQPRD); Region: Plasmid_RAQPRD; pfam09686
529507012578	Signal peptide predicted for PMI2585 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.999 between residues 25 and 26
529507012579	Protein of unknown function (DUF2913); Region: DUF2913; pfam11140
529507012580	integrating conjugative element membrane protein, PFL_4697 family; Region: conj_TIGR03747
529507012581	3 probable transmembrane helices predicted for PMI2587 by TMHMM2.0 at aa 32-54, 153-175 and 221-243
529507012582	conjugative coupling factor TraD, SXT/TOL subfamily; Region: SXT_TraD; TIGR03743
529507012583	conjugative coupling factor TraD, TOL family; Region: conj_TOL_TraD; TIGR03754
529507012584	PS00030 Eukaryotic RNA-binding region RNP-1 signature.
529507012585	PS00017 ATP/GTP-binding site motif A (P-loop).
529507012586	1 probable transmembrane helix predicted for PMI2589 by TMHMM2.0 at aa 15-34
529507012587	Protein of unknown function (DUF2859); Region: DUF2859; pfam11072
529507012588	Signal peptide predicted for PMI2590 by SignalP 2.0 HMM (Signal peptide probability 0.998) with cleavage site probability 0.950 between residues 32 and 33
529507012589	Lytic Transglycosylase (LT)  and Goose Egg White Lysozyme (GEWL) domain. Members include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as, the eukaryotic "goose-type" lysozymes (GEWL).  LTs...; Region: LT_GEWL; cd00254
529507012590	N-acetyl-D-glucosamine binding site [chemical binding]; other site
529507012591	HMMPfam hit to PF01464, Transglycosylase SLT domain, score 8e-05
529507012592	Signal peptide predicted for PMI2591 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.709 between residues 20 and 21
529507012593	integrating conjugative element protein, PFL_4693 family; Region: conj_TIGR03759
529507012594	Signal peptide predicted for PMI2592 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.890 between residues 22 and 23
529507012595	Mitotic checkpoint protein; Region: MAD; pfam05557
529507012596	1 probable transmembrane helix predicted for PMI2593 by TMHMM2.0 at aa 21-43
529507012597	conjugative transfer region protein, TIGR03748 family; Region: conj_PilL
529507012598	Signal peptide predicted for PMI2594 by SignalP 2.0 HMM (Signal peptide probability 0.994) with cleavage site probability 0.669 between residues 30 and 31
529507012599	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507012600	IS1004 transposase (pseudogene);This CDS contains an inframe stop codon
529507012601	Predicted helix-turn-helix motif with score 1026.000, SD 2.68 at aa 78-99, sequence WARGYFADTVGVNEVIIRRYVR
529507012602	HMMPfam hit to PF01797, Transposase IS200 like, score 2.4e-37
529507012603	TonB-dependent siderophore receptor; Region: TonB-siderophor; TIGR01783
529507012604	TonB dependent/Ligand-Gated channels are created by a monomeric 22 strand (22,24) anti-parallel beta-barrel. Ligands apparently bind to the large extracellular loops. The N-terminal 150-200 residues form a plug from the periplasmic end of barrel; Region: ligand_gated_channel; cd01347
529507012605	N-terminal plug; other site
529507012606	ligand-binding site [chemical binding]; other site
529507012607	HMMPfam hit to PF00593, TonB dependent receptor, score 7.7e-25
529507012608	HMMPfam hit to PF07715, TonB-dependent Receptor Plug Domain, score 1.8e-11
529507012609	PS00430 TonB-dependent receptor proteins signature 1.
529507012610	Signal peptide predicted for PMI2596 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.864 between residues 25 and 26
529507012611	muropeptide transporter; Validated; Region: ampG; cl17669
529507012612	12 probable transmembrane helices predicted for PMI2597 by TMHMM2.0 at aa 2-24, 29-51, 71-90, 100-122, 143-165, 170-187, 217-239, 249-271, 276-298, 308-330, 343-365 and 370-392
529507012613	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 3.8e-07
529507012614	Methyltransferase domain; Region: Methyltransf_12; pfam08242
529507012615	Phosphopantetheine attachment site; Region: PP-binding; cl09936
529507012616	Condensation domain; Region: Condensation; pfam00668
529507012617	Non-ribosomal peptide synthetase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism]; Region: EntF; COG1020
529507012618	Nonribosomal peptide synthase; Region: NRPS; pfam08415
529507012619	The adenylation domain of nonribosomal peptide synthetases (NRPS), including Streptoalloteichus tallysomycin biosynthesis genes; Region: A_NRPS_TlmIV_like; cd12114
529507012620	acyl-activating enzyme (AAE) consensus motif; other site
529507012621	AMP binding site [chemical binding]; other site
529507012622	Methyltransferase domain; Region: Methyltransf_12; pfam08242
529507012623	Adenylate forming domain, Class I; Region: AFD_class_I; cl17068
529507012624	Phosphopantetheine attachment site; Region: PP-binding; pfam00550
529507012625	Condensation domain; Region: Condensation; pfam00668
529507012626	Non-ribosomal peptide synthetase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism]; Region: EntF; COG1020
529507012627	Nonribosomal peptide synthase; Region: NRPS; pfam08415
529507012628	Phosphopantetheine attachment site; Region: PP-binding; pfam00550
529507012629	HMMPfam hit to PF00668, Condensation domain, score 3.7e-37
529507012630	HMMPfam hit to PF00501, AMP-binding enzyme, score 2.1e-130
529507012631	PS00455 AMP-binding domain signature.
529507012632	HMMPfam hit to PF00550, Phosphopantetheine attachment site, score 5.9e-09
529507012633	HMMPfam hit to PF00668, Condensation domain, score 5.3e-46
529507012634	HMMPfam hit to PF00550, Phosphopantetheine attachment site, score 3.1e-05
529507012635	polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations. PKSs can be divided into 2 groups, modular type I PKSs consisting of one or...; Region: PKS; cd00833
529507012636	Beta-ketoacyl synthase; Region: PKS_KS; smart00825
529507012637	active site
529507012638	malonyl CoA-acyl carrier protein transacylase; Region: fabD; TIGR00128
529507012639	Acyl transferase domain in polyketide synthase (PKS) enzymes; Region: PKS_AT; smart00827
529507012640	Methyltransferase domain; Region: Methyltransf_12; pfam08242
529507012641	ketoreductase (KR) and fatty acid synthase (FAS), complex (x) SDRs; Region: KR_FAS_SDR_x; cd05274
529507012642	This enzymatic domain is part of bacterial polyketide synthases; Region: PKS_KR; smart00822
529507012643	NADP binding site [chemical binding]; other site
529507012644	active site
529507012645	Condensation domain; Region: Condensation; pfam00668
529507012646	Non-ribosomal peptide synthetase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism]; Region: EntF; COG1020
529507012647	Nonribosomal peptide synthase; Region: NRPS; pfam08415
529507012648	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
529507012649	Phosphopantetheine attachment site; Region: PP-binding; pfam00550
529507012650	Alpha/beta hydrolase family; Region: Abhydrolase_6; pfam12697
529507012651	HMMPfam hit to PF00109, Beta-ketoacyl synthase, N-terminal do, score 1.8e-73
529507012652	PS00606 Beta-ketoacyl synthases active site.
529507012653	PS00095 C-5 cytosine-specific DNA methylases C-terminal signature.
529507012654	HMMPfam hit to PF02801, Beta-ketoacyl synthase, C-terminal do, score 2.5e-70
529507012655	HMMPfam hit to PF00698, Acyl transferase domain, score 1.2e-32
529507012656	HMMPfam hit to PF00550, Phosphopantetheine attachment site, score 2.9e-10
529507012657	PS00012 Phosphopantetheine attachment site.
529507012658	HMMPfam hit to PF00668, Condensation domain, score 6.9e-38
529507012659	HMMPfam hit to PF00550, Phosphopantetheine attachment site, score 3.3e-10
529507012660	PS00012 Phosphopantetheine attachment site.
529507012661	HMMPfam hit to PF00975, Thioesterase domain, score 4.7e-06
529507012662	thiazolinyl imide reductase; Region: thiaz-red; TIGR01761
529507012663	Oxidoreductase family, NAD-binding Rossmann fold; Region: GFO_IDH_MocA; pfam01408
529507012664	HMMPfam hit to PF07414, Yersiniabactin synthetase thiazolinyl reduct, score 2.1e-250
529507012665	Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism]; Region: GrsT; COG3208
529507012666	Lipase.  Lipases are esterases that can hydrolyze long-chain acyl-triglycerides into di- and monoglycerides, glycerol, and free fatty acids at a water/lipid interface. A typical feature of lipases is "interfacial activation", the process of...; Region: Lipase; cl14883
529507012667	nucleophilic elbow; other site
529507012668	catalytic triad; other site
529507012669	HMMPfam hit to PF00975, Thioesterase domain, score 1.2e-37
529507012670	ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]; Region: MdlB; COG1132
529507012671	ABC transporter transmembrane region; Region: ABC_membrane; pfam00664
529507012672	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
529507012673	Walker A/P-loop; other site
529507012674	ATP binding site [chemical binding]; other site
529507012675	Q-loop/lid; other site
529507012676	ABC transporter signature motif; other site
529507012677	Walker B; other site
529507012678	D-loop; other site
529507012679	H-loop/switch region; other site
529507012680	Signal peptide predicted for PMI2603 by SignalP 2.0 HMM (Signal peptide probability 0.778) with cleavage site probability 0.408 between residues 38 and 39
529507012681	5 probable transmembrane helices predicted for PMI2603 by TMHMM2.0 at aa 22-44, 64-86, 147-169, 249-271 and 281-303
529507012682	HMMPfam hit to PF00664, ABC transporter transmembrane region, score 4.4e-16
529507012683	HMMPfam hit to PF00005, ABC transporter, score 6.7e-63
529507012684	PS00017 ATP/GTP-binding site motif A (P-loop).
529507012685	PS00211 ABC transporters family signature.
529507012686	ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]; Region: MdlB; COG1132
529507012687	ABC transporter transmembrane region; Region: ABC_membrane; pfam00664
529507012688	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
529507012689	Walker A/P-loop; other site
529507012690	ATP binding site [chemical binding]; other site
529507012691	Q-loop/lid; other site
529507012692	ABC transporter signature motif; other site
529507012693	Walker B; other site
529507012694	D-loop; other site
529507012695	H-loop/switch region; other site
529507012696	HMMPfam hit to PF00664, ABC transporter transmembrane region, score 2.2e-20
529507012697	6 probable transmembrane helices predicted for PMI2604 by TMHMM2.0 at aa 21-43, 53-75, 132-154, 159-178, 243-265 and 280-302
529507012698	HMMPfam hit to PF00005, ABC transporter, score 5.2e-53
529507012699	PS00017 ATP/GTP-binding site motif A (P-loop).
529507012700	PS00211 ABC transporters family signature.
529507012701	Phosphopantetheinyl transferase [Coenzyme metabolism]; Region: Sfp; COG2091
529507012702	4'-phosphopantetheinyl transferase superfamily; Region: ACPS; pfam01648
529507012703	HMMPfam hit to PF01648, 4'-phosphopantetheinyl transferase superfami, score 3.3e-20
529507012704	Pseudogene. This CDS contains an in frame stop codon.; conserved hypothetical protein (pseudogene)
529507012705	This CDS is truncated at N-terminus relative to database matches; conserved hypothetical protein (fragment)
529507012706	Predicted transcriptional regulator [Transcription]; Region: AlpA; COG3311
529507012707	HMMPfam hit to PF05930, Prophage CP4-57 regulatory protein (AlpA), score 4.2e-24
529507012708	Predicted helix-turn-helix motif with score 1303.000, SD 3.62 at aa 30-51, sequence LRLKQVEEKTGLKRSQIYLYMK
529507012709	conserved hypothetical protein (fragment)
529507012710	Transposase and inactivated derivatives [DNA replication, recombination, and repair]; Region: COG2963
529507012711	Transposase; Region: HTH_Tnp_1; cl17663
529507012712	HMMPfam hit to PF01527, Transposase, score 8e-14
529507012713	Predicted helix-turn-helix motif with score 1350.000, SD 3.78 at aa 23-44, sequence YTVADAANAMDVGLSTMTRWVK
529507012714	This CDS is disrupted by the insertion of an IS element.; transposase (pseudogene)
529507012715	Transposase; Region: DEDD_Tnp_IS110; pfam01548
529507012716	Transposase and inactivated derivatives [DNA replication, recombination, and repair]; Region: COG3547
529507012717	Transposase IS116/IS110/IS902 family; Region: Transposase_20; pfam02371
529507012718	HMMPfam hit to PF02371, Transposase IS116/IS110/IS902 family, score 2.9e-18
529507012719	This CDS is truncated at the N-terminus relative to database matches.; Almost identical to the C-terminus of PMI2633 (92.5 38d); conserved hypothetical protein (fragment)
529507012720	antirestriction protein (pseudogene);This CDS contains several frameshift mutations.
529507012721	TonB-dependent Receptor Plug Domain; Region: Plug; pfam07715
529507012722	Outer membrane receptor proteins, mostly Fe transport [Inorganic ion transport and metabolism]; Region: CirA; COG1629
529507012723	Porin superfamily.  These outer membrane channels share a beta-barrel structure that differ in strand and shear number.  Classical (gram-negative ) porins are non-specific channels for small hydrophillic molecules and form 16 beta-stranded barrels (16,20)...; Region: OM_channels; cl17244
529507012724	HMMPfam hit to PF00593, TonB dependent receptor, score 1e-17
529507012725	HMMPfam hit to PF07715, TonB-dependent Receptor Plug Domain, score 1.1e-12
529507012726	Signal peptide predicted for PMI2618 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.997 between residues 20 and 21
529507012727	Outer membrane receptor proteins, mostly Fe transport [Inorganic ion transport and metabolism]; Region: CirA; COG1629
529507012728	Porin superfamily.  These outer membrane channels share a beta-barrel structure that differ in strand and shear number.  Classical (gram-negative ) porins are non-specific channels for small hydrophillic molecules and form 16 beta-stranded barrels (16,20)...; Region: OM_channels; cl17244
529507012729	HMMPfam hit to PF00593, TonB dependent receptor, score 3.2e-20
529507012730	HMMPfam hit to PF07715, TonB-dependent Receptor Plug Domain, score 2.4e-23
529507012731	Signal peptide predicted for PMI2619 by SignalP 2.0 HMM (Signal peptide probability 0.982) with cleavage site probability 0.885 between residues 27 and 28
529507012732	membrane protein (fragment)
529507012733	1 probable transmembrane helix predicted for PMI2621 by TMHMM2.0 at aa 20-42
529507012734	degenerate fimbrial operon
529507012735	fimbrial usher protein (fragment)
529507012736	This CDS contains a frameshift mutation and two in frame stop codons; fimbrial chaperone chaperone (pseudogene)
529507012737	HMMPfam hit to PF02753, Gram-negative pili assembly chaperone, score 1.9e-07
529507012738	fimbrial subunit (fragment)
529507012739	HMMPfam hit to PF00419, Fimbrial protein, score 2.2e-07
529507012740	Signal peptide predicted for PMI2624 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 1.000 between residues 23 and 24
529507012741	Also similar to the N-terminus of PMI0307 (75.5 id).; ornithine decarboxylase (fragment)
529507012742	Also highly similar to the N-terminal region of PMI2592 (94.5 38d).; exported protein (fragment)
529507012743	putative transposase; Provisional; Region: PRK09857
529507012744	Putative transposase, YhgA-like; Region: Transposase_31; pfam04754
529507012745	HMMPfam hit to PF04754, transposase, YhgA-like, score 5.8e-138
529507012746	Protein of unknown function (DUF3577); Region: DUF3577; pfam12101
529507012747	DNA topoisomerase III; Provisional; Region: PRK07726
529507012748	TOPRIM_TopoIA_TopoIII: The topoisomerase-primase (TORPIM) domain found in members of the type IA family of DNA topoisomerases (Topo IA) similar to topoisomerase III. Type IA DNA topoisomerases remove (relax) negative supercoils in the DNA by: cleaving...; Region: TOPRIM_TopoIA_TopoIII; cd03362
529507012749	active site
529507012750	putative interdomain interaction site [polypeptide binding]; other site
529507012751	putative metal-binding site [ion binding]; other site
529507012752	putative nucleotide binding site [chemical binding]; other site
529507012753	DNA Topoisomerase, subtype IA; DNA-binding, ATP-binding and catalytic domain of bacterial DNA topoisomerases I and III, and eukaryotic DNA topoisomerase III and eubacterial and archael reverse gyrases. Topoisomerases clevage single or double stranded DNA...; Region: TOP1Ac; cd00186
529507012754	domain I; other site
529507012755	DNA binding groove [nucleotide binding]
529507012756	phosphate binding site [ion binding]; other site
529507012757	domain II; other site
529507012758	domain III; other site
529507012759	nucleotide binding site [chemical binding]; other site
529507012760	catalytic site [active]
529507012761	domain IV; other site
529507012762	Topoisomerase DNA binding C4 zinc finger; Region: zf-C4_Topoisom; pfam01396
529507012763	HMMPfam hit to PF01396, Topoisomerase DNA binding C4 zinc fing, score 3.1e-10
529507012764	HMMPfam hit to PF01131, DNA topoisomerase, score 9e-111
529507012765	HMMPfam hit to PF01751, Toprim domain, score 2.5e-24
529507012766	Signal peptide predicted for PMI2631 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.662 between residues 21 and 22
529507012767	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507012768	Domain of unknown function (DUF1845); Region: DUF1845; cl07481
529507012769	Protein of unknown function (DUF1706); Region: DUF1706; pfam08020
529507012770	Helix-turn-helix domain; Region: HTH_36; pfam13730
529507012771	Protein of unknown function (DUF2857); Region: DUF2857; pfam11198
529507012772	integrating conjugative element, PFGI_1 class, ParB family protein; Region: ICE_PFGI_1_parB; TIGR03764
529507012773	ParB-like nuclease domain; Region: ParBc; pfam02195
529507012774	DnaB-like helicase N terminal domain; Region: DnaB; pfam00772
529507012775	replicative DNA helicase; Region: DnaB; TIGR00665
529507012776	DnaB helicase C terminal domain. The hexameric helicase DnaB unwinds the DNA duplex at the  chromosome replication fork. Although the mechanism by which DnaB both couples ATP hydrolysis to translocation along DNA and denatures the duplex is unknown, a...; Region: DnaB_C; cd00984
529507012777	Walker A motif; other site
529507012778	ATP binding site [chemical binding]; other site
529507012779	Walker B motif; other site
529507012780	DNA binding loops [nucleotide binding]
529507012781	HMMPfam hit to PF03796, DnaB-like helicase C terminal domain, score 5.1e-107
529507012782	Predicted helix-turn-helix motif with score 1470.000, SD 4.19 at aa 347-368, sequence RSLKALAKELGCPVVALSQLNR
529507012783	PS00017 ATP/GTP-binding site motif A (P-loop).
529507012784	HMMPfam hit to PF00772, DnaB-like helicase N terminal domain, score 9.1e-43
529507012785	PS00290 Immunoglobulins and major histocompatibility complex proteins signature.
529507012786	ATPases involved in chromosome partitioning [Cell division and chromosome partitioning]; Region: Soj; COG1192
529507012787	ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the...; Region: ParA; cd02042
529507012788	P-loop; other site
529507012789	Magnesium ion binding site [ion binding]; other site
529507012790	The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain. Functionally, proteins in this superfamily use the energy from hydrolysis of NTP to transfer electron or ion; Region: Fer4_NifH; cl17203
529507012791	integrase (fragment)
529507012792	Beta-propeller domains of methanol dehydrogenase type [General function prediction only]; Region: COG1512
529507012793	Repair protein; Region: Repair_PSII; pfam04536
529507012794	4 probable transmembrane helices predicted for PMI2644 by TMHMM2.0 at aa 5-24, 181-203, 248-270 and 285-307
529507012795	HMMPfam hit to PF04536, Domain of unknown function (DUF477), score 2.6e-41
529507012796	Signal peptide predicted for PMI2644 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.766 between residues 24 and 25
529507012797	PS00430 TonB-dependent receptor proteins signature 1.
529507012798	Uncharacterized conserved protein [Function unknown]; Region: LemA; COG1704
529507012799	HMMPfam hit to PF04011, LemA family, score 3.8e-75
529507012800	PS00017 ATP/GTP-binding site motif A (P-loop).
529507012801	1 probable transmembrane helix predicted for PMI2645 by TMHMM2.0 at aa 4-23
529507012802	Signal peptide predicted for PMI2645 by SignalP 2.0 HMM (Signal peptide probability 0.824) with cleavage site probability 0.548 between residues 22 and 23
529507012803	Signal peptide predicted for PMI2646 by SignalP 2.0 HMM (Signal peptide probability 0.716) with cleavage site probability 0.483 between residues 33 and 34
529507012804	3 probable transmembrane helices predicted for PMI2646 by TMHMM2.0 at aa 13-35, 62-84 and 97-119
529507012805	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG2268
529507012806	Band_7_flotillin: a subgroup of the band 7 domain of flotillin (reggie) like proteins. This subgroup contains proteins similar to stomatin, prohibitin, flotillin, HlfK/C and podicin.  These two proteins are lipid raft-associated.  Individual proteins of...; Region: Band_7_flotillin; cd03399
529507012807	1 probable transmembrane helix predicted for PMI2647 by TMHMM2.0 at aa 5-27
529507012808	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507012809	ATPase involved in DNA repair; Region: DUF3686; pfam12458
529507012810	Protein-interacting V-domain of mammalian Alix and related domains; Region: V_Alix_like; cl14654
529507012811	putative YPXnL-motif binding site; other site
529507012812	AAA domain; Region: AAA_22; pfam13401
529507012813	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cl17189
529507012814	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507012815	Sugar (and other) transporter; Region: Sugar_tr; pfam00083
529507012816	putative substrate translocation pore; other site
529507012817	HMMPfam hit to PF00083, Sugar (and other) transporter, score 1e-41
529507012818	12 probable transmembrane helices predicted for PMI2649 by TMHMM2.0 at aa 21-43, 53-75, 84-103, 108-130, 143-165, 170-192, 243-265, 280-302, 309-331, 335-357, 370-392 and 397-419
529507012819	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 1.4e-30
529507012820	ferredoxin-like protein FixX; Provisional; Region: PRK15449
529507012821	2Fe-2S iron-sulfur cluster binding domain; Region: Fer2_3; pfam13085
529507012822	putative oxidoreductase FixC; Provisional; Region: PRK10157
529507012823	HMMPfam hit to PF01266, FAD dependent oxidoreductase, score 9.9e-15
529507012824	1 probable transmembrane helix predicted for PMI2651 by TMHMM2.0 at aa 7-26
529507012825	putative electron transfer flavoprotein FixB; Provisional; Region: fixB; PRK03363
529507012826	Electron transfer flavoprotein domain; Region: ETF; smart00893
529507012827	Electron transfer flavoprotein FAD-binding domain; Region: ETF_alpha; pfam00766
529507012828	PS00696 Electron transfer flavoprotein alpha-subunit signature.
529507012829	HMMPfam hit to PF00766, Electron transfer flavoprotein alpha subuni, score 8.9e-84
529507012830	The electron transfer flavoprotein (ETF) serves as a specific electron acceptor for various mitochondrial dehydrogenases. ETF transfers electrons to the main respiratory chain via ETF-ubiquinone oxidoreductase. ETF is an heterodimer that consists of an...; Region: ETF_beta; cd01714
529507012831	Ligand binding site [chemical binding]; other site
529507012832	Electron transfer flavoprotein domain; Region: ETF; pfam01012
529507012833	HMMPfam hit to PF01012, Electron transfer flavoprotein beta subunit, score 1.3e-90
529507012834	L-carnitine/gamma-butyrobetaine antiporter; Provisional; Region: PRK03356
529507012835	12 probable transmembrane helices predicted for PMI2654 by TMHMM2.0 at aa 13-30, 50-72, 92-114, 144-163, 184-206, 229-251, 264-286, 312-334, 347-366, 410-432, 445-467 and 472-494
529507012836	HMMPfam hit to PF02028, BCCT family transporter, score 1e-277
529507012837	crotonobetainyl-CoA dehydrogenase; Validated; Region: PRK03354
529507012838	Acyl-CoA dehydrogenase; Region: ACAD; cd00567
529507012839	active site
529507012840	HMMPfam hit to PF02771, Acyl-CoA dehydrogenase, N-terminal doma, score 1.6e-47
529507012841	HMMPfam hit to PF02770, Acyl-CoA dehydrogenase, middle domain, score 1.3e-51
529507012842	PS00072 Acyl-CoA dehydrogenases signature 1.
529507012843	HMMPfam hit to PF00441, Acyl-CoA dehydrogenase, C-terminal doma, score 5.9e-61
529507012844	PS00073 Acyl-CoA dehydrogenases signature 2.
529507012845	crotonobetainyl-CoA:carnitine CoA-transferase; Provisional; Region: PRK03525
529507012846	CoA-transferase family III; Region: CoA_transf_3; pfam02515
529507012847	HMMPfam hit to PF02515, CoA-transferase family III, score 1.7e-92
529507012848	putative crotonobetaine/carnitine-CoA ligase; Validated; Region: caiC; PRK08008
529507012849	Adenylate forming domain, Class I; Region: AFD_class_I; cl17068
529507012850	Uncharacterized subfamily of fatty acid CoA ligase (FACL); Region: FACL_DitJ_like; cd05934
529507012851	acyl-activating enzyme (AAE) consensus motif; other site
529507012852	putative AMP binding site [chemical binding]; other site
529507012853	putative active site [active]
529507012854	putative CoA binding site [chemical binding]; other site
529507012855	HMMPfam hit to PF00501, AMP-binding enzyme, score 3.6e-124
529507012856	PS00455 AMP-binding domain signature.
529507012857	carnitinyl-CoA dehydratase; Provisional; Region: PRK03580
529507012858	Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily. This superfamily contains a diverse set of enzymes including enoyl-CoA hydratase, napthoate synthase, methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA dehydratase, and dienoyl-CoA isomerase; Region: crotonase-like; cd06558
529507012859	substrate binding site [chemical binding]; other site
529507012860	oxyanion hole (OAH) forming residues; other site
529507012861	trimer interface [polypeptide binding]; other site
529507012862	HMMPfam hit to PF00378, Enoyl-CoA hydratase/isomerase family, score 8e-83
529507012863	PS00166 Enoyl-CoA hydratase/isomerase signature.
529507012864	carnitine operon protein CaiE; Provisional; Region: PRK13627
529507012865	paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E. coli paaY gene, which is part of the paa gene cluster responsible for phenylacetic acid degradation. Proteins in this group are expected to...; Region: LbH_paaY_like; cd04745
529507012866	putative trimer interface [polypeptide binding]; other site
529507012867	putative metal binding site [ion binding]; other site
529507012868	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 0.25
529507012869	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 55
529507012870	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 0.081
529507012871	DNA-binding transcriptional activator CaiF; Provisional; Region: PRK11476
529507012872	Transaldolase-like fructose-6-phosphate aldolases (FSA) found in bacteria and archaea; Region: Transaldolase_FSA; cd00956
529507012873	active site
529507012874	intersubunit interactions; other site
529507012875	catalytic residue [active]
529507012876	HMMPfam hit to PF00923, Transaldolase, score 7.7e-62
529507012877	PS01054 Transaldolase signature 1.
529507012878	Chitin binding domain; Region: Chitin_bind_3; pfam03067
529507012879	HMMPfam hit to PF03067, Chitin binding domain, score 2.5e-53
529507012880	Signal peptide predicted for PMI2662 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.971 between residues 26 and 27
529507012881	recombination regulator RecX; Reviewed; Region: recX; PRK00117
529507012882	HMMPfam hit to PF02631, RecX family, score 2.8e-13
529507012883	Signal peptide predicted for PMI2664 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.994 between residues 23 and 24
529507012884	Surface antigen; Region: Bac_surface_Ag; pfam01103
529507012885	Signal peptide predicted for PMI2665 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.999 between residues 23 and 24
529507012886	Protein of unknown function (DUF4056); Region: DUF4056; pfam13265
529507012887	Signal peptide predicted for PMI2666 by SignalP 2.0 HMM (Signal peptide probability 0.977) with cleavage site probability 0.770 between residues 25 and 26
529507012888	1 probable transmembrane helix predicted for PMI2666 by TMHMM2.0 at aa 5-24
529507012889	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507012890	hypothetical protein; Provisional; Region: PRK10356
529507012891	Uncharacterized FlgJ-related protein [General function prediction only]; Region: Bax; COG2992
529507012892	Signal peptide predicted for PMI2667 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.925 between residues 26 and 27
529507012893	1 probable transmembrane helix predicted for PMI2667 by TMHMM2.0 at aa 9-31
529507012894	HMMPfam hit to PF01832, Mannosyl-glycoprotein endo-beta-N-ace, score 1.6e-16
529507012895	Predicted membrane protein involved in D-alanine export [Cell envelope biogenesis, outer membrane]; Region: DltB; COG1696
529507012896	12 probable transmembrane helices predicted for PMI2668 by TMHMM2.0 at aa 4-22, 29-46, 50-67, 74-96, 116-138, 151-168, 188-207, 238-260, 321-343, 364-382, 411-433 and 440-459
529507012897	HMMPfam hit to PF03062, MBOAT family, score 1.4e-49
529507012898	SGNH_peri2; putative periplasmic member of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known...; Region: SGNH_hydrolase_peri2; cd01829
529507012899	active site
529507012900	catalytic triad [active]
529507012901	oxyanion hole [active]
529507012902	1 probable transmembrane helix predicted for PMI2669 by TMHMM2.0 at aa 13-30
529507012903	HMMPfam hit to PF04311, Protein of unknown function (DUF459), score 2e-41
529507012904	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely...; Region: SGNH_hydrolase; cl01053
529507012905	SGNH_peri1; putative periplasmic member of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known...; Region: SGNH_hydrolase_peri1; cd01825
529507012906	active site
529507012907	oxyanion hole [active]
529507012908	catalytic triad [active]
529507012909	Signal peptide predicted for PMI2670 by SignalP 2.0 HMM (Signal peptide probability 0.961) with cleavage site probability 0.574 between residues 28 and 29
529507012910	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507012911	Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]; Region: Tar; COG0840
529507012912	Methyl-accepting chemotaxis protein (MCP), signaling domain; Region: MCP_signal; cd11386
529507012913	dimer interface [polypeptide binding]; other site
529507012914	putative CheW interface [polypeptide binding]; other site
529507012915	MCP-signal associated domain; Region: MCPsignal_assoc; pfam13682
529507012916	HMMPfam hit to PF00015, Methyl-accepting chemotaxis protein (MCP) s, score 0.002
529507012917	low affinity gluconate transporter; Provisional; Region: PRK10472
529507012918	gluconate transporter; Region: gntP; TIGR00791
529507012919	HMMPfam hit to PF02447, GntP family permease, score 1.5e-215
529507012920	13 probable transmembrane helices predicted for PMI2672 by TMHMM2.0 at aa 4-21, 28-47, 57-79, 109-131, 146-168, 175-197, 228-250, 262-284, 299-316, 329-351, 356-378, 385-407 and 422-444
529507012921	Signal peptide predicted for PMI2672 by SignalP 2.0 HMM (Signal peptide probability 0.982) with cleavage site probability 0.422 between residues 28 and 29
529507012922	Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate. The resulting product gluconate-6-phoshate is an important precursor of gluconate metabolism. GntK acts as a dimmer composed of two identical subunits; Region: GntK; cd02021
529507012923	AAA domain; Region: AAA_33; pfam13671
529507012924	ATP-binding site [chemical binding]; other site
529507012925	Gluconate-6-phosphate binding site [chemical binding]; other site
529507012926	HMMPfam hit to PF01202, Shikimate kinase, score 1.7e-06
529507012927	PS00017 ATP/GTP-binding site motif A (P-loop).
529507012928	gluconate operon transcriptional regulator; Provisional; Region: PRK14987
529507012929	Helix-turn-helix (HTH) DNA binding domain of the LacI family of transcriptional regulators; Region: HTH_LacI; cd01392
529507012930	DNA binding site [nucleotide binding]
529507012931	domain linker motif; other site
529507012932	Ligand-binding domain of DNA transcription repressor GntR specific for gluconate, a member of the LacI-GalR family of bacterial transcription regulators; Region: PBP1_GntR; cd01575
529507012933	putative ligand binding site [chemical binding]; other site
529507012934	putative dimerization interface [polypeptide binding]; other site
529507012935	HMMPfam hit to PF00532, Periplasmic binding proteins and sugar b, score 6.8e-26
529507012936	HMMPfam hit to PF00356, Bacterial regulatory proteins, lacI fami, score 2e-09
529507012937	Predicted helix-turn-helix motif with score 2043.000, SD 6.15 at aa 6-27, sequence PSLQDVADRVGVTKMTVSRFLR
529507012938	PS00356 Bacterial regulatory proteins, lacI family signature.
529507012939	Metal binding protein HemV-2.  These proteins are predicted to function as initial receptors in ABC transport of metal ions.  They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding...; Region: HemV-2; cd01147
529507012940	Periplasmic binding protein; Region: Peripla_BP_2; pfam01497
529507012941	putative metal binding site [ion binding]; other site
529507012942	Signal peptide predicted for PMI2675 by SignalP 2.0 HMM (Signal peptide probability 0.998) with cleavage site probability 0.925 between residues 27 and 28
529507012943	HMMPfam hit to PF01497, Periplasmic binding protein, score 2.9e-06
529507012944	ABC-type enterobactin transport system, permease component [Inorganic ion transport and metabolism]; Region: FepG; COG4779
529507012945	Transmembrane subunit (TM), of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters involved in the uptake of siderophores, heme, vitamin B12, or the divalent cations Mg2+ and Zn2+. PBP-dependent ABC transporters consist of...; Region: TM_ABC_iron-siderophores_like; cd06550
529507012946	ABC-ATPase subunit  interface; other site
529507012947	dimer interface [polypeptide binding]; other site
529507012948	putative PBP binding regions; other site
529507012949	Signal peptide predicted for PMI2676 by SignalP 2.0 HMM (Signal peptide probability 0.989) with cleavage site probability 0.659 between residues 21 and 22
529507012950	9 probable transmembrane helices predicted for PMI2676 by TMHMM2.0 at aa 7-29, 58-80, 93-110, 114-136, 148-170, 190-212, 240-262, 272-294 and 307-326
529507012951	HMMPfam hit to PF01032, FecCD transport family, score 1.1e-109
529507012952	ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]; Region: FepC; COG1120
529507012953	ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins; Region: ABC_Iron-Siderophores_B12_Hemin; cd03214
529507012954	Walker A/P-loop; other site
529507012955	ATP binding site [chemical binding]; other site
529507012956	Q-loop/lid; other site
529507012957	ABC transporter signature motif; other site
529507012958	Walker B; other site
529507012959	D-loop; other site
529507012960	H-loop/switch region; other site
529507012961	HMMPfam hit to PF00005, ABC transporter, score 6.3e-51
529507012962	PS00017 ATP/GTP-binding site motif A (P-loop).
529507012963	PS00634 Ribosomal protein L30 signature.
529507012964	PS00211 ABC transporters family signature.
529507012965	Predicted helix-turn-helix motif with score 1040.000, SD 2.73 at aa 227-248, sequence LTPEHLAQLYNVKPTDIQAHFY
529507012966	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
529507012967	S-adenosylmethionine binding site [chemical binding]; other site
529507012968	molybdenum transport protein ModD; Provisional; Region: PRK06096
529507012969	ModD; Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase) present in some modABC operons in bacteria, which are involved in molybdate transport. In general, QPRTases are part of the de novo synthesis pathway of NAD in both prokaryotes and...; Region: modD_like; cd01573
529507012970	dimerization interface [polypeptide binding]; other site
529507012971	active site
529507012972	HMMPfam hit to PF02749, Quinolinate phosphoribosyl transferase, N-t, score 4.1e-26
529507012973	HMMPfam hit to PF01729, Quinolinate phosphoribosyl transferase, C-t, score 2.2e-53
529507012974	Outer membrane receptor proteins, mostly Fe transport [Inorganic ion transport and metabolism]; Region: CirA; COG1629
529507012975	TonB dependent/Ligand-Gated channels are created by a monomeric 22 strand (22,24) anti-parallel beta-barrel. Ligands apparently bind to the large extracellular loops. The N-terminal 150-200 residues form a plug from the periplasmic end of barrel; Region: ligand_gated_channel; cd01347
529507012976	N-terminal plug; other site
529507012977	ligand-binding site [chemical binding]; other site
529507012978	Signal peptide predicted for PMI2680 by SignalP 2.0 HMM (Signal peptide probability 0.998) with cleavage site probability 0.991 between residues 20 and 21
529507012979	HMMPfam hit to PF07715, TonB-dependent Receptor Plug Domain, score 8.5e-16
529507012980	HMMPfam hit to PF00593, TonB dependent receptor, score 4.2e-21
529507012981	low 4096C region region. type III secretion system.
529507012982	Invasion plasmid antigen IpaD; Region: IpaD; cl05827
529507012983	1 probable transmembrane helix predicted for PMI2682 by TMHMM2.0 at aa 150-172
529507012984	Secretion system effector C (SseC) like family; Region: SseC; pfam04888
529507012985	3 probable transmembrane helices predicted for PMI2683 by TMHMM2.0 at aa 421-443, 450-472 and 537-559
529507012986	chaperone protein SicA; Provisional; Region: PRK15331
529507012987	Tetratricopeptide repeat; Region: TPR_3; pfam07720
529507012988	Tetratricopeptide repeat; Region: TPR_3; pfam07720
529507012989	HMMPfam hit to PF07720, Tetratricopeptide repeat, score 4.1e-07
529507012990	HMMPfam hit to PF07720, Tetratricopeptide repeat, score 2.1e-10
529507012991	type III secretion system protein SpaS; Validated; Region: PRK08156
529507012992	HMMPfam hit to PF01312, FlhB HrpN YscU SpaS Family, score 1.5e-89
529507012993	4 probable transmembrane helices predicted for PMI2685 by TMHMM2.0 at aa 28-45, 76-98, 140-162 and 177-199
529507012994	Bacterial export proteins, family 1; Region: Bac_export_1; cl00734
529507012995	HMMPfam hit to PF01311, Bacterial export proteins, family, score 2.2e-43
529507012996	6 probable transmembrane helices predicted for PMI2686 by TMHMM2.0 at aa 7-29, 44-64, 71-93, 123-145, 179-201 and 211-233
529507012997	Bacterial export proteins, family 3; Region: Bac_export_3; cl00867
529507012998	HMMPfam hit to PF01313, Bacterial export proteins, family, score 1.6e-29
529507012999	2 probable transmembrane helices predicted for PMI2687 by TMHMM2.0 at aa 10-32 and 45-67
529507013000	type III secretion system protein SpaP; Provisional; Region: spaP; PRK12796
529507013001	HMMPfam hit to PF00813, FliP family, score 1.9e-100
529507013002	4 probable transmembrane helices predicted for PMI2688 by TMHMM2.0 at aa 7-36, 51-73, 156-178 and 183-205
529507013003	PS01061 Flagella transport protein fliP family signature 2.
529507013004	Signal peptide predicted for PMI2688 by SignalP 2.0 HMM (Signal peptide probability 0.988) with cleavage site probability 0.516 between residues 22 and 23
529507013005	type III secretion system apparatus protein YscQ/HrcQ; Region: SpaO_YscQ; TIGR02551
529507013006	Surface presentation of antigens (SPOA); Region: SpoA; pfam01052
529507013007	HMMPfam hit to PF01052, Surface presentation of antigens (SPOA) prot, score 2.8e-07
529507013008	integrating conjugative element protein, PFL_4705 family; Region: conj_TIGR03752
529507013009	ATP synthase SpaL; Validated; Region: PRK08149
529507013010	RecA-like NTPases. This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and...; Region: RecA-like_NTPases; cl17233
529507013011	Walker A motif; other site
529507013012	ATP binding site [chemical binding]; other site
529507013013	Walker B motif; other site
529507013014	HMMPfam hit to PF00006, ATP synthase alpha/beta family, nucleot, score 6.3e-103
529507013015	PS00152 ATP synthase alpha and beta subunits signature.
529507013016	PS00017 ATP/GTP-binding site motif A (P-loop).
529507013017	HMMPfam hit to PF02874, ATP synthase alpha/beta family, beta-ba, score 0.0035
529507013018	Invasion protein B family; Region: Invas_SpaK; cl04129
529507013019	HMMPfam hit to PF03519, Invasion protein B family, score 2.1e-07
529507013020	type III secretion system protein InvA; Provisional; Region: PRK15337
529507013021	Flagellar biosynthesis pathway, component FlhA [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FlhA; cl07980
529507013022	HMMPfam hit to PF00771, FHIPEP family, score 8.5e-294
529507013023	7 probable transmembrane helices predicted for PMI2694 by TMHMM2.0 at aa 13-30, 35-57, 69-91, 106-128, 197-219, 239-261 and 282-304
529507013024	PS00994 Bacterial export FHIPEP family signature.
529507013025	Signal peptide predicted for PMI2694 by SignalP 2.0 HMM (Signal peptide probability 0.686) with cleavage site probability 0.678 between residues 36 and 37
529507013026	type III secretion system regulator InvE; Provisional; Region: PRK15338
529507013027	HrpJ-like domain; Region: HrpJ; cl15454
529507013028	HMMPfam hit to PF02523, InvE invasion protein, score 3.7e-10
529507013029	type III secretion outer membrane pore, YscC/HrcC family; Region: type_III_yscC; TIGR02516
529507013030	Bacterial type II/III secretion system short domain; Region: Secretin_N; pfam03958
529507013031	Bacterial type II and III secretion system protein; Region: Secretin; pfam00263
529507013032	HMMPfam hit to PF00263, Bacterial type II and III secretion system, score 1.1e-58
529507013033	HMMPfam hit to PF03958, Bacterial type II/III secretion system sho, score 5.6e-10
529507013034	HMMPfam hit to PF03958, Bacterial type II/III secretion system sho, score 1e-05
529507013035	1 probable transmembrane helix predicted for PMI2696 by TMHMM2.0 at aa 7-26
529507013036	Signal peptide predicted for PMI2696 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.996 between residues 25 and 26
529507013037	helix_turn_helix, arabinose operon control protein; Region: HTH_ARAC; smart00342
529507013038	Bacterial regulatory helix-turn-helix proteins, AraC family; Region: HTH_AraC; pfam00165
529507013039	HMMPfam hit to PF00165, Bacterial regulatory helix-turn-helix protei, score 1e-08
529507013040	HMMPfam hit to PF00165, Bacterial regulatory helix-turn-helix protei, score 0.023
529507013041	Predicted helix-turn-helix motif with score 1151.000, SD 3.11 at aa 158-179, sequence SNIAQIGERYGVSGTHFRRLCK
529507013042	Type III secretion system protein PrgH-EprH (PrgH); Region: PrgH; pfam09480
529507013043	1 probable transmembrane helix predicted for PMI2698 by TMHMM2.0 at aa 129-146
529507013044	Type III secretion needle MxiH like; Region: MxiH; cl09641
529507013045	Secretory protein of YscJ/FliF family; Region: YscJ_FliF; cl01907
529507013046	HMMPfam hit to PF01514, Secretory protein of YscJ/FliF family, score 8.7e-37
529507013047	Signal peptide predicted for PMI2701 by SignalP 2.0 HMM (Signal peptide probability 0.975) with cleavage site probability 0.481 between residues 20 and 21
529507013048	1 probable transmembrane helix predicted for PMI2701 by TMHMM2.0 at aa 215-237
529507013049	Bacterial type III secretion apparatus protein (OrgA_MxiK); Region: OrgA_MxiK; cl09716
529507013050	Helix-Turn-Helix DNA binding domain of the SoxR transcription regulator; Region: HTH_SoxR; cd01110
529507013051	redox-sensitive transcriptional activator SoxR; Region: SoxR; TIGR01950
529507013052	DNA binding residues [nucleotide binding]
529507013053	dimer interface [polypeptide binding]; other site
529507013054	[2Fe-2S] cluster binding site [ion binding]; other site
529507013055	HMMPfam hit to PF00376, MerR family regulatory protein, score 1.5e-12
529507013056	PS00552 Bacterial regulatory proteins, merR family signature.
529507013057	Predicted helix-turn-helix motif with score 1192.000, SD 3.25 at aa 12-33, sequence LTVGEVAKRSGVAISTLHFYEE
529507013058	Predicted membrane protein [Function unknown]; Region: COG2259
529507013059	Signal peptide predicted for PMI2706 by SignalP 2.0 HMM (Signal peptide probability 0.819) with cleavage site probability 0.762 between residues 32 and 33
529507013060	HMMPfam hit to PF07681, DoxX, score 2.4e-16
529507013061	4 probable transmembrane helices predicted for PMI2706 by TMHMM2.0 at aa 15-32, 53-72, 76-98 and 105-127
529507013062	RND family efflux transporter, MFP subunit; Region: RND_mfp; TIGR01730
529507013063	Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS). These domains transport CO2, acyl; Region: Biotinyl_lipoyl_domains; cl11404
529507013064	HlyD family secretion protein; Region: HlyD_3; pfam13437
529507013065	Signal peptide predicted for PMI2707 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.530 between residues 24 and 25
529507013066	1 probable transmembrane helix predicted for PMI2707 by TMHMM2.0 at aa 5-27
529507013067	HMMPfam hit to PF00529, HlyD family secretion protein, score 0.00024
529507013068	multidrug efflux protein; Reviewed; Region: PRK09579
529507013069	Signal peptide predicted for PMI2708 by SignalP 2.0 HMM (Signal peptide probability 0.996) with cleavage site probability 0.554 between residues 30 and 31
529507013070	HMMPfam hit to PF00873, AcrB/AcrD/AcrF family, score 0
529507013071	10 probable transmembrane helices predicted for PMI2708 by TMHMM2.0 at aa 7-29, 333-352, 359-381, 433-455, 462-484, 521-543, 847-869, 873-895, 944-966 and 981-1003
529507013072	Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways. The depth of the active site cleft renders the enzyme specific for phosphorylated Tyr; Region: PTPc; cl00053
529507013073	active site
529507013074	HMMPfam hit to PF00102, Protein-tyrosine phosphatase, score 3.2e-09
529507013075	PS00383 Tyrosine specific protein phosphatases active site.
529507013076	This region is similar to a region witin E.coli PAI_II536 (Dobrindt et al. 2002 I&I 70, 6365-6372)
529507013077	Membrane transporters of cations and cationic drugs [Inorganic ion transport and metabolism]; Region: EmrE; COG2076
529507013078	3 probable transmembrane helices predicted for PMI2710 by TMHMM2.0 at aa 31-53, 57-79 and 86-105
529507013079	HMMPfam hit to PF00893, Small Multidrug Resistance protein, score 2.8e-31
529507013080	Membrane transporters of cations and cationic drugs [Inorganic ion transport and metabolism]; Region: EmrE; COG2076
529507013081	3 probable transmembrane helices predicted for PMI2711 by TMHMM2.0 at aa 33-55, 62-84 and 94-111
529507013082	HMMPfam hit to PF00893, Small Multidrug Resistance protein, score 2.1e-19
529507013083	Signal peptide predicted for PMI2711 by SignalP 2.0 HMM (Signal peptide probability 0.703) with cleavage site probability 0.409 between residues 21 and 22
529507013084	propanediol utilization phosphotransacylase; Provisional; Region: PRK15070
529507013085	Propanediol utilisation protein PduL; Region: PduL; pfam06130
529507013086	Propanediol utilisation protein PduL; Region: PduL; pfam06130
529507013087	HMMPfam hit to PF06130, Propanediol utilisation protein PduL, score 3.7e-119
529507013088	Carbon dioxide concentrating mechanism/carboxysome shell protein [Secondary metabolites biosynthesis, transport, and catabolism / Energy production and conversion]; Region: CcmK; COG4577
529507013089	Carbon dioxide concentrating mechanism K (CcmK)-like proteins, Bacterial Micro-Compartment (BMC) domain; Region: BMC_CcmK_like; cd07045
529507013090	Hexamer interface [polypeptide binding]; other site
529507013091	Hexagonal pore residue; other site
529507013092	HMMPfam hit to PF00936, Bacterial microcompartments protein fam, score 1.2e-22
529507013093	glycyl-radical enzyme activating protein family; Region: PFLE_PFLC; TIGR02494
529507013094	HMMPfam hit to PF04055, Radical SAM superfamily, score 2.2e-14
529507013095	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 0.0027
529507013096	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 2e-05
529507013097	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
529507013098	PS01087 Radical activating enzymes signature.
529507013099	Ribonucleotide reductase and Pyruvate formate lyase; Region: RNR_PFL; cl09939
529507013100	Ribonucleotide reductase and Pyruvate formate lyase; Region: RNR_PFL; cl09939
529507013101	glycyl radical enzyme, PFL2/glycerol dehydratase family; Region: PFL2-3; TIGR01774
529507013102	Pyruvate formate lyase 2 and related enzymes; Region: PFL2_DhaB_BssA; cd01677
529507013103	dimer interface [polypeptide binding]; other site
529507013104	active site
529507013105	glycine loop; other site
529507013106	HMMPfam hit to PF01228, Glycine radical, score 1.7e-05
529507013107	PS00850 Glycine radical signature.
529507013108	HMMPfam hit to PF02901, Pyruvate formate lyase, score 6.1e-64
529507013109	Alcohol dehydrogenase, class IV [Energy production and conversion]; Region: EutG; COG1454
529507013110	1,3-propanediol dehydrogenase (PPD) catalyzes the reduction of 3-hydroxypropionaldehyde (3-HPA) to 1,3-propanediol in glycerol metabolism; Region: PDD; cd08180
529507013111	putative active site [active]
529507013112	metal binding site [ion binding]; metal-binding site
529507013113	HMMPfam hit to PF00465, Iron-containing alcohol dehydrogenase, score 5.3e-114
529507013114	PS00060 Iron-containing alcohol dehydrogenases signature 2.
529507013115	PS00913 Iron-containing alcohol dehydrogenases signature 1.
529507013116	Ethanolamine utilisation protein and carboxysome structural protein domain family; Region: EutN_CcmL; cd01614
529507013117	Hexamer/Pentamer interface [polypeptide binding]; other site
529507013118	central pore; other site
529507013119	NAD-dependent aldehyde dehydrogenases [Energy production and conversion]; Region: PutA; COG1012
529507013120	Coenzyme A acylating aldehyde dehydrogenase (ACDH), ALDH family 20-like; Region: ALDH_F20_ACDH; cd07122
529507013121	putative catalytic cysteine [active]
529507013122	Carbon dioxide concentrating mechanism/carboxysome shell protein [Secondary metabolites biosynthesis, transport, and catabolism / Energy production and conversion]; Region: CcmK; COG4577
529507013123	Carbon dioxide concentrating mechanism K (CcmK)-like proteins, Bacterial Micro-Compartment (BMC) domain; Region: BMC_CcmK_like; cd07045
529507013124	Hexamer interface [polypeptide binding]; other site
529507013125	Hexagonal pore residue; other site
529507013126	HMMPfam hit to PF00936, Bacterial microcompartments protein fam, score 3.5e-42
529507013127	PS01139 Bacterial microcompartiments proteins signature.
529507013128	Carbon dioxide concentrating mechanism/carboxysome shell protein [Secondary metabolites biosynthesis, transport, and catabolism / Energy production and conversion]; Region: CcmK; COG4577
529507013129	Carbon dioxide concentrating mechanism K (CcmK)-like proteins, Bacterial Micro-Compartment (BMC) domain; Region: BMC_CcmK_like; cd07045
529507013130	Hexamer interface [polypeptide binding]; other site
529507013131	Hexagonal pore residue; other site
529507013132	HMMPfam hit to PF00936, Bacterial microcompartments protein fam, score 2.1e-44
529507013133	PS01139 Bacterial microcompartiments proteins signature.
529507013134	Carbon dioxide concentrating mechanism/carboxysome shell protein [Secondary metabolites biosynthesis, transport, and catabolism / Energy production and conversion]; Region: CcmK; COG4577
529507013135	Carbon dioxide concentrating mechanism K (CcmK)-like proteins, Bacterial Micro-Compartment (BMC) domain; Region: BMC_CcmK_like; cd07045
529507013136	Hexamer interface [polypeptide binding]; other site
529507013137	Hexagonal pore residue; other site
529507013138	HMMPfam hit to PF00936, Bacterial microcompartments protein fam, score 2.2e-42
529507013139	PS01139 Bacterial microcompartiments proteins signature.
529507013140	Signal peptide predicted for PMI2723 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.838 between residues 23 and 24
529507013141	Transcriptional regulatory protein, C terminal; Region: Trans_reg_C; smart00862
529507013142	DNA binding site [nucleotide binding]
529507013143	1 probable transmembrane helix predicted for PMI2724 by TMHMM2.0 at aa 175-197
529507013144	HMMPfam hit to PF00486, Transcriptional regulatory protein, C ter, score 0.0002
529507013145	Transcriptional regulator [Transcription]; Region: AcrR; COG1309
529507013146	Bacterial regulatory proteins, tetR family; Region: TetR_N; pfam00440
529507013147	HMMPfam hit to PF00440, Bacterial regulatory proteins, tetR family, score 4.6e-12
529507013148	Predicted helix-turn-helix motif with score 1173.000, SD 3.18 at aa 35-56, sequence LSLNAVAKEAGVSKGGLLHHFP
529507013149	O-acetylhomoserine aminocarboxypropyltransferase; Validated; Region: PRK06084
529507013150	CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis. This pathway is unique to microorganisms and plants, rendering the enzyme an attractive target for the development of...; Region: CGS_like; cd00614
529507013151	homodimer interface [polypeptide binding]; other site
529507013152	substrate-cofactor binding pocket; other site
529507013153	pyridoxal 5'-phosphate binding site [chemical binding]; other site
529507013154	catalytic residue [active]
529507013155	HMMPfam hit to PF01053, Cys/Met metabolism PLP-dependent enzy, score 1.8e-216
529507013156	aromatic amino acid exporter; Provisional; Region: PRK11689
529507013157	10 probable transmembrane helices predicted for PMI2727 by TMHMM2.0 at aa 7-26, 32-54, 66-88, 93-115, 120-139, 159-177, 184-206, 211-233, 240-262 and 272-291
529507013158	fimbrial operon 13
529507013159	Fimbrial protein; Region: Fimbrial; cl01416
529507013160	Signal peptide predicted for PMI2728 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 1.000 between residues 23 and 24
529507013161	HMMPfam hit to PF00419, Fimbrial protein, score 1.1e-43
529507013162	long polar fimbrial chaperone LpfB; Provisional; Region: PRK15208
529507013163	Gram-negative pili assembly chaperone, N-terminal domain; Region: Pili_assembly_N; pfam00345
529507013164	Gram-negative pili assembly chaperone, C-terminal domain; Region: Pili_assembly_C; pfam02753
529507013165	Signal peptide predicted for PMI2729 by SignalP 2.0 HMM (Signal peptide probability 0.995) with cleavage site probability 0.429 between residues 24 and 25
529507013166	1 probable transmembrane helix predicted for PMI2729 by TMHMM2.0 at aa 7-29
529507013167	HMMPfam hit to PF00345, Gram-negative pili assembly chaperone, score 1.2e-58
529507013168	PS00635 Gram-negative pili assembly chaperone signature.
529507013169	HMMPfam hit to PF02753, Gram-negative pili assembly chaperone, score 4.8e-13
529507013170	outer membrane usher protein; Provisional; Region: PRK15193
529507013171	PapC N-terminal domain; Region: PapC_N; pfam13954
529507013172	Type VII secretion system (T7SS), usher protein; Region: Usher; pfam00577
529507013173	PapC C-terminal domain; Region: PapC_C; pfam13953
529507013174	Signal peptide predicted for PMI2730 by SignalP 2.0 HMM (Signal peptide probability 0.995) with cleavage site probability 0.748 between residues 31 and 32
529507013175	1 probable transmembrane helix predicted for PMI2730 by TMHMM2.0 at aa 12-31
529507013176	HMMPfam hit to PF00577, Fimbrial Usher protein, score 0
529507013177	P pilus assembly protein, pilin FimA [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimA; COG3539
529507013178	Signal peptide predicted for PMI2731 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.998 between residues 20 and 21
529507013179	HMMPfam hit to PF00419, Fimbrial protein, score 7.4e-31
529507013180	P pilus assembly protein, pilin FimA [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimA; COG3539
529507013181	Signal peptide predicted for PMI2732 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.950 between residues 24 and 25
529507013182	HMMPfam hit to PF00419, Fimbrial protein, score 0.0016
529507013183	Predicted transcriptional regulators [Transcription]; Region: HipB; COG1396
529507013184	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
529507013185	non-specific DNA binding site [nucleotide binding]; other site
529507013186	salt bridge; other site
529507013187	sequence-specific DNA binding site [nucleotide binding]; other site
529507013188	HMMPfam hit to PF01381, Helix-turn-helix, score 4.3e-14
529507013189	Predicted helix-turn-helix motif with score 1821.000, SD 5.39 at aa 25-46, sequence YSGKLFAKELGISQQQLSRYER
529507013190	spermidine/putrescine ABC transporter periplasmic substrate-binding protein; Reviewed; Region: potD; PRK09501
529507013191	Bacterial extracellular solute-binding protein; Region: SBP_bac_6; pfam13343
529507013192	HMMPfam hit to PF01547, Bacterial extracellular solute-binding prot, score 1.7e-12
529507013193	PS00017 ATP/GTP-binding site motif A (P-loop).
529507013194	Signal peptide predicted for PMI2734 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.998 between residues 22 and 23
529507013195	ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism]; Region: PotC; COG1177
529507013196	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
529507013197	dimer interface [polypeptide binding]; other site
529507013198	conserved gate region; other site
529507013199	putative PBP binding loops; other site
529507013200	ABC-ATPase subunit interface; other site
529507013201	HMMPfam hit to PF00528, Binding-protein-dependent transport syst, score 3.3e-11
529507013202	6 probable transmembrane helices predicted for PMI2735 by TMHMM2.0 at aa 5-27, 64-86, 99-121, 126-148, 176-195 and 230-252
529507013203	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
529507013204	ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism]; Region: PotC; COG1177
529507013205	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
529507013206	dimer interface [polypeptide binding]; other site
529507013207	conserved gate region; other site
529507013208	putative PBP binding loops; other site
529507013209	ABC-ATPase subunit interface; other site
529507013210	HMMPfam hit to PF00528, Binding-protein-dependent transport syst, score 5.1e-17
529507013211	6 probable transmembrane helices predicted for PMI2736 by TMHMM2.0 at aa 12-34, 70-92, 99-121, 152-174, 195-217 and 251-273
529507013212	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
529507013213	Signal peptide predicted for PMI2736 by SignalP 2.0 HMM (Signal peptide probability 0.785) with cleavage site probability 0.371 between residues 38 and 39
529507013214	putrescine/spermidine ABC transporter ATPase protein; Reviewed; Region: potA; PRK09452
529507013215	ATP-binding cassette domain of the polyamine transporter; Region: ABC_PotA_N; cd03300
529507013216	Walker A/P-loop; other site
529507013217	ATP binding site [chemical binding]; other site
529507013218	Q-loop/lid; other site
529507013219	ABC transporter signature motif; other site
529507013220	Walker B; other site
529507013221	D-loop; other site
529507013222	H-loop/switch region; other site
529507013223	TOBE domain; Region: TOBE_2; pfam08402
529507013224	HMMPfam hit to PF00005, ABC transporter, score 4.5e-70
529507013225	PS00211 ABC transporters family signature.
529507013226	PS00017 ATP/GTP-binding site motif A (P-loop).
529507013227	Subtilisin-like serine proteases [Posttranslational modification, protein turnover, chaperones]; Region: AprE; COG1404
529507013228	Peptidase S8 family domain, uncharacterized subfamily 11; Region: Peptidases_S8_11; cd04843
529507013229	putative active site [active]
529507013230	putative catalytic triad [active]
529507013231	HMMPfam hit to PF00082, Subtilase family, score 6.3e-09
529507013232	tRNA-dihydrouridine synthase A; Provisional; Region: PRK11815
529507013233	Dihydrouridine synthase-like (DUS-like) FMN-binding domain. Members of this family catalyze the reduction of the 5,6-double bond of a uridine residue on tRNA. Dihydrouridine modification of tRNA is widely observed in prokaryotes and eukaryotes, and also...; Region: DUS_like_FMN; cd02801
529507013234	FMN binding site [chemical binding]; other site
529507013235	active site
529507013236	catalytic residues [active]
529507013237	substrate binding site [chemical binding]; other site
529507013238	HMMPfam hit to PF01207, Dihydrouridine synthase (Dus), score 3e-134
529507013239	PS01136 Uncharacterized protein family UPF0034 signature.
529507013240	quinone oxidoreductase, NADPH-dependent; Provisional; Region: PRK10754
529507013241	Quinone oxidoreductase (QOR); Region: QOR2; cd05286
529507013242	NADP binding site [chemical binding]; other site
529507013243	dimer interface [polypeptide binding]; other site
529507013244	HMMPfam hit to PF00107, Zinc-binding dehydrogenase, score 1.4e-76
529507013245	PS01162 Quinone oxidoreductase / zeta-crystallin signature.
529507013246	replicative DNA helicase; Provisional; Region: PRK08006
529507013247	DnaB-like helicase N terminal domain; Region: DnaB; pfam00772
529507013248	DnaB helicase C terminal domain. The hexameric helicase DnaB unwinds the DNA duplex at the  chromosome replication fork. Although the mechanism by which DnaB both couples ATP hydrolysis to translocation along DNA and denatures the duplex is unknown, a...; Region: DnaB_C; cd00984
529507013249	Walker A motif; other site
529507013250	ATP binding site [chemical binding]; other site
529507013251	Walker B motif; other site
529507013252	DNA binding loops [nucleotide binding]
529507013253	HMMPfam hit to PF00772, DnaB-like helicase N terminal domain, score 7.5e-56
529507013254	HMMPfam hit to PF03796, DnaB-like helicase C terminal domain, score 4.1e-137
529507013255	PS00017 ATP/GTP-binding site motif A (P-loop).
529507013256	Predicted helix-turn-helix motif with score 1279.000, SD 3.54 at aa 374-395, sequence RSLKALAKELQVPVVALSQLNR
529507013257	alanine racemase; Reviewed; Region: alr; PRK00053
529507013258	Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, Proteobacterial Alanine Racemases; Region: PLPDE_III_AR_proteobact; cd06827
529507013259	active site
529507013260	pyridoxal 5'-phosphate (PLP) binding site [chemical binding]; other site
529507013261	substrate binding site [chemical binding]; other site
529507013262	catalytic residues [active]
529507013263	dimer interface [polypeptide binding]; other site
529507013264	HMMPfam hit to PF01168, Alanine racemase, N-terminal domain, score 2.4e-84
529507013265	PS00395 Alanine racemase pyridoxal-phosphate attachment site.
529507013266	HMMPfam hit to PF00842, Alanine racemase, C-terminal domain, score 2.7e-67
529507013267	aromatic amino acid aminotransferase; Provisional; Region: PRK09257
529507013268	Aspartate aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). Pyridoxal phosphate combines with an alpha-amino acid to form a compound called a Schiff base or aldimine...; Region: AAT_like; cd00609
529507013269	pyridoxal 5'-phosphate binding site [chemical binding]; other site
529507013270	homodimer interface [polypeptide binding]; other site
529507013271	catalytic residue [active]
529507013272	HMMPfam hit to PF00155, Aminotransferase class I and II, score 2.4e-90
529507013273	PS00105 Aminotransferases class-I pyridoxal-phosphate attachment site.
529507013274	L-cysteine desulfidase [Amino acid transport and metabolism]; Region: COG3681
529507013275	HMMPfam hit to PF06354, Protein of unknown function (DUF1063), score 8.3e-199
529507013276	serine transporter; Region: stp; TIGR00814
529507013277	Amino acid permeases [Amino acid transport and metabolism]; Region: SdaC; COG0814
529507013278	11 probable transmembrane helices predicted for PMI2745 by TMHMM2.0 at aa 41-63, 68-90, 116-138, 153-172, 192-209, 224-246, 267-289, 317-339, 364-383, 388-410 and 423-442
529507013279	excinuclease ABC subunit A; Reviewed; Region: uvrA; PRK00349
529507013280	ATP-binding cassette domain I of the excision repair protein UvrA; Region: ABC_UvrA_I; cd03270
529507013281	Cysteine-rich CPCC; Region: Cys_rich_CPCC; pfam14206
529507013282	ATP-binding cassette domain I of the excision repair protein UvrA; Region: ABC_UvrA_I; cd03270
529507013283	ATP-binding cassette domain II of the excision repair protein UvrA; Region: ABC_UvrA_II; cd03271
529507013284	HMMPfam hit to PF00005, ABC transporter, score 4.5e-36
529507013285	PS00211 ABC transporters family signature.
529507013286	PS00017 ATP/GTP-binding site motif A (P-loop).
529507013287	HMMPfam hit to PF00005, ABC transporter, score 2.4e-07
529507013288	PS00211 ABC transporters family signature.
529507013289	PS00017 ATP/GTP-binding site motif A (P-loop).
529507013290	Single-stranded DNA-binding protein [DNA replication, recombination, and repair]; Region: Ssb; COG0629
529507013291	SSB_OBF: A subfamily of OB folds similar to the OB fold of ssDNA-binding protein (SSB). SSBs bind with high affinity to ssDNA. They bind to and protect ssDNA intermediates during DNA metabolic pathways. All bacterial and eukaryotic SSBs studied to date...; Region: SSB_OBF; cd04496
529507013292	dimer interface [polypeptide binding]; other site
529507013293	ssDNA binding site [nucleotide binding]; other site
529507013294	tetramer (dimer of dimers) interface [polypeptide binding]; other site
529507013295	HMMPfam hit to PF00436, Single-strand binding protein family, score 7.3e-39
529507013296	PS00735 Single-strand binding protein family signature 1.
529507013297	PS00736 Single-strand binding protein family signature 2.
529507013298	ferric uptake regulator; Provisional; Region: fur; PRK09462
529507013299	Ferric uptake regulator(Fur) and related metalloregulatory proteins; typically iron-dependent, DNA-binding repressors and activators; Region: Fur_like; cd07153
529507013300	metal binding site 2 [ion binding]; metal-binding site
529507013301	putative DNA binding helix; other site
529507013302	metal binding site 1 [ion binding]; metal-binding site
529507013303	dimer interface [polypeptide binding]; other site
529507013304	structural Zn2+ binding site [ion binding]; other site
529507013305	HMMPfam hit to PF01475, Ferric uptake regulator family, score 8.3e-07
529507013306	PS00190 Cytochrome c family heme-binding site signature.
529507013307	LexA repressor; Validated; Region: PRK00215
529507013308	LexA DNA binding domain; Region: LexA_DNA_bind; pfam01726
529507013309	Peptidase S24 LexA-like proteins are involved in the SOS response leading to the repair of single-stranded DNA within the bacterial cell. This family includes: the lambda repressor CI/C2 family and related bacterial prophage repressor proteins; LexA (EC...; Region: S24_LexA-like; cd06529
529507013310	Catalytic site [active]
529507013311	HMMPfam hit to PF00717, Peptidase S24-like, score 2.7e-21
529507013312	HMMPfam hit to PF01726, LexA DNA binding domain, score 9.5e-37
529507013313	Diacylglycerol kinase [Cell envelope biogenesis, outer membrane]; Region: DgkA; COG0818
529507013314	3 probable transmembrane helices predicted for PMI2750 by TMHMM2.0 at aa 36-53, 57-79 and 100-122
529507013315	HMMPfam hit to PF01219, Prokaryotic diacylglycerol kinase, score 6.8e-54
529507013316	PS01069 Prokaryotic diacylglycerol kinase signature.
529507013317	glycerol-3-phosphate O-acyltransferase; Region: plsB; TIGR03703
529507013318	Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: GPAT-like; Region: LPLAT_DHAPAT-like; cd07993
529507013319	putative acyl-acceptor binding pocket; other site
529507013320	HMMPfam hit to PF01553, Acyltransferase, score 3e-41
529507013321	4-hydroxybenzoate octaprenyltransferase; Reviewed; Region: ubiA; PRK12848
529507013322	UbiA prenyltransferase family; Region: UbiA; pfam01040
529507013323	7 probable transmembrane helices predicted for PMI2752 by TMHMM2.0 at aa 19-36, 94-127, 134-156, 160-179, 209-228, 233-248 and 261-283
529507013324	HMMPfam hit to PF01040, UbiA prenyltransferase family, score 1.4e-81
529507013325	PS00041 Bacterial regulatory proteins, araC family signature.
529507013326	PS00943 UbiA prenyltransferase family signature.
529507013327	chorismate pyruvate lyase; Provisional; Region: ubiC; PRK11655
529507013328	HMMPfam hit to PF04345, Chorismate lyase, score 1.1e-20
529507013329	glucose-6-phosphate isomerase; Reviewed; Region: pgi; PRK00179
529507013330	Phosphoglucose isomerase (PGI) contains two SIS (Sugar ISomerase) domains. This classification is based on the alignment of the first SIS domain. PGI is a multifunctional enzyme which as an intracellular dimer catalyzes the reversible isomerization of...; Region: SIS_PGI_1; cd05015
529507013331	active site
529507013332	dimer interface [polypeptide binding]; other site
529507013333	Phosphoglucose isomerase (PGI) contains two SIS (Sugar ISomerase) domains. This classification is based on the alignment of the second SIS domain. PGI is a multifunctional enzyme which as an intracellular dimer catalyzes the reversible isomerization of...; Region: SIS_PGI_2; cd05016
529507013334	dimer interface [polypeptide binding]; other site
529507013335	active site
529507013336	HMMPfam hit to PF00342, Phosphoglucose isomerase, score 0
529507013337	PS00174 Phosphoglucose isomerase signature 2.
529507013338	PS00765 Phosphoglucose isomerase signature 1.
529507013339	aspartate kinase III; Validated; Region: PRK09084
529507013340	Amino Acid Kinases (AAK) superfamily, catalytic domain; present in such enzymes like N-acetylglutamate kinase (NAGK), carbamate kinase (CK), aspartokinase (AK), glutamate-5-kinase (G5K) and UMP kinase (UMPK). The AAK superfamily includes kinases that...; Region: AAK; cl00452
529507013341	nucleotide binding site [chemical binding]; other site
529507013342	substrate binding site [chemical binding]; other site
529507013343	ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme; Region: ACT; cl09141
529507013344	ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII; Region: ACT_AKiii-LysC-EC_2; cd04917
529507013345	dimer interface [polypeptide binding]; other site
529507013346	HMMPfam hit to PF00696, Amino acid kinase family, score 3.6e-51
529507013347	PS00324 Aspartokinase signature.
529507013348	PS00017 ATP/GTP-binding site motif A (P-loop).
529507013349	HMMPfam hit to PF01842, ACT domain, score 0.00026
529507013350	B12-dependent methionine synthase; Provisional; Region: metH; PRK09490
529507013351	Methionine synthase I (cobalamin-dependent), methyltransferase domain [Amino acid transport and metabolism]; Region: MetH; COG0646
529507013352	MeTr subgroup of pterin binding enzymes. This family includes cobalamin-dependent methyltransferases such as methyltetrahydrofolate, corrinoid iron-sulfur protein methyltransferase (MeTr) and methionine synthase (MetH).  Cobalamin-dependent...; Region: MeTr; cd00740
529507013353	substrate binding pocket [chemical binding]; other site
529507013354	B12 binding domain of methionine synthase. This domain binds methylcobalamin, which it uses as an intermediate methyl carrier from methyltetrahydrofolate (CH3H4folate) to homocysteine (Hcy); Region: methionine_synthase_B12_BD; cd02069
529507013355	B12 binding site [chemical binding]; other site
529507013356	cobalt ligand [ion binding]; other site
529507013357	Vitamin B12 dependent methionine synthase, activation domain; Region: Met_synt_B12; pfam02965
529507013358	HMMPfam hit to PF02965, Vitamin B12 dependent methionine synth, score 2.9e-163
529507013359	HMMPfam hit to PF02310, B12 binding domain, score 9.1e-26
529507013360	HMMPfam hit to PF02607, B12 binding domain, score 4e-44
529507013361	HMMPfam hit to PF00809, Pterin binding enzyme, score 2e-77
529507013362	HMMPfam hit to PF02574, Homocysteine S-methyltransferase, score 4.3e-148
529507013363	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507013364	transcriptional repressor IclR; Provisional; Region: PRK11569
529507013365	helix_turn_helix isocitrate lyase regulation; Region: HTH_ICLR; smart00346
529507013366	Bacterial transcriptional regulator; Region: IclR; pfam01614
529507013367	Predicted helix-turn-helix motif with score 999.000, SD 2.59 at aa 47-68, sequence IALTDLAFQAGLPNSTTHRLLT
529507013368	HMMPfam hit to PF01614, Bacterial transcriptional regulator, score 9.1e-69
529507013369	phosphogluconate dehydratase; Validated; Region: PRK09054
529507013370	6-phosphogluconate dehydratase; Region: edd; TIGR01196
529507013371	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507013372	HMMPfam hit to PF00920, Dehydratase family, score 1.6e-263
529507013373	PS00886 Dihydroxy-acid and 6-phosphogluconate dehydratases signature 1.
529507013374	PS00887 Dihydroxy-acid and 6-phosphogluconate dehydratases signature 2.
529507013375	keto-hydroxyglutarate-aldolase/keto-deoxy- phosphogluconate aldolase; Provisional; Region: PRK05718
529507013376	KDPG and KHG aldolase; Region: KDPG_aldolase; cd00452
529507013377	active site
529507013378	intersubunit interface [polypeptide binding]; other site
529507013379	catalytic residue [active]
529507013380	HMMPfam hit to PF01081, KDPG and KHG aldolase, score 4.2e-129
529507013381	PS00159 KDPG and KHG aldolases active site.
529507013382	PS00160 KDPG and KHG aldolases Schiff-base forming residue.
529507013383	Isocitrate dehydrogenase kinase/phosphatase [Signal transduction mechanisms]; Region: COG4579
529507013384	bifunctional isocitrate dehydrogenase kinase/phosphatase protein; Validated; Region: aceK; PRK02946
529507013385	HMMPfam hit to PF06315, Isocitrate dehydrogenase kinase/phosphatase, score 0
529507013386	PS00017 ATP/GTP-binding site motif A (P-loop).
529507013387	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
529507013388	isocitrate lyase; Provisional; Region: PRK15063
529507013389	Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage. Known members are phosphoenolpyruvate mutase (PEPM), phosphonopyruvate hydrolase (PPH), carboxyPEP mutase (CPEP mutase), oxaloacetate hydrolase (OAH), isocitrate...; Region: ICL_PEPM; cd00377
529507013390	tetramer interface [polypeptide binding]; other site
529507013391	active site
529507013392	Mg2+/Mn2+ binding site [ion binding]; other site
529507013393	HMMPfam hit to PF00463, Isocitrate lyase family, score 9.5e-267
529507013394	PS00030 Eukaryotic RNA-binding region RNP-1 signature.
529507013395	PS00161 Isocitrate lyase signature.
529507013396	Malate synthase A (MSA), present in some bacteria, plants and fungi. Prokaryotic MSAs tend to be monomeric, whereas eukaryotic enzymes are homomultimers. In general, malate synthase catalyzes the Claisen condensation of glyoxylate and acetyl-CoA to...; Region: malate_synt_A; cd00727
529507013397	malate synthase A; Region: malate_syn_A; TIGR01344
529507013398	active site
529507013399	HMMPfam hit to PF01274, Malate synthase, score 1.8e-294
529507013400	Predicted helix-turn-helix motif with score 1150.000, SD 3.10 at aa 439-460, sequence YGLMEDAATAEISRTSIWQWIR
529507013401	PS00510 Malate synthase signature.
529507013402	homoserine O-succinyltransferase; Provisional; Region: PRK05368
529507013403	Type 1 glutamine amidotransferase (GATase1)-like domain found in homoserine trans-succinylase (HTS); Region: GATase1_HTS; cd03131
529507013404	proposed active site lysine [active]
529507013405	conserved cys residue [active]
529507013406	HMMPfam hit to PF04204, Homoserine O-succinyltransferase, score 1.9e-213
529507013407	Glycerol dehydrogenase and related enzymes [Energy production and conversion]; Region: GldA; COG0371
529507013408	Glycerol dehydrogenases (GlyDH) catalyzes oxidation of glycerol to dihydroxyacetone in glycerol dissmilation; Region: GlyDH; cd08170
529507013409	dimer interface [polypeptide binding]; other site
529507013410	active site
529507013411	metal binding site [ion binding]; metal-binding site
529507013412	HMMPfam hit to PF00465, Iron-containing alcohol dehydrogenase, score 9.7e-49
529507013413	PS00435 Peroxidases proximal heme-ligand signature.
529507013414	PS00687 Aldehyde dehydrogenases glutamic acid active site.
529507013415	Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway. Isoprenoids comprise a large family of natural products including sterols, carotenoids, dolichols and prenylated...; Region: IPP_Isomerase; cd02885
529507013416	isopentenyl-diphosphate delta-isomerase, type 1; Region: IPP_isom_1; TIGR02150
529507013417	active site
529507013418	metal binding site [ion binding]; metal-binding site
529507013419	nudix motif; other site
529507013420	HMMPfam hit to PF00293, NUDIX domain, score 8.8e-16
529507013421	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase; Provisional; Region: purH; PRK00881
529507013422	Inosine monophosphate cyclohydrolase domain. This is the N-terminal domain in the purine biosynthesis pathway protein ATIC (purH). The bifunctional ATIC protein contains a C-terminal  ATIC formylase domain that formylates...; Region: IMPCH; cd01421
529507013423	purine monophosphate binding site [chemical binding]; other site
529507013424	dimer interface [polypeptide binding]; other site
529507013425	putative catalytic residues [active]
529507013426	AICARFT/IMPCHase bienzyme; Region: AICARFT_IMPCHas; smart00798
529507013427	AICARFT/IMPCHase bienzyme; Region: AICARFT_IMPCHas; cl03362
529507013428	HMMPfam hit to PF02142, MGS-like domain, score 4e-62
529507013429	HMMPfam hit to PF01808, AICARFT/IMPCHase bienzyme, score 1.8e-199
529507013430	phosphoribosylamine--glycine ligase; Provisional; Region: PRK00885
529507013431	Phosphoribosylglycinamide synthetase, N domain; Region: GARS_N; pfam02844
529507013432	Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain; Region: GARS_A; pfam01071
529507013433	Phosphoribosylglycinamide synthetase, C domain; Region: GARS_C; pfam02843
529507013434	HMMPfam hit to PF02844, Phosphoribosylglycinamide synthetase, N doma, score 1.5e-64
529507013435	HMMPfam hit to PF02842, Phosphoribosylglycinamide synthetase, B doma, score 8.2e-48
529507013436	HMMPfam hit to PF01071, Phosphoribosylglycinamide synthetase, ATP-gr, score 1.3e-91
529507013437	PS00184 Phosphoribosylglycinamide synthetase signature.
529507013438	HMMPfam hit to PF02843, Phosphoribosylglycinamide synthetase, C doma, score 9e-45
529507013439	Protein of unknown function (DUF1481); Region: DUF1481; pfam07356
529507013440	HMMPfam hit to PF07356, Protein of unknown function (DUF1481), score 1.7e-73
529507013441	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507013442	Integration host factor (IHF) and HU are small heterodimeric members of the DNABII protein family that bind and bend DNA, functioning as architectural factors in many cellular processes including transcription, site-specific recombination, and...; Region: HU_IHF; cd00591
529507013443	IHF dimer interface [polypeptide binding]; other site
529507013444	IHF - DNA interface [nucleotide binding]; other site
529507013445	HMMPfam hit to PF00216, Bacterial DNA-binding protein, score 6.5e-52
529507013446	PS00045 Bacterial histone-like DNA-binding proteins signature.
529507013447	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG3068
529507013448	HMMPfam hit to PF04222, Protein of unknown function, DUF, score 3.4e-144
529507013449	Endonuclease_V, a DNA repair enzyme that initiates repair of nitrosative deaminated purine bases; Region: Endonuclease_V; cd06559
529507013450	Active_site [active]
529507013451	HMMPfam hit to PF04493, Endonuclease V, score 2.9e-88
529507013452	Uroporphyrinogen decarboxylase (URO-D) is a dimeric cytosolic enzyme that decarboxylates the four acetate side chains of uroporphyrinogen III (uro-III) to create coproporphyrinogen III, without requiring any prosthetic groups or cofactors. This reaction...; Region: URO-D; cd00717
529507013453	substrate binding site [chemical binding]; other site
529507013454	active site
529507013455	HMMPfam hit to PF01208, Uroporphyrinogen decarboxylase (URO-D), score 3.8e-203
529507013456	PS00907 Uroporphyrinogen decarboxylase signature 2.
529507013457	PS00906 Uroporphyrinogen decarboxylase signature 1.
529507013458	NADH pyrophosphatase; Reviewed; Region: nudC; PRK00241
529507013459	NADH pyrophosphatase-like rudimentary NUDIX domain; Region: NUDIX-like; pfam09296
529507013460	NADH pyrophosphatase zinc ribbon domain; Region: zf-NADH-PPase; pfam09297
529507013461	NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP. Like other members of the Nudix family, it requires a divalent cation, such as Mg2+ or Mn2+, for...; Region: NADH_pyrophosphatase; cd03429
529507013462	putative NADH binding site [chemical binding]; other site
529507013463	putative active site [active]
529507013464	nudix motif; other site
529507013465	putative metal binding site [ion binding]; other site
529507013466	HMMPfam hit to PF00293, NUDIX domain, score 1.9e-21
529507013467	PS00893 mutT domain signature.
529507013468	PS00190 Cytochrome c family heme-binding site signature.
529507013469	Phosphoserine phosphatase [Amino acid transport and metabolism]; Region: SerB; COG0560
529507013470	haloacid dehalogenase-like hydrolase; Region: HAD; cl17202
529507013471	thiamine biosynthesis protein ThiC; Provisional; Region: PRK09284
529507013472	ThiC-associated domain; Region: ThiC-associated; pfam13667
529507013473	Thiamine biosynthesis protein ThiC [Coenzyme metabolism]; Region: ThiC; COG0422
529507013474	HMMPfam hit to PF01964, ThiC family, score 0
529507013475	Thiamine monophosphate synthase (TMP synthase)/TenI. TMP synthase catalyzes an important step in the thiamine biosynthesis pathway, the substitution of the pyrophosphate of 2-methyl-4-amino-5- hydroxymethylpyrimidine pyrophosphate by 4-methyl-5-; Region: TMP_TenI; cd00564
529507013476	thiamine phosphate binding site [chemical binding]; other site
529507013477	active site
529507013478	pyrophosphate binding site [ion binding]; other site
529507013479	HMMPfam hit to PF02581, Thiamine monophosphate synthase/TENI, score 9e-75
529507013480	molybdopterin biosynthesis protein MoeB; Provisional; Region: PRK05690
529507013481	ThiF_MoeB_HesA. Family of E1-like enzymes involved in molybdopterin and thiamine biosynthesis family. The common reaction mechanism catalyzed by MoeB and ThiF, like other E1 enzymes, begins with a nucleophilic attack of the C-terminal carboxylate of MoaD...; Region: ThiF_MoeB_HesA_family; cd00757
529507013482	ATP binding site [chemical binding]; other site
529507013483	substrate interface [chemical binding]; other site
529507013484	HMMPfam hit to PF00899, ThiF family, score 3.6e-53
529507013485	1 probable transmembrane helix predicted for PMI2779 by TMHMM2.0 at aa 32-54
529507013486	HMMPfam hit to PF05237, MoeZ/MoeB domain, score 2.4e-31
529507013487	ThiaminS ubiquitin-like sulfur carrier protein; Region: ThiS; cd00565
529507013488	thiS-thiF/thiG interaction site; other site
529507013489	HMMPfam hit to PF02597, ThiS family, score 6.9e-14
529507013490	Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism. ThiG catalyzes...; Region: ThiG; cd04728
529507013491	ThiS interaction site; other site
529507013492	putative active site [active]
529507013493	tetramer interface [polypeptide binding]; other site
529507013494	HMMPfam hit to PF05690, Thiazole biosynthesis protein ThiG, score 7.9e-161
529507013495	thiamine biosynthesis protein ThiH; Reviewed; Region: thiH; PRK09240
529507013496	Radical SAM superfamily. Enzymes of this family generate radicals by combining a 4Fe-4S cluster and S-adenosylmethionine (SAM) in close proximity. They are characterized by a conserved CxxxCxxC motif, which coordinates the conserved iron-sulfur cluster; Region: Radical_SAM; cd01335
529507013497	FeS/SAM binding site; other site
529507013498	Biotin and Thiamin Synthesis associated domain; Region: BATS; smart00876
529507013499	HMMPfam hit to PF04055, Radical SAM superfamily, score 3.3e-05
529507013500	HMMPfam hit to PF06968, Biotin and Thiamin Synthesis associated d, score 8.9e-40
529507013501	putative transposase; Provisional; Region: PRK09857
529507013502	Putative transposase, YhgA-like; Region: Transposase_31; pfam04754
529507013503	HMMPfam hit to PF04754, transposase, YhgA-like, score 4.8e-88
529507013504	RNA polymerase Rpb1, domain 1; Region: RNA_pol_Rpb1_1; pfam04997
529507013505	DNA-directed RNA polymerase, beta' subunit/160 kD subunit [Transcription]; Region: RpoC; COG0086
529507013506	RNA polymerase I subunit A N-terminus; Region: RPOLA_N; smart00663
529507013507	RNA polymerase Rpb1, domain 3; Region: RNA_pol_Rpb1_3; pfam04983
529507013508	RNA polymerase Rpb1, domain 4; Region: RNA_pol_Rpb1_4; pfam05000
529507013509	RNA polymerase Rpb1, domain 5; Region: RNA_pol_Rpb1_5; pfam04998
529507013510	Largest subunit of RNA polymerase (RNAP), C-terminal domain; Region: RNAP_largest_subunit_C; cl11429
529507013511	Rpb1 - Rpb6 interaction site [polypeptide binding]; other site
529507013512	Largest subunit of RNA polymerase (RNAP), C-terminal domain; Region: RNAP_largest_subunit_C; cl11429
529507013513	Largest subunit (beta') of Bacterial DNA-dependent RNA polymerase (RNAP), C-terminal domain; Region: RNAP_beta'_C; cd02655
529507013514	DNA binding site [nucleotide binding]
529507013515	Rpb1 (beta') - Rpb2 (beta) interaction site [polypeptide binding]; other site
529507013516	HMMPfam hit to PF04998, RNA polymerase Rpb1, domain, score 7.1e-77
529507013517	HMMPfam hit to PF05000, RNA polymerase Rpb1, domain, score 2.3e-31
529507013518	HMMPfam hit to PF04983, RNA polymerase Rpb1, domain, score 7.3e-47
529507013519	HMMPfam hit to PF00623, RNA polymerase Rpb1, domain, score 6.1e-82
529507013520	HMMPfam hit to PF04997, RNA polymerase Rpb1, domain, score 4.9e-159
529507013521	DNA-directed RNA polymerase subunit beta; Reviewed; Region: rpoB; PRK00405
529507013522	RNA polymerase beta subunit. RNA polymerases catalyse the DNA dependent polymerization of RNA. Prokaryotes contain a single RNA polymerase compared to three in eukaryotes (not including mitochondrial. and chloroplast polymerases). Each RNA polymerase...; Region: RNA_pol_B_RPB2; cl17585
529507013523	RNA polymerase Rpb2, domain 2; Region: RNA_pol_Rpb2_2; pfam04561
529507013524	RNA polymerase beta subunit. RNA polymerases catalyse the DNA dependent polymerization of RNA. Prokaryotes contain a single RNA polymerase compared to three in eukaryotes (not including mitochondrial. and chloroplast polymerases). Each RNA polymerase...; Region: RNA_pol_B_RPB2; cd00653
529507013525	RNA polymerase Rpb2, domain 6; Region: RNA_pol_Rpb2_6; pfam00562
529507013526	RNA polymerase beta subunit. RNA polymerases catalyse the DNA dependent polymerization of RNA. Prokaryotes contain a single RNA polymerase compared to three in eukaryotes (not including mitochondrial. and chloroplast polymerases). Each RNA polymerase...; Region: RNA_pol_B_RPB2; cd00653
529507013527	RPB3 interaction site [polypeptide binding]; other site
529507013528	RPB1 interaction site [polypeptide binding]; other site
529507013529	RPB11 interaction site [polypeptide binding]; other site
529507013530	RPB10 interaction site [polypeptide binding]; other site
529507013531	HMMPfam hit to PF04560, RNA polymerase Rpb2, domain, score 5.7e-52
529507013532	HMMPfam hit to PF00562, RNA polymerase Rpb2, domain, score 4.5e-183
529507013533	PS01166 RNA polymerases beta chain signature.
529507013534	PS00223 Annexins repeated domain signature.
529507013535	HMMPfam hit to PF04565, RNA polymerase Rpb2, domain, score 9.4e-45
529507013536	HMMPfam hit to PF04563, RNA polymerase beta subunit, score 1.3e-07
529507013537	HMMPfam hit to PF04561, RNA polymerase Rpb2, domain, score 4.1e-09
529507013538	Ribosomal protein L7/L12. Ribosomal protein L7/L12 refers to the large ribosomal subunit proteins L7 and L12, which are identical except that L7 is acetylated at the N terminus. It is a component of the L7/L12 stalk, which is located at the surface of...; Region: Ribosomal_L7_L12; cd00387
529507013539	core dimer interface [polypeptide binding]; other site
529507013540	peripheral dimer interface [polypeptide binding]; other site
529507013541	L10 interface [polypeptide binding]; other site
529507013542	L11 interface [polypeptide binding]; other site
529507013543	putative EF-Tu interaction site [polypeptide binding]; other site
529507013544	putative EF-G interaction site [polypeptide binding]; other site
529507013545	HMMPfam hit to PF00542, Ribosomal protein L7/L12 C-terminal dom, score 2.2e-36
529507013546	Ribosomal protein L10 family, L10 subfamily; composed of bacterial 50S ribosomal protein and eukaryotic mitochondrial 39S ribosomal protein, L10. L10 occupies the L7/L12 stalk of the ribosome. The N-terminal domain (NTD) of L10 interacts with L11 protein...; Region: Ribosomal_L10; cd05797
529507013547	23S rRNA interface [nucleotide binding]; other site
529507013548	Interface with L7/L12 ribosomal proteins [polypeptide binding]; other site
529507013549	HMMPfam hit to PF00466, Ribosomal protein L10, score 4.3e-39
529507013550	PS01109 Ribosomal protein L10 signature.
529507013551	Ribosomal protein L1.  The L1 protein, located near the E-site of the ribosome, forms part of the L1 stalk along with 23S rRNA.  In bacteria and archaea, L1 functions both as a ribosomal protein that binds rRNA, and as a translation repressor that binds...; Region: Ribosomal_L1; cd00403
529507013552	mRNA/rRNA interface [nucleotide binding]; other site
529507013553	HMMPfam hit to PF00687, Ribosomal protein L1p/L10e family, score 2.7e-124
529507013554	PS01199 Ribosomal protein L1 signature.
529507013555	50S ribosomal protein L11; Validated; Region: rplK; PRK00140
529507013556	Ribosomal protein L11. Ribosomal protein L11, together with proteins L10 and L7/L12, and 23S rRNA, form the L7/L12 stalk on the surface of the large subunit of the ribosome. The homologous eukaryotic cytoplasmic protein is also called 60S ribosomal...; Region: Ribosomal_L11; cd00349
529507013557	23S rRNA interface [nucleotide binding]; other site
529507013558	L7/L12 interface [polypeptide binding]; other site
529507013559	putative thiostrepton binding site; other site
529507013560	L25 interface [polypeptide binding]; other site
529507013561	This hit extended beyond the end of the feature by 1 aa and was clipped.; PS00359 Ribosomal protein L11 signature.
529507013562	HMMPfam hit to PF00298, Ribosomal protein L11, RNA binding do, score 3e-38
529507013563	HMMPfam hit to PF03946, Ribosomal protein L11, N-terminal dom, score 1.7e-38
529507013564	transcription antitermination protein NusG; Validated; Region: nusG; PRK05609
529507013565	Bacterial N-Utilization Substance G (NusG) N-terminal (NGN) domain, subgroup 1; Region: NGN_Bact_1; cd09891
529507013566	putative homodimer interface [polypeptide binding]; other site
529507013567	NusG contains an NGN domain at its N-terminus and KOW motif at its C-terminus; Region: KOW_NusG; cd06091
529507013568	heterodimer interface [polypeptide binding]; other site
529507013569	homodimer interface [polypeptide binding]; other site
529507013570	PS01014 Transcription termination factor nusG signature.
529507013571	HMMPfam hit to PF00467, KOW motif, score 1.9e-11
529507013572	HMMPfam hit to PF02357, Transcription termination factor nusG, score 5.3e-21
529507013573	preprotein translocase subunit SecE; Reviewed; Region: secE; PRK05740
529507013574	HMMPfam hit to PF00584, SecE/Sec61-gamma subunits of protein translo, score 1.4e-23
529507013575	3 probable transmembrane helices predicted for PMI2791 by TMHMM2.0 at aa 15-34, 41-63 and 94-116
529507013576	PS01067 Protein secE/sec61-gamma signature.
529507013577	elongation factor Tu; Reviewed; Region: PRK00049
529507013578	Elongation Factor Tu (EF-Tu) GTP-binding proteins; Region: EF_Tu; cd01884
529507013579	G1 box; other site
529507013580	GEF interaction site [polypeptide binding]; other site
529507013581	GTP/Mg2+ binding site [chemical binding]; other site
529507013582	Switch I region; other site
529507013583	G2 box; other site
529507013584	G3 box; other site
529507013585	Switch II region; other site
529507013586	G4 box; other site
529507013587	G5 box; other site
529507013588	EFTU_II: Elongation factor Tu domain II. Elongation factors Tu (EF-Tu) are three-domain GTPases with an essential function in the elongation phase of mRNA translation. The GTPase center of EF-Tu is in the N-terminal domain (domain I), also known as the...; Region: EFTU_II; cd03697
529507013589	Domain III of elongation factor (EF) Tu. Ef-Tu consists of three structural domains, designated I, II and III. Domain III adopts a beta barrel structure. Domain III is involved in binding to both charged tRNA and binding to elongation factor Ts (EF-Ts); Region: EFTU_III; cd03707
529507013590	Antibiotic Binding Site [chemical binding]; other site
529507013591	HMMPfam hit to PF03143, Elongation factor Tu C-terminal domain, score 9.6e-62
529507013592	HMMPfam hit to PF03144, Elongation factor Tu domain, score 9.4e-26
529507013593	HMMPfam hit to PF00009, Elongation factor Tu GTP binding domain, score 5.4e-98
529507013594	PS00301 GTP-binding elongation factors signature.
529507013595	PS00017 ATP/GTP-binding site motif A (P-loop).
529507013596	elongation factor G; Reviewed; Region: PRK00007
529507013597	Elongation factor G (EF-G) family involved in both the elongation and ribosome recycling phases of protein synthesis; Region: EF-G; cd01886
529507013598	G1 box; other site
529507013599	putative GEF interaction site [polypeptide binding]; other site
529507013600	GTP/Mg2+ binding site [chemical binding]; other site
529507013601	Switch I region; other site
529507013602	G2 box; other site
529507013603	G3 box; other site
529507013604	Switch II region; other site
529507013605	G4 box; other site
529507013606	G5 box; other site
529507013607	EFG_mtEFG_II: this subfamily represents the domain II of elongation factor G (EF-G) in bacteria and, the C-terminus of mitochondrial Elongation factor G1 (mtEFG1) and G2 (mtEFG2)_like proteins found in eukaryotes. During the process of peptide synthesis...; Region: EFG_mtEFG_II; cd04088
529507013608	EFG_mtEFG1_IV: domains similar to domain IV of the bacterial translational elongation factor (EF) EF-G. Included in this group is a domain of mitochondrial Elongation factor G1 (mtEFG1) proteins homologous to domain IV of EF-G. Eukaryotic cells harbor 2...; Region: EFG_mtEFG1_IV; cd01434
529507013609	EFG_mtEFG_C: domains similar to the C-terminal domain of the bacterial translational elongation factor (EF) EF-G.  Included in this group is the C-terminus of mitochondrial Elongation factor G1 (mtEFG1) and G2 (mtEFG2) proteins. Eukaryotic cells harbor 2...; Region: EFG_mtEFG_C; cd03713
529507013610	HMMPfam hit to PF00679, Elongation factor G C-terminus, score 1.2e-49
529507013611	HMMPfam hit to PF03764, Elongation factor G, domain IV, score 5.3e-72
529507013612	HMMPfam hit to PF03144, Elongation factor Tu domain, score 1e-21
529507013613	HMMPfam hit to PF00009, Elongation factor Tu GTP binding domain, score 3.8e-109
529507013614	PS00301 GTP-binding elongation factors signature.
529507013615	PS00017 ATP/GTP-binding site motif A (P-loop).
529507013616	30S ribosomal protein S7; Validated; Region: PRK05302
529507013617	HMMPfam hit to PF00177, Ribosomal protein S7p/S5e, score 1.4e-86
529507013618	PS00052 Ribosomal protein S7 signature.
529507013619	S12-like family, 30S ribosomal protein S12 subfamily; S12 is located at the interface of the large and small ribosomal subunits of prokaryotes, chloroplasts and mitochondria, where it plays an important role in both tRNA and ribosomal subunit...; Region: Ribosomal_S12; cd03368
529507013620	S17 interaction site [polypeptide binding]; other site
529507013621	S8 interaction site; other site
529507013622	16S rRNA interaction site [nucleotide binding]; other site
529507013623	streptomycin interaction site [chemical binding]; other site
529507013624	23S rRNA interaction site [nucleotide binding]; other site
529507013625	aminoacyl-tRNA interaction site (A-site) [nucleotide binding]; other site
529507013626	HMMPfam hit to PF00164, Ribosomal protein S12, score 3e-75
529507013627	PS00055 Ribosomal protein S12 signature.
529507013628	DsrH like protein; Region: DsrH; cl17347
529507013629	HMMPfam hit to PF04077, DsrH like protein, score 3.4e-23
529507013630	sulfur relay protein TusC; Validated; Region: PRK00211
529507013631	HMMPfam hit to PF02635, DsrE/DsrF-like family, score 1.4e-34
529507013632	sulfur transfer complex subunit TusD; Validated; Region: PRK00207
529507013633	HMMPfam hit to PF02635, DsrE/DsrF-like family, score 1.9e-46
529507013634	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG2964
529507013635	YheO-like PAS domain; Region: PAS_6; pfam08348
529507013636	HTH domain; Region: HTH_22; pfam13309
529507013637	Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only]; Region: RhaT; COG0697
529507013638	10 probable transmembrane helices predicted for PMI2800 by TMHMM2.0 at aa 7-29, 39-56, 69-91, 95-114, 123-142, 147-166, 173-195, 205-227, 234-256 and 261-280
529507013639	HMMPfam hit to PF00892, Integral membrane protein DUF6, score 1e-09
529507013640	HMMPfam hit to PF00892, Integral membrane protein DUF6, score 1.7e-15
529507013641	Domain amino terminal to FKBP-type peptidyl-prolyl isomerase; Region: FKBP_N; pfam01346
529507013642	FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones]; Region: FkpA; COG0545
529507013643	FKBP-type peptidyl-prolyl cis-trans isomerase; Region: FKBP_C; pfam00254
529507013644	HMMPfam hit to PF00254, FKBP-type peptidyl-prolyl cis-trans isomeras, score 1.9e-43
529507013645	PS00454 FKBP-type peptidyl-prolyl cis-trans isomerase signature 2.
529507013646	PS00453 FKBP-type peptidyl-prolyl cis-trans isomerase signature 1.
529507013647	HMMPfam hit to PF01346, Domain amino terminal to FKBP-type peptidyl-, score 2.6e-39
529507013648	Signal peptide predicted for PMI2801 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.998 between residues 25 and 26
529507013649	SlyX; Region: SlyX; pfam04102
529507013650	HMMPfam hit to PF04102, SlyX, score 2.4e-24
529507013651	FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional; Region: PRK15095
529507013652	FKBP-type peptidyl-prolyl cis-trans isomerase; Region: FKBP_C; pfam00254
529507013653	HMMPfam hit to PF00254, FKBP-type peptidyl-prolyl cis-trans isomeras, score 0.00064
529507013654	PS00453 FKBP-type peptidyl-prolyl cis-trans isomerase signature 1.
529507013655	Predicted nucleic-acid-binding protein containing a Zn-ribbon domain [General function prediction only]; Region: COG3529
529507013656	Signal peptide predicted for PMI2804 by SignalP 2.0 HMM (Signal peptide probability 0.953) with cleavage site probability 0.952 between residues 19 and 20
529507013657	glutathione-regulated potassium-efflux system protein KefB; Provisional; Region: PRK03659
529507013658	transporter, monovalent cation:proton antiporter-2 (CPA2) family; Region: 2a37; TIGR00932
529507013659	TrkA-N domain; Region: TrkA_N; pfam02254
529507013660	HMMPfam hit to PF02254, TrkA-N domain, score 2e-18
529507013661	12 probable transmembrane helices predicted for PMI2805 by TMHMM2.0 at aa 5-24, 31-50, 55-74, 87-109, 114-136, 149-171, 181-201, 222-244, 269-291, 296-318, 328-350 and 357-379
529507013662	glutathione-regulated potassium-efflux system ancillary protein KefG; Provisional; Region: PRK04930
529507013663	HMMPfam hit to PF02525, Flavodoxin-like fold, score 7.7e-51
529507013664	putative ABC transporter ATP-binding protein; Provisional; Region: PRK10636
529507013665	ATP-binding cassette domain of elongation factor 3, subfamily F; Region: ABCF_EF-3; cd03221
529507013666	ATP-binding cassette domain of elongation factor 3, subfamily F; Region: ABCF_EF-3; cd03221
529507013667	ABC transporter; Region: ABC_tran_2; pfam12848
529507013668	ATP-binding cassette domain of elongation factor 3, subfamily F; Region: ABCF_EF-3; cd03221
529507013669	HMMPfam hit to PF00005, ABC transporter, score 1.3e-41
529507013670	PS00017 ATP/GTP-binding site motif A (P-loop).
529507013671	PS00211 ABC transporters family signature.
529507013672	HMMPfam hit to PF00005, ABC transporter, score 1.2e-38
529507013673	PS00017 ATP/GTP-binding site motif A (P-loop).
529507013674	PS00211 ABC transporters family signature.
529507013675	methyl-accepting chemotaxis protein I; Provisional; Region: PRK15041
529507013676	Histidine kinase, Adenylyl cyclase, Methyl-accepting protein, and Phosphatase (HAMP) domain. HAMP is a signaling domain which occurs in a wide variety of signaling proteins, many of which are bacterial. The HAMP domain consists of two alpha helices...; Region: HAMP; cd06225
529507013677	dimerization interface [polypeptide binding]; other site
529507013678	Methyl-accepting chemotaxis protein (MCP), signaling domain; Region: MCP_signal; cd11386
529507013679	dimer interface [polypeptide binding]; other site
529507013680	putative CheW interface [polypeptide binding]; other site
529507013681	Signal peptide predicted for PMI2808 by SignalP 2.0 HMM (Signal peptide probability 0.933) with cleavage site probability 0.604 between residues 25 and 26
529507013682	2 probable transmembrane helices predicted for PMI2808 by TMHMM2.0 at aa 7-29 and 191-213
529507013683	HMMPfam hit to PF00672, HAMP domain, score 3.7e-09
529507013684	HMMPfam hit to PF00015, Methyl-accepting chemotaxis protein (MCP) s, score 1.8e-91
529507013685	methyl-accepting chemotaxis protein I; Provisional; Region: PRK15041
529507013686	HAMP domain; Region: HAMP; pfam00672
529507013687	Methyl-accepting chemotaxis protein (MCP), signaling domain; Region: MCP_signal; cd11386
529507013688	dimer interface [polypeptide binding]; other site
529507013689	putative CheW interface [polypeptide binding]; other site
529507013690	Signal peptide predicted for PMI2809 by SignalP 2.0 HMM (Signal peptide probability 0.734) with cleavage site probability 0.368 between residues 25 and 26
529507013691	2 probable transmembrane helices predicted for PMI2809 by TMHMM2.0 at aa 27-49 and 210-232
529507013692	HMMPfam hit to PF00672, HAMP domain, score 5.6e-09
529507013693	HMMPfam hit to PF00015, Methyl-accepting chemotaxis protein (MCP) s, score 1.1e-82
529507013694	type VI secretion system effector, Hcp1 family; Region: VI_effect_Hcp1; TIGR03344
529507013695	HMMPfam hit to PF05638, Protein of unknown function (DUF796), score 1.3e-60
529507013696	PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in...; Region: PAS; cd00130
529507013697	PAS domain; Region: PAS_9; pfam13426
529507013698	putative active site [active]
529507013699	heme pocket [chemical binding]; other site
529507013700	HAMP domain; Region: HAMP; pfam00672
529507013701	Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Region: MA; smart00283
529507013702	Methyl-accepting chemotaxis protein (MCP), signaling domain; Region: MCP_signal; cd11386
529507013703	dimer interface [polypeptide binding]; other site
529507013704	putative CheW interface [polypeptide binding]; other site
529507013705	HMMPfam hit to PF00015, Methyl-accepting chemotaxis protein (MCP) s, score 9e-73
529507013706	HMMPfam hit to PF00672, HAMP domain, score 0.00092
529507013707	1 probable transmembrane helix predicted for PMI2813 by TMHMM2.0 at aa 171-193
529507013708	HMMPfam hit to PF00785, PAC motif, score 0.00092
529507013709	Helix-turn-helix domain, rpiR family; Region: HTH_6; pfam01418
529507013710	putative DNA-binding transcriptional regulator; Provisional; Region: PRK11557
529507013711	RpiR-like protein. RpiR contains a SIS (Sugar ISomerase) domain, which is found in many phosphosugar isomerases and phosphosugar binding proteins. In E. coli, rpiR negatively regulates the expression of rpiB gene. Both rpiB and rpiA are ribose phosphate...; Region: SIS_RpiR; cd05013
529507013712	putative active site [active]
529507013713	HMMPfam hit to PF01380, SIS domain, score 2e-25
529507013714	HMMPfam hit to PF01418, Helix-turn-helix domain, rpiR family, score 2.2e-31
529507013715	PS00430 TonB-dependent receptor proteins signature 1.
529507013716	Putative threonine efflux protein [Amino acid transport and metabolism]; Region: RhtB; COG1280
529507013717	HMMPfam hit to PF01810, LysE type translocator, score 6.4e-06
529507013718	6 probable transmembrane helices predicted for PMI2815 by TMHMM2.0 at aa 5-27, 40-62, 66-88, 108-130, 145-167 and 180-200
529507013719	Signal peptide predicted for PMI2815 by SignalP 2.0 HMM (Signal peptide probability 0.856) with cleavage site probability 0.341 between residues 16 and 17
529507013720	putative hydrolase; Provisional; Region: PRK10985
529507013721	HMMPfam hit to PF00561, alpha/beta hydrolase fold, score 1.9e-17
529507013722	hypothetical protein; Provisional; Region: PRK04966
529507013723	HMMPfam hit to PF06794, Uncharacterised protein family (UPF0270), score 8.1e-44
529507013724	phosphoribulokinase; Provisional; Region: PRK15453
529507013725	active site
529507013726	Signal peptide predicted for PMI2818 by SignalP 2.0 HMM (Signal peptide probability 0.930) with cleavage site probability 0.340 between residues 36 and 37
529507013727	HMMPfam hit to PF00485, Phosphoribulokinase / Uridine kinase family, score 1.2e-111
529507013728	PS00567 Phosphoribulokinase signature.
529507013729	hypothetical protein; Provisional; Region: PRK10738
529507013730	HMMPfam hit to PF02566, OsmC-like protein, score 3.1e-46
529507013731	DNA-binding transcriptional dual regulator Crp; Provisional; Region: PRK11753
529507013732	effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO...; Region: CAP_ED; cd00038
529507013733	ligand binding site [chemical binding]; other site
529507013734	flexible hinge region; other site
529507013735	helix_turn_helix, cAMP Regulatory protein C-terminus; DNA binding domain of prokaryotic regulatory proteins belonging to the catabolite activator protein family; Region: HTH_CRP; cd00092
529507013736	putative switch regulator; other site
529507013737	non-specific DNA interactions [nucleotide binding]; other site
529507013738	DNA binding site [nucleotide binding]
529507013739	sequence specific DNA binding site [nucleotide binding]; other site
529507013740	putative cAMP binding site [chemical binding]; other site
529507013741	HMMPfam hit to PF00027, Cyclic nucleotide-binding domain, score 7.6e-32
529507013742	PS00888 Cyclic nucleotide-binding domain signature 1.
529507013743	PS00889 Cyclic nucleotide-binding domain signature 2.
529507013744	HMMPfam hit to PF00325, Bacterial regulatory proteins, crp famil, score 1.3e-15
529507013745	PS00042 Bacterial regulatory proteins, crp family signature.
529507013746	bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed; Region: argD; PRK05093
529507013747	Acetyl ornithine aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD correspond to ornithine aminotransferase, acetylornithine aminotransferase; Region: OAT_like; cd00610
529507013748	inhibitor-cofactor binding pocket; inhibition site
529507013749	pyridoxal 5'-phosphate binding site [chemical binding]; other site
529507013750	catalytic residue [active]
529507013751	HMMPfam hit to PF00202, Aminotransferase class-III, score 1.9e-178
529507013752	PS00600 Aminotransferases class-III pyridoxal-phosphate attachment site.
529507013753	para-aminobenzoate synthase component II; Provisional; Region: PRK08857
529507013754	Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase; Region: GATase1_Anthranilate_Synthase; cd01743
529507013755	glutamine binding [chemical binding]; other site
529507013756	catalytic triad [active]
529507013757	HMMPfam hit to PF00117, Glutamine amidotransferase class-I, score 9.3e-86
529507013758	PS00442 Glutamine amidotransferases class-I active site.
529507013759	peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional; Region: PRK10903
529507013760	cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases. This family contains eukaryotic, bacterial and archeal proteins which exhibit a peptidylprolyl cis- trans isomerases activity (PPIase, Rotamase) and in addition bind the...; Region: cyclophilin; cl00197
529507013761	active site
529507013762	HMMPfam hit to PF00160, Cyclophilin type peptidyl-prolyl cis-tr, score 1.3e-61
529507013763	PS00170 Cyclophilin-type peptidyl-prolyl cis-trans isomerase signature.
529507013764	Signal peptide predicted for PMI2823 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.970 between residues 23 and 24
529507013765	YihA (EngB) GTPase family; Region: YihA_EngB; cd01876
529507013766	G1 box; other site
529507013767	GTP/Mg2+ binding site [chemical binding]; other site
529507013768	Switch I region; other site
529507013769	G2 box; other site
529507013770	G3 box; other site
529507013771	Switch II region; other site
529507013772	G4 box; other site
529507013773	G5 box; other site
529507013774	HMMPfam hit to PF01926, GTPase of unknown function, score 2.2e-28
529507013775	PS00017 ATP/GTP-binding site motif A (P-loop).
529507013776	Polypeptide or peptide deformylase; a family of metalloenzymes that catalyzes the removal of the N-terminal formyl group in a growing polypeptide chain following translation initiation during protein synthesis in prokaryotes. These enzymes utilize Fe(II)...; Region: Pep_deformylase; cd00487
529507013777	active site
529507013778	catalytic residues [active]
529507013779	metal binding site [ion binding]; metal-binding site
529507013780	HMMPfam hit to PF01327, Polypeptide deformylase, score 6.4e-75
529507013781	DNA polymerase I; Provisional; Region: PRK05755
529507013782	PIN domain of the 5'-3' exonuclease of Taq DNA polymerase I and homologs; Region: PIN_53EXO; cd09859
529507013783	active site
529507013784	metal binding site 1 [ion binding]; metal-binding site
529507013785	putative 5' ssDNA interaction site; other site
529507013786	metal binding site 3; metal-binding site
529507013787	metal binding site 2 [ion binding]; metal-binding site
529507013788	H3TH domain of the 5'-3' exonuclease of Taq DNA polymerase I and homologs; Region: H3TH_53EXO; cd09898
529507013789	putative DNA binding site [nucleotide binding]; other site
529507013790	putative metal binding site [ion binding]; other site
529507013791	DEDDy 3'-5' exonuclease domain of Escherichia coli DNA polymerase I and similar bacterial family-A DNA polymerases; Region: DNA_polA_I_Ecoli_like_exo; cd06139
529507013792	active site
529507013793	catalytic site [active]
529507013794	substrate binding site [chemical binding]; other site
529507013795	Polymerase I functions primarily to fill DNA gaps that arise during DNA repair, recombination and replication; Region: DNA_pol_A_pol_I_C; cd08637
529507013796	active site
529507013797	DNA binding site [nucleotide binding]
529507013798	catalytic site [active]
529507013799	HMMPfam hit to PF00476, DNA polymerase family A, score 8.7e-206
529507013800	PS00447 DNA polymerase family A signature.
529507013801	HMMPfam hit to PF01612, 3'-5' exonuclease, score 9.8e-58
529507013802	HMMPfam hit to PF01367, 5'-3' exonuclease, C-terminal SAM fold, score 8.3e-51
529507013803	HMMPfam hit to PF02739, 5'-3' exonuclease, N-terminal resolvase-, score 1.2e-94
529507013804	Sugar efflux transporter for intercellular exchange; Region: MtN3_slv; pfam03083
529507013805	3 probable transmembrane helices predicted for PMI2827 by TMHMM2.0 at aa 51-73, 88-105 and 112-131
529507013806	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507013807	DsbA family, DsbA subfamily; DsbA is a monomeric thiol disulfide oxidoreductase protein containing a redox active CXXC motif imbedded in a TRX fold. It is involved in the oxidative protein folding pathway in prokaryotes, and is the strongest thiol...; Region: DsbA_DsbA; cd03019
529507013808	DSBA-like thioredoxin domain; Region: DSBA; pfam01323
529507013809	catalytic residues [active]
529507013810	hinge region; other site
529507013811	alpha helical domain; other site
529507013812	HMMPfam hit to PF01323, DSBA-like thioredoxin domain, score 9.7e-40
529507013813	PS00194 Thioredoxin family active site.
529507013814	Signal peptide predicted for PMI2828 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.949 between residues 19 and 20
529507013815	serine/threonine protein kinase; Provisional; Region: PRK11768
529507013816	Putative homoserine kinase type II (protein kinase fold) [General function prediction only]; Region: COG2334
529507013817	HMMPfam hit to PF01636, Phosphotransferase enzyme family, score 3e-34
529507013818	Protein of unknown function (DUF1040); Region: DUF1040; cl01176
529507013819	HMMPfam hit to PF06288, Protein of unknown function (DUF1040), score 2.3e-58
529507013820	molybdopterin-guanine dinucleotide biosynthesis protein MobA; Reviewed; Region: mobA; PRK00317
529507013821	MobA catalyzes the formation of molybdopterin guanine dinucleotide; Region: MobA; cd02503
529507013822	GTP binding site; other site
529507013823	Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes. In E. coli, the synthesis of Moco involves genes from several loci: moa; Region: MobB; cd03116
529507013824	Walker A motif; other site
529507013825	HMMPfam hit to PF03205, Molybdopterin guanine dinucleotide synthesis, score 2.2e-56
529507013826	PS00017 ATP/GTP-binding site motif A (P-loop).
529507013827	This group of proteins belong to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function.  The conserved domain is similar in structure to chorismate mutase but there is no sequence...; Region: YjgF_YER057c_UK114_like_3; cd06151
529507013828	homotrimer interaction site [polypeptide binding]; other site
529507013829	putative active site [active]
529507013830	HMMPfam hit to PF01042, Endoribonuclease L-PSP, score 3.3e-17
529507013831	PS01094 Uncharacterized protein family UPF0076 signature.
529507013832	Signal peptide predicted for PMI2833 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.979 between residues 21 and 22
529507013833	Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism]; Region: DadA; COG0665
529507013834	NAD(P)-binding Rossmann-like domain; Region: NAD_binding_8; pfam13450
529507013835	HMMPfam hit to PF01266, FAD dependent oxidoreductase, score 4.7e-71
529507013836	1 probable transmembrane helix predicted for PMI2834 by TMHMM2.0 at aa 7-29
529507013837	Signal peptide predicted for PMI2834 by SignalP 2.0 HMM (Signal peptide probability 0.998) with cleavage site probability 0.408 between residues 19 and 20
529507013838	glutathione reductase; Validated; Region: PRK06116
529507013839	NAD(P)-binding Rossmann-like domain; Region: NAD_binding_8; cl17500
529507013840	Pyridine nucleotide-disulphide oxidoreductase; Region: Pyr_redox; pfam00070
529507013841	Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain; Region: Pyr_redox_dim; pfam02852
529507013842	HMMPfam hit to PF02852, Pyridine nucleotide-disulphide oxidored, score 4e-50
529507013843	HMMPfam hit to PF00070, Pyridine nucleotide-disulphide oxidored, score 1.4e-90
529507013844	PS00076 Pyridine nucleotide-disulphide oxidoreductases class-I active site.
529507013845	Protein involved in catabolism of external DNA [General function prediction only]; Region: ComJ; COG2961
529507013846	HMMPfam hit to PF04378, Protein of unknown function (DUF519), score 1.6e-153
529507013847	PS00092 N-6 Adenine-specific DNA methylases signature.
529507013848	PS00092 N-6 Adenine-specific DNA methylases signature.
529507013849	Protein of unknown function (DUF1090); Region: DUF1090; pfam06476
529507013850	Signal peptide predicted for PMI2837 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.993 between residues 20 and 21
529507013851	HMMPfam hit to PF06476, Protein of unknown function (DUF1090), score 9.2e-35
529507013852	Virulence factor BrkB; Region: Virul_fac_BrkB; cl07918
529507013853	HMMPfam hit to PF03631, Ribonuclease BN-like family, score 3.6e-22
529507013854	6 probable transmembrane helices predicted for PMI2838 by TMHMM2.0 at aa 75-97, 136-155, 186-208, 228-250, 262-284 and 299-321
529507013855	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507013856	4-Oxalocrotonate Tautomerase:  Catalyzes the isomerization of unsaturated ketones. The structure is a homohexamer that is arranged as a trimer of dimers. The hexamer contains six active sites, each formed by residues from three monomers, two from one...; Region: 4Oxalocrotonate_Tautomerase; cl00235
529507013857	active site 1 [active]
529507013858	dimer interface [polypeptide binding]; other site
529507013859	hexamer interface [polypeptide binding]; other site
529507013860	active site 2 [active]
529507013861	HMMPfam hit to PF01361, Tautomerase enzyme, score 5.9e-25
529507013862	Predicted Zn-dependent peptidases [General function prediction only]; Region: PqqL; COG0612
529507013863	Peptidase M16 inactive domain; Region: Peptidase_M16_C; pfam05193
529507013864	HMMPfam hit to PF05193, Peptidase M16 inactive domain, score 9e-09
529507013865	HMMPfam hit to PF00675, Insulinase (Peptidase family M16), score 0.16
529507013866	Signal peptide predicted for PMI2840 by SignalP 2.0 HMM (Signal peptide probability 0.990) with cleavage site probability 0.895 between residues 24 and 25
529507013867	Histidine kinase, Adenylyl cyclase, Methyl-accepting protein, and Phosphatase (HAMP) domain. HAMP is a signaling domain which occurs in a wide variety of signaling proteins, many of which are bacterial. The HAMP domain consists of two alpha helices...; Region: HAMP; cl01054
529507013868	HMMPfam hit to PF00672, HAMP domain, score 0.036
529507013869	2 probable transmembrane helices predicted for PMI2841 by TMHMM2.0 at aa 15-37 and 160-182
529507013870	Signal peptide predicted for PMI2841 by SignalP 2.0 HMM (Signal peptide probability 0.709) with cleavage site probability 0.288 between residues 36 and 37
529507013871	haemagglutination activity domain; Region: Haemagg_act; pfam05860
529507013872	HMMPfam hit to PF05860, haemagglutination activity domain, score 6.9e-22
529507013873	Signal peptide predicted for PMI2842 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.810 between residues 27 and 28
529507013874	dipeptide transporter ATP-binding subunit; Provisional; Region: dppF; PRK11308
529507013875	ATP-binding cassette domain of nickel/oligopeptides specific transporters; Region: ABC_NikE_OppD_transporters; cd03257
529507013876	Walker A/P-loop; other site
529507013877	ATP binding site [chemical binding]; other site
529507013878	Q-loop/lid; other site
529507013879	ABC transporter signature motif; other site
529507013880	Walker B; other site
529507013881	D-loop; other site
529507013882	H-loop/switch region; other site
529507013883	Oligopeptide/dipeptide transporter, C-terminal region; Region: oligo_HPY; cl07097
529507013884	HMMPfam hit to PF00005, ABC transporter, score 4.3e-60
529507013885	PS00211 ABC transporters family signature.
529507013886	PS00017 ATP/GTP-binding site motif A (P-loop).
529507013887	dipeptide transporter ATP-binding subunit; Provisional; Region: dppD; PRK11022
529507013888	ATP-binding cassette domain of nickel/oligopeptides specific transporters; Region: ABC_NikE_OppD_transporters; cd03257
529507013889	Walker A/P-loop; other site
529507013890	ATP binding site [chemical binding]; other site
529507013891	Q-loop/lid; other site
529507013892	ABC transporter signature motif; other site
529507013893	Walker B; other site
529507013894	D-loop; other site
529507013895	H-loop/switch region; other site
529507013896	oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain; Region: oligo_HPY; TIGR01727
529507013897	HMMPfam hit to PF00005, ABC transporter, score 8.1e-58
529507013898	PS00211 ABC transporters family signature.
529507013899	PS00017 ATP/GTP-binding site motif A (P-loop).
529507013900	dipeptide transporter; Provisional; Region: PRK10913
529507013901	N-terminal TM domain of oligopeptide transport permease C; Region: OppC_N; pfam12911
529507013902	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
529507013903	dimer interface [polypeptide binding]; other site
529507013904	conserved gate region; other site
529507013905	putative PBP binding loops; other site
529507013906	ABC-ATPase subunit interface; other site
529507013907	HMMPfam hit to PF00528, Binding-protein-dependent transport syst, score 1.7e-47
529507013908	5 probable transmembrane helices predicted for PMI2845 by TMHMM2.0 at aa 31-53, 103-125, 140-162, 215-237 and 265-287
529507013909	ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism]; Region: DppB; COG0601
529507013910	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
529507013911	dimer interface [polypeptide binding]; other site
529507013912	conserved gate region; other site
529507013913	putative PBP binding loops; other site
529507013914	ABC-ATPase subunit interface; other site
529507013915	HMMPfam hit to PF00528, Binding-protein-dependent transport syst, score 4.1e-55
529507013916	6 probable transmembrane helices predicted for PMI2846 by TMHMM2.0 at aa 9-31, 99-121, 134-156, 199-221, 259-281 and 309-331
529507013917	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
529507013918	ABC-type dipeptide transport system, periplasmic component [Amino acid transport and metabolism]; Region: DdpA; COG0747
529507013919	The substrate-binding component of an ABC-type dipeptide import system contains the type 2 periplasmic binding fold; Region: PBP2_DppA_like; cd08493
529507013920	peptide binding site [polypeptide binding]; other site
529507013921	HMMPfam hit to PF00496, Bacterial extracellular solute-binding prot, score 9.7e-97
529507013922	PS01040 Bacterial extracellular solute-binding proteins, family 5 signature.
529507013923	Signal peptide predicted for PMI2847 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.991 between residues 28 and 29
529507013924	Hemolysin activation/secretion protein [Intracellular trafficking and secretion]; Region: FhaC; COG2831
529507013925	POTRA domain, ShlB-type; Region: POTRA_2; pfam08479
529507013926	Haemolysin secretion/activation protein ShlB/FhaC/HecB; Region: ShlB; pfam03865
529507013927	Signal peptide predicted for PMI2848 by SignalP 2.0 HMM (Signal peptide probability 0.985) with cleavage site probability 0.974 between residues 22 and 23
529507013928	Signal peptide predicted for PMI2849 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.976 between residues 21 and 22
529507013929	Protein of unknown function (DUF1375); Region: DUF1375; cl11456
529507013930	HMMPfam hit to PF07119, Protein of unknown function (DUF1375), score 7.3e-33
529507013931	Signal peptide predicted for PMI2850 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.912 between residues 28 and 29
529507013932	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507013933	putative transporter; Validated; Region: PRK03818
529507013934	Predicted Permease Membrane Region; Region: Asp-Al_Ex; pfam06826
529507013935	TrkA-C domain; Region: TrkA_C; pfam02080
529507013936	TrkA-C domain; Region: TrkA_C; pfam02080
529507013937	AspT/YidE/YbjL antiporter duplication domain; Region: YidE_YbjL_dupl; TIGR01625
529507013938	11 probable transmembrane helices predicted for PMI2851 by TMHMM2.0 at aa 4-23, 30-52, 67-86, 93-115, 160-182, 371-393, 403-425, 438-460, 465-484, 491-513 and 528-550
529507013939	HMMPfam hit to PF06826, Predicted Permease Membrane Region, score 5.6e-62
529507013940	HMMPfam hit to PF02080, TrkA-C domain, score 7.1e-14
529507013941	HMMPfam hit to PF02080, TrkA-C domain, score 3.2e-11
529507013942	HMMPfam hit to PF06826, Predicted Permease Membrane Region, score 4.9e-62
529507013943	valine--pyruvate transaminase; Provisional; Region: avtA; PRK09440
529507013944	Aspartate aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). Pyridoxal phosphate combines with an alpha-amino acid to form a compound called a Schiff base or aldimine...; Region: AAT_like; cd00609
529507013945	pyridoxal 5'-phosphate binding site [chemical binding]; other site
529507013946	homodimer interface [polypeptide binding]; other site
529507013947	catalytic residue [active]
529507013948	Methyladenine glycosylase; Region: Adenine_glyco; pfam03352
529507013949	HMMPfam hit to PF03352, Methyladenine glycosylase, score 5.2e-113
529507013950	Class II Glycyl-tRNA synthetase (GlyRS) alpha subunit core catalytic domain. GlyRS functions as a homodimer in eukaryotes, archaea and some bacteria and as a heterotetramer in the remainder of prokaryotes and in arabidopsis. It is responsible for the...; Region: GlyRS_alpha_core; cd00733
529507013951	dimer interface [polypeptide binding]; other site
529507013952	motif 1; other site
529507013953	active site
529507013954	motif 2; other site
529507013955	motif 3; other site
529507013956	HMMPfam hit to PF02091, Glycyl-tRNA synthetase alpha subunit, score 1.2e-245
529507013957	PS00339 Aminoacyl-transfer RNA synthetases class-II signature 2.
529507013958	glycyl-tRNA synthetase subunit beta; Validated; Region: glyS; PRK01233
529507013959	DALR anticodon binding domain; Region: DALR_1; pfam05746
529507013960	HMMPfam hit to PF02092, Glycyl-tRNA synthetase beta subunit, score 0
529507013961	HMMPfam hit to PF05746, DALR anticodon binding domain, score 1.8e-05
529507013962	Protein of unknown function (DUF1044); Region: DUF1044; pfam06296
529507013963	HMMPfam hit to PF06296, Protein of unknown function (DUF1044), score 3.8e-42
529507013964	Predicted transcriptional regulator [Transcription]; Region: COG2944
529507013965	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
529507013966	non-specific DNA binding site [nucleotide binding]; other site
529507013967	salt bridge; other site
529507013968	sequence-specific DNA binding site [nucleotide binding]; other site
529507013969	HMMPfam hit to PF01381, Helix-turn-helix, score 7.6e-07
529507013970	Exonuclease-Endonuclease-Phosphatase (EEP) domain superfamily; Region: EEP; cl00490
529507013971	putative catalytic site [active]
529507013972	putative metal binding site [ion binding]; other site
529507013973	putative phosphate binding site [ion binding]; other site
529507013974	HMMPfam hit to PF03372, Endonuclease/Exonuclease/phosphatase fa, score 0.00023
529507013975	Protein of unknown function (DUF3748); Region: DUF3748; pfam12566
529507013976	Predicted membrane protein [Function unknown]; Region: COG2860
529507013977	UPF0126 domain; Region: UPF0126; pfam03458
529507013978	UPF0126 domain; Region: UPF0126; pfam03458
529507013979	HMMPfam hit to PF03458, UPF0126 domain, score 1.3e-36
529507013980	7 probable transmembrane helices predicted for PMI2861 by TMHMM2.0 at aa 5-22, 29-51, 61-80, 87-109, 113-132, 148-169 and 173-190
529507013981	HMMPfam hit to PF03458, UPF0126 domain, score 2.3e-31
529507013982	Guanylate kinase [Nucleotide transport and metabolism]; Region: Gmk; COG0194
529507013983	Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), also known as guanylate kinase (GKase), catalyzes the reversible phosphoryl transfer from adenosine triphosphate (ATP) to guanosine monophosphate (GMP) to yield adenosine diphosphate (ADP) and guanosine...; Region: GMPK; cd00071
529507013984	catalytic site [active]
529507013985	G-X2-G-X-G-K; other site
529507013986	PS00017 ATP/GTP-binding site motif A (P-loop).
529507013987	PS00856 Guanylate kinase signature.
529507013988	HMMPfam hit to PF00625, Guanylate kinase, score 2.8e-56
529507013989	DNA-directed RNA polymerase, omega subunit; Region: rpoZ; TIGR00690
529507013990	HMMPfam hit to PF01192, RNA polymerase Rpb6, score 1.2e-21
529507013991	bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional; Region: PRK11092
529507013992	Metal dependent phosphohydrolases with conserved 'HD' motif; Region: HDc; cd00077
529507013993	Zn2+ binding site [ion binding]; other site
529507013994	Mg2+ binding site [ion binding]; other site
529507013995	Nucleotidyltransferase (NT) domain of RelA- and SpoT-like ppGpp synthetases and hydrolases; Region: NT_Rel-Spo_like; cd05399
529507013996	synthetase active site [active]
529507013997	NTP binding site [chemical binding]; other site
529507013998	metal binding site [ion binding]; metal-binding site
529507013999	TGS_RelA_SpoT: The RelA (SpoT) protein, also referred to as ppGpp hydrolase/synthetase, is a ribosome-associated protein that is activated during amino acid starvation and thought to mediate the stringent response. RelA contains a TGS domain, named after...; Region: TGS_RelA_SpoT; cd01668
529507014000	ACT  domain found C-terminal of the RelA/SpoT domains; Region: ACT_RelA-SpoT; cd04876
529507014001	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507014002	HMMPfam hit to PF01966, HD domain, score 6.5e-16
529507014003	HMMPfam hit to PF04607, Region found in RelA / SpoT proteins, score 2.4e-47
529507014004	HMMPfam hit to PF02824, TGS domain, score 6.2e-29
529507014005	HMMPfam hit to PF01842, ACT domain, score 0.00091
529507014006	tRNA guanosine-2'-O-methyltransferase; Provisional; Region: PRK11081
529507014007	SpoU rRNA Methylase family; Region: SpoU_methylase; pfam00588
529507014008	SpoU, rRNA methylase, C-terminal; Region: SpoU_methylas_C; pfam12105
529507014009	HMMPfam hit to PF00588, SpoU rRNA Methylase family, score 2.4e-45
529507014010	ATP-dependent DNA helicase RecG; Provisional; Region: PRK10917
529507014011	Y-family of DNA polymerases; Region: PolY; cl12025
529507014012	RecG_wedge_OBF: A subfamily of OB folds corresponding to the OB fold found in the N-terminal (wedge) domain of Escherichia coli RecG. RecG is a branched-DNA-specific helicase, which catalyzes the interconversion of a DNA replication fork to a...; Region: RecG_wedge_OBF; cd04488
529507014013	generic binding surface II; other site
529507014014	ssDNA binding site; other site
529507014015	DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region; Region: DEXDc; cd00046
529507014016	ATP binding site [chemical binding]; other site
529507014017	putative Mg++ binding site [ion binding]; other site
529507014018	Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may...; Region: HELICc; cd00079
529507014019	nucleotide binding region [chemical binding]; other site
529507014020	ATP-binding site [chemical binding]; other site
529507014021	HMMPfam hit to PF01336, OB-fold nucleic acid binding domain, score 7.7e-12
529507014022	HMMPfam hit to PF04851, Type III restriction enzyme, res subunit, score 6.5e-06
529507014023	HMMPfam hit to PF00270, DEAD/DEAH box helicase, score 4.5e-38
529507014024	PS00017 ATP/GTP-binding site motif A (P-loop).
529507014025	PS00435 Peroxidases proximal heme-ligand signature.
529507014026	HMMPfam hit to PF00271, Helicase conserved C-terminal domain, score 1.8e-22
529507014027	sodium--glutamate symport carrier (gltS); Region: gltS; TIGR00210
529507014028	11 probable transmembrane helices predicted for PMI2867 by TMHMM2.0 at aa 4-21, 33-55, 70-87, 94-116, 154-176, 213-235, 245-267, 274-292, 302-324, 336-358 and 368-390
529507014029	HMMPfam hit to PF03616, Sodium/glutamate symporter, score 3.9e-237
529507014030	Xanthine/uracil permeases [Nucleotide transport and metabolism]; Region: UraA; COG2233
529507014031	HMMPfam hit to PF00860, Permease family, score 1.2e-152
529507014032	11 probable transmembrane helices predicted for PMI2868 by TMHMM2.0 at aa 44-66, 96-118, 128-150, 157-179, 194-213, 220-242, 262-284, 347-369, 379-401, 408-430 and 440-459
529507014033	PS00038 Myc-type, 'helix-loop-helix' dimerization domain signature.
529507014034	PS01116 Xanthine/uracil permeases family signature.
529507014035	AsmA family; Region: AsmA; pfam05170
529507014036	HMMPfam hit to PF07089, Protein of unknown function (DUF1354), score 8.8e-36
529507014037	Signal peptide predicted for PMI2870 by SignalP 2.0 HMM (Signal peptide probability 0.994) with cleavage site probability 0.582 between residues 26 and 27
529507014038	23S rRNA pseudouridine synthase F; Provisional; Region: PRK10475
529507014039	S4/Hsp/ tRNA synthetase RNA-binding domain; The domain surface is populated by conserved, charged residues that define a likely RNA-binding site;  Found in stress proteins, ribosomal proteins and tRNA synthetases; This may imply a hitherto unrecognized...; Region: S4; cd00165
529507014040	RNA binding surface [nucleotide binding]; other site
529507014041	Pseudouridine synthase, Escherichia coli RluF like; Region: PseudoU_synth_RluF; cd02554
529507014042	probable active site [active]
529507014043	HMMPfam hit to PF00849, RNA pseudouridylate synthase, score 2.1e-24
529507014044	PS01149 Rsu family of pseudouridine synthase signature.
529507014045	HMMPfam hit to PF01479, S4 domain, score 6.6e-14
529507014046	Acetyltransferase (GNAT) domain; Region: Acetyltransf_3; pfam13302
529507014047	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cd04301
529507014048	Coenzyme A binding pocket [chemical binding]; other site
529507014049	Putative thioesterase (yiiD_Cterm); Region: YiiD_Cterm; pfam09500
529507014050	HMMPfam hit to PF00583, Acetyltransferase (GNAT) family, score 3.3e-17
529507014051	D-Tyrosyl-tRNAtyr deacylases; a class of tRNA-dependent hydrolases which are capable of hydrolyzing the ester bond of D-Tyrosyl-tRNA reducing the level of cellular D-Tyrosine while recycling the peptidyl-tRNA; found in bacteria and in eukaryotes but not...; Region: Dtyr_deacylase; cd00563
529507014052	putative active site [active]
529507014053	dimerization interface [polypeptide binding]; other site
529507014054	putative tRNAtyr binding site [nucleotide binding]; other site
529507014055	HMMPfam hit to PF02580, D-Tyr-tRNA(Tyr) deacylase, score 2.1e-74
529507014056	haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED; Region: HAD-SF-IA-v3; TIGR01509
529507014057	Haloacid dehalogenase-like hydrolases. The haloacid dehalogenase-like (HAD) superfamily includes L-2-haloacid dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, and many others; Region: HAD_like; cd01427
529507014058	motif II; other site
529507014059	HMMPfam hit to PF00702, haloacid dehalogenase-like hydrolase, score 3.5e-15
529507014060	Helix-turn-helix XRE-family like proteins; Region: HTH_XRE; smart00530
529507014061	non-specific DNA binding site [nucleotide binding]; other site
529507014062	salt bridge; other site
529507014063	sequence-specific DNA binding site [nucleotide binding]; other site
529507014064	HMMPfam hit to PF01381, Helix-turn-helix, score 5.3e-09
529507014065	Signal peptide predicted for PMI2877 by SignalP 2.0 HMM (Signal peptide probability 0.727) with cleavage site probability 0.206 between residues 23 and 24
529507014066	PIN domain of ribonucleases (toxins), VapC and FitB, of prokaryotic toxin/antitoxin operons, Pyrococcus horikoshii protein PH0500, and other similar bacterial and archaeal homologs; Region: PIN_VapC-FitB; cd09881
529507014067	oligomeric interface; other site
529507014068	putative active site [active]
529507014069	homodimer interface [polypeptide binding]; other site
529507014070	HMMPfam hit to PF01850, PIN domain, score 4.9e-11
529507014071	Virulence-associated protein and related proteins [Function unknown]; Region: VagC; COG4456
529507014072	HMMPfam hit to PF04014, SpoVT / AbrB like domain, score 2.1e-11
529507014073	Predicted membrane GTPase involved in stress response [Signal transduction mechanisms]; Region: TypA; COG1217
529507014074	Tyrosine phosphorylated protein A (TypA)/BipA family belongs to ribosome-binding GTPases; Region: TypA_BipA; cd01891
529507014075	G1 box; other site
529507014076	putative GEF interaction site [polypeptide binding]; other site
529507014077	GTP/Mg2+ binding site [chemical binding]; other site
529507014078	Switch I region; other site
529507014079	G2 box; other site
529507014080	G3 box; other site
529507014081	Switch II region; other site
529507014082	G4 box; other site
529507014083	G5 box; other site
529507014084	BipA_TypA_II: domain II of BipA (also called TypA) having homology to domain II of the elongation factors (EFs) EF-G and EF-Tu.  BipA is a highly conserved protein with global regulatory properties in Escherichia coli. BipA is phosphorylated on a...; Region: BipA_TypA_II; cd03691
529507014085	BipA_TypA_C: a C-terminal portion of BipA or TypA having homology to the C terminal domains of the elongation factors EF-G and EF-2. A member of the ribosome binding GTPase superfamily, BipA is widely distributed in bacteria and plants.  BipA is a highly...; Region: BipA_TypA_C; cd03710
529507014086	HMMPfam hit to PF00679, Elongation factor G C-terminus, score 5.4e-32
529507014087	HMMPfam hit to PF03144, Elongation factor Tu domain, score 5e-13
529507014088	HMMPfam hit to PF00009, Elongation factor Tu GTP binding domain, score 1.7e-73
529507014089	PS00301 GTP-binding elongation factors signature.
529507014090	PS00017 ATP/GTP-binding site motif A (P-loop).
529507014091	glutamine synthetase; Provisional; Region: glnA; PRK09469
529507014092	Glutamine synthetase, beta-Grasp domain; Region: Gln-synt_N; pfam03951
529507014093	Glutamine synthetase, catalytic domain; Region: Gln-synt_C; pfam00120
529507014094	HMMPfam hit to PF03951, Glutamine synthetase, beta-Grasp domain, score 4.7e-46
529507014095	PS00180 Glutamine synthetase signature 1.
529507014096	HMMPfam hit to PF00120, Glutamine synthetase, catalytic domain, score 7.6e-164
529507014097	PS00181 Glutamine synthetase ATP-binding region signature.
529507014098	PS00182 Glutamine synthetase class-I adenylation site.
529507014099	nitrogen regulation protein NR(II); Provisional; Region: glnL; PRK11073
529507014100	PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in...; Region: PAS; cd00130
529507014101	putative active site [active]
529507014102	heme pocket [chemical binding]; other site
529507014103	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
529507014104	ATP binding site [chemical binding]; other site
529507014105	Mg2+ binding site [ion binding]; other site
529507014106	G-X-G motif; other site
529507014107	HMMPfam hit to PF00512, His Kinase A (phosphoacceptor) domain, score 3.4e-15
529507014108	HMMPfam hit to PF02518, Histidine kinase-, DNA gyrase B-, and HSP90, score 7.2e-27
529507014109	nitrogen regulation protein NR(I); Provisional; Region: glnG; PRK10923
529507014110	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
529507014111	active site
529507014112	phosphorylation site [posttranslational modification]
529507014113	intermolecular recognition site; other site
529507014114	dimerization interface [polypeptide binding]; other site
529507014115	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
529507014116	Walker A motif; other site
529507014117	ATP binding site [chemical binding]; other site
529507014118	Walker B motif; other site
529507014119	arginine finger; other site
529507014120	Bacterial regulatory protein, Fis family; Region: HTH_8; pfam02954
529507014121	HMMPfam hit to PF00072, Response regulator receiver domain, score 9.8e-36
529507014122	HMMPfam hit to PF00158, Sigma-54 interaction domain, score 1.4e-145
529507014123	PS00675 Sigma-54 interaction domain ATP-binding region A signature.
529507014124	PS00676 Sigma-54 interaction domain ATP-binding region B signature.
529507014125	HMMPfam hit to PF02954, Bacterial regulatory protein, Fis fam, score 2.7e-15
529507014126	coproporphyrinogen III oxidase; Provisional; Region: PRK09249
529507014127	Radical SAM superfamily. Enzymes of this family generate radicals by combining a 4Fe-4S cluster and S-adenosylmethionine (SAM) in close proximity. They are characterized by a conserved CxxxCxxC motif, which coordinates the conserved iron-sulfur cluster; Region: Radical_SAM; cd01335
529507014128	FeS/SAM binding site; other site
529507014129	HemN C-terminal domain; Region: HemN_C; pfam06969
529507014130	HMMPfam hit to PF06969, HemN C-terminal region, score 8e-51
529507014131	HMMPfam hit to PF04055, Radical SAM superfamily, score 1.3e-25
529507014132	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG4380
529507014133	HMMPfam hit to PF05643, bacterial lipoprotein (DUF799), score 1e-69
529507014134	Signal peptide predicted for PMI2886 by SignalP 2.0 HMM (Signal peptide probability 0.980) with cleavage site probability 0.748 between residues 20 and 21
529507014135	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507014136	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG4259
529507014137	Signal peptide predicted for PMI2887 by SignalP 2.0 HMM (Signal peptide probability 0.986) with cleavage site probability 0.536 between residues 20 and 21
529507014138	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507014139	Curli production assembly/transport component CsgG; Region: CsgG; pfam03783
529507014140	HMMPfam hit to PF03783, Curli production assembly/transport componen, score 1.9e-77
529507014141	PS00017 ATP/GTP-binding site motif A (P-loop).
529507014142	1 probable transmembrane helix predicted for PMI2888 by TMHMM2.0 at aa 20-42
529507014143	Signal peptide predicted for PMI2888 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.213 between residues 24 and 25
529507014144	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507014145	Transcriptional accessory protein [Transcription]; Region: Tex; COG2183
529507014146	Tex-like protein N-terminal domain; Region: Tex_N; pfam09371
529507014147	Likely ribonuclease with RNase H fold; Region: YqgFc; smart00732
529507014148	S1_Tex: The C-terminal S1 domain of a transcription accessory factor called Tex, which has been characterized in Bordetella pertussis and Pseudomonas aeruginosa. The tex gene is essential in Bortella pertusis and is named for its role in toxin expression; Region: S1_Tex; cd05685
529507014149	RNA binding site [nucleotide binding]; other site
529507014150	HMMPfam hit to PF00575, S1 RNA binding domain, score 8.2e-28
529507014151	transcription elongation factor GreB; Reviewed; Region: greB; PRK01885
529507014152	Transcription elongation factor, N-terminal; Region: GreA_GreB_N; pfam03449
529507014153	Transcription elongation factor, GreA/GreB, C-term; Region: GreA_GreB; pfam01272
529507014154	HMMPfam hit to PF03449, Prokaryotic transcription elongation fact, score 8.5e-39
529507014155	PS00829 Prokaryotic transcription elongation factors signature 1.
529507014156	HMMPfam hit to PF01272, Prokaryotic transcription elongation fact, score 1e-37
529507014157	PS00830 Prokaryotic transcription elongation factors signature 2.
529507014158	osmolarity response regulator; Provisional; Region: ompR; PRK09468
529507014159	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
529507014160	active site
529507014161	phosphorylation site [posttranslational modification]
529507014162	intermolecular recognition site; other site
529507014163	dimerization interface [polypeptide binding]; other site
529507014164	Effector domain of response regulator. Bacteria and certain eukaryotes like protozoa and higher plants use two-component signal transduction systems to detect and respond to changes in the environment. The system consists of a sensor histidine kinase and...; Region: trans_reg_C; cd00383
529507014165	DNA binding site [nucleotide binding]
529507014166	HMMPfam hit to PF00072, Response regulator receiver domain, score 7e-45
529507014167	HMMPfam hit to PF00486, Transcriptional regulatory protein, C te, score 2.4e-18
529507014168	osmolarity sensor protein; Provisional; Region: envZ; PRK09467
529507014169	Histidine kinase, Adenylyl cyclase, Methyl-accepting protein, and Phosphatase (HAMP) domain. HAMP is a signaling domain which occurs in a wide variety of signaling proteins, many of which are bacterial. The HAMP domain consists of two alpha helices...; Region: HAMP; cd06225
529507014170	dimerization interface [polypeptide binding]; other site
529507014171	Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via...; Region: HisKA; cd00082
529507014172	dimer interface [polypeptide binding]; other site
529507014173	phosphorylation site [posttranslational modification]
529507014174	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
529507014175	ATP binding site [chemical binding]; other site
529507014176	Mg2+ binding site [ion binding]; other site
529507014177	G-X-G motif; other site
529507014178	Signal peptide predicted for PMI2892 by SignalP 2.0 HMM (Signal peptide probability 0.998) with cleavage site probability 0.468 between residues 34 and 35
529507014179	2 probable transmembrane helices predicted for PMI2892 by TMHMM2.0 at aa 17-39 and 156-178
529507014180	HMMPfam hit to PF00672, HAMP domain, score 1.7e-10
529507014181	HMMPfam hit to PF00512, His Kinase A (phosphoacceptor) domain, score 2e-12
529507014182	HMMPfam hit to PF02518, Histidine kinase-, DNA gyrase B-, and HSP90, score 2.5e-30
529507014183	Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of  substrates, such as, amino acids, peptides, sugars, vitamins and inorganic...; Region: PBPb; cd00134
529507014184	Signal peptide predicted for PMI2893 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.788 between residues 25 and 26
529507014185	HMMPfam hit to PF01547, Bacterial extracellular solute-binding prot, score 3.4e-33
529507014186	1 probable transmembrane helix predicted for PMI2893 by TMHMM2.0 at aa 21-43
529507014187	phosphate transporter permease subunit PstC; Provisional; Region: pstC; PRK11275
529507014188	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
529507014189	dimer interface [polypeptide binding]; other site
529507014190	conserved gate region; other site
529507014191	putative PBP binding loops; other site
529507014192	ABC-ATPase subunit interface; other site
529507014193	6 probable transmembrane helices predicted for PMI2894 by TMHMM2.0 at aa 21-43, 78-100, 112-134, 166-188, 227-249 and 282-304
529507014194	HMMPfam hit to PF00528, Binding-protein-dependent transport syst, score 2.5e-12
529507014195	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
529507014196	phosphate transporter permease subunit PtsA; Provisional; Region: pstA; PRK11268
529507014197	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
529507014198	dimer interface [polypeptide binding]; other site
529507014199	conserved gate region; other site
529507014200	putative PBP binding loops; other site
529507014201	ABC-ATPase subunit interface; other site
529507014202	Signal peptide predicted for PMI2895 by SignalP 2.0 HMM (Signal peptide probability 0.817) with cleavage site probability 0.398 between residues 58 and 59
529507014203	6 probable transmembrane helices predicted for PMI2895 by TMHMM2.0 at aa 33-55, 92-114, 127-149, 154-173, 205-227 and 272-294
529507014204	HMMPfam hit to PF00528, Binding-protein-dependent transport syst, score 2.8e-38
529507014205	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
529507014206	phosphate transporter ATP-binding protein; Provisional; Region: pstB; PRK10744
529507014207	ATP-binding cassette domain of the phosphate transport system; Region: ABC_PstB_phosphate_transporter; cd03260
529507014208	Walker A/P-loop; other site
529507014209	ATP binding site [chemical binding]; other site
529507014210	Q-loop/lid; other site
529507014211	ABC transporter signature motif; other site
529507014212	Walker B; other site
529507014213	D-loop; other site
529507014214	H-loop/switch region; other site
529507014215	HMMPfam hit to PF00005, ABC transporter, score 3.2e-72
529507014216	PS00017 ATP/GTP-binding site motif A (P-loop).
529507014217	PS00211 ABC transporters family signature.
529507014218	transcriptional regulator PhoU; Provisional; Region: PRK11115
529507014219	PhoU domain; Region: PhoU; pfam01895
529507014220	PhoU domain; Region: PhoU; pfam01895
529507014221	HMMPfam hit to PF01895, PhoU family, score 3.7e-32
529507014222	HMMPfam hit to PF01895, PhoU family, score 1.4e-31
529507014223	Bacterial extracellular solute-binding proteins, family 3; Region: SBP_bac_3; pfam00497
529507014224	Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of  substrates, such as, amino acids, peptides, sugars, vitamins and inorganic...; Region: PBPb; cd00134
529507014225	substrate binding pocket [chemical binding]; other site
529507014226	membrane-bound complex binding site; other site
529507014227	hinge residues; other site
529507014228	Signal peptide predicted for PMI2898 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.981 between residues 23 and 24
529507014229	HMMPfam hit to PF00497, Bacterial extracellular solute-binding prot, score 3e-65
529507014230	ABC-type arginine transport system, permease component [Amino acid transport and metabolism]; Region: ArtQ; COG4215
529507014231	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
529507014232	dimer interface [polypeptide binding]; other site
529507014233	conserved gate region; other site
529507014234	putative PBP binding loops; other site
529507014235	ABC-ATPase subunit interface; other site
529507014236	HMMPfam hit to PF00528, Binding-protein-dependent transport syst, score 1.7e-15
529507014237	4 probable transmembrane helices predicted for PMI2899 by TMHMM2.0 at aa 22-44, 64-86, 106-128 and 211-233
529507014238	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
529507014239	dimer interface [polypeptide binding]; other site
529507014240	conserved gate region; other site
529507014241	putative PBP binding loops; other site
529507014242	ABC-ATPase subunit interface; other site
529507014243	HMMPfam hit to PF00528, Binding-protein-dependent transport syst, score 4.4e-20
529507014244	5 probable transmembrane helices predicted for PMI2900 by TMHMM2.0 at aa 27-49, 61-83, 93-115, 161-183 and 198-220
529507014245	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
529507014246	8 probable transmembrane helices predicted for PMI2901 by TMHMM2.0 at aa 13-35, 40-59, 93-115, 125-147, 171-193, 208-230, 265-287 and 291-308
529507014247	malonyl CoA-acyl carrier protein transacylase; Region: fabD; TIGR00128
529507014248	(acyl-carrier-protein) S-malonyltransferase [Lipid metabolism]; Region: FabD; COG0331
529507014249	HMMPfam hit to PF00698, Acyl transferase domain, score 7.1e-07
529507014250	ABC-type transport system, involved in lipoprotein release, permease component [Cell envelope biogenesis, outer membrane]; Region: LolE; COG4591
529507014251	5 probable transmembrane helices predicted for PMI2903 by TMHMM2.0 at aa 4-26, 39-61, 299-321, 341-363 and 402-424
529507014252	Signal peptide predicted for PMI2904 by SignalP 2.0 HMM (Signal peptide probability 0.722) with cleavage site probability 0.220 between residues 21 and 22
529507014253	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
529507014254	lipoprotein releasing system, ATP-binding protein; Region: LolD_lipo_ex; TIGR02211
529507014255	Walker A/P-loop; other site
529507014256	ATP binding site [chemical binding]; other site
529507014257	Q-loop/lid; other site
529507014258	ABC transporter signature motif; other site
529507014259	Walker B; other site
529507014260	D-loop; other site
529507014261	H-loop/switch region; other site
529507014262	PS00017 ATP/GTP-binding site motif A (P-loop).
529507014263	3-oxoacyl-(acyl-carrier-protein) synthase [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism]; Region: FabB; COG0304
529507014264	Beta-ketoacyl synthase, C-terminal domain; Region: Ketoacyl-synt_C; pfam02801
529507014265	HMMPfam hit to PF02801, Beta-ketoacyl synthase, C-terminal do, score 7.6e-05
529507014266	HMMPfam hit to PF00109, Beta-ketoacyl synthase, N-terminal do, score 0.0062
529507014267	3-oxoacyl-(acyl-carrier-protein) synthase [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism]; Region: FabB; COG0304
529507014268	Beta-ketoacyl-acyl carrier protein (ACP) synthase (KAS), type I and II. KASs are responsible for the elongation steps in fatty acid biosynthesis. KASIII catalyses the initial condensation and KAS I and II catalyze further elongation steps by Claisen...; Region: KAS_I_II; cd00834
529507014269	dimer interface [polypeptide binding]; other site
529507014270	active site
529507014271	3-oxoacyl-(acyl-carrier-protein) synthase [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism]; Region: FabB; COG0304
529507014272	Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction. Members are share strong structural similarity, and are involved in the synthesis and degradation of fatty acids, and the...; Region: cond_enzymes; cl09938
529507014273	active site
529507014274	HMMPfam hit to PF02801, Beta-ketoacyl synthase, C-terminal do, score 1.7e-49
529507014275	HMMPfam hit to PF00109, Beta-ketoacyl synthase, N-terminal do, score 1.3e-12
529507014276	PS00606 Beta-ketoacyl synthases active site.
529507014277	Signal peptide predicted for PMI2908 by SignalP 2.0 HMM (Signal peptide probability 0.991) with cleavage site probability 0.987 between residues 20 and 21
529507014278	Glycine cleavage system T protein (aminomethyltransferase) [Amino acid transport and metabolism]; Region: GcvT; COG0404
529507014279	Glycine cleavage T-protein C-terminal barrel domain; Region: GCV_T_C; pfam08669
529507014280	HMMPfam hit to PF01571, Glycine cleavage T-protein (aminomethyl tran, score 3.3e-10
529507014281	Phosphopantetheine attachment site; Region: PP-binding; cl09936
529507014282	3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratases [Lipid metabolism]; Region: FabA; COG0764
529507014283	active site 2 [active]
529507014284	active site 1 [active]
529507014285	3-ketoacyl-(acyl-carrier-protein) reductase; Validated; Region: fabG; PRK05653
529507014286	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
529507014287	NAD(P) binding site [chemical binding]; other site
529507014288	active site
529507014289	HMMPfam hit to PF00106, short chain dehydrogenase, score 2.6e-68
529507014290	PS00061 Short-chain dehydrogenases/reductases family signature.
529507014291	PS00108 Serine/Threonine protein kinases active-site signature.
529507014292	4'-phosphopantetheinyl transferase; Provisional; Region: acpS; PRK00070
529507014293	HMMPfam hit to PF01648, 4'-phosphopantetheinyl transferase superfami, score 1.1e-10
529507014294	haemagglutination activity domain; Region: Haemagg_act; pfam05860
529507014295	HMMPfam hit to PF05594, Haemagluttinin repeat, score 0.0043
529507014296	HMMPfam hit to PF05594, Haemagluttinin repeat, score 2
529507014297	HMMPfam hit to PF05594, Haemagluttinin repeat, score 1
529507014298	HMMPfam hit to PF05594, Haemagluttinin repeat, score 1.3
529507014299	HMMPfam hit to PF05594, Haemagluttinin repeat, score 2.2
529507014300	PS00018 EF-hand calcium-binding domain.
529507014301	HMMPfam hit to PF05860, haemagglutination activity domain, score 3.7e-28
529507014302	Signal peptide predicted for PMI2914 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.933 between residues 30 and 31
529507014303	Xanthine/uracil/vitamin C permease [Nucleotide transport and    metabolism]; Region: COG2252
529507014304	13 probable transmembrane helices predicted for PMI2915 by TMHMM2.0 at aa 22-44, 59-81, 83-105, 110-132, 139-158, 178-197, 204-226, 241-263, 292-314, 324-346, 351-373, 388-410 and 422-444
529507014305	HMMPfam hit to PF00860, Permease family, score 3.5e-28
529507014306	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cl17182
529507014307	Acetyltransferase (GNAT) domain; Region: Acetyltransf_3; pfam13302
529507014308	HMMPfam hit to PF00583, Acetyltransferase (GNAT) family, score 1.9e-14
529507014309	Dolichyl-phosphate-mannose-protein mannosyltransferase; Region: PMT_2; pfam13231
529507014310	9 probable transmembrane helices predicted for PMI2917 by TMHMM2.0 at aa 12-34, 75-97, 104-126, 162-184, 196-218, 238-260, 273-290, 300-319 and 326-348
529507014311	Der GTPase activator; Provisional; Region: PRK05244
529507014312	HMMPfam hit to PF04220, Protein of unknown function, DUF414, score 2.9e-41
529507014313	Protein of unknown function (DUF4026); Region: DUF4026; pfam13218
529507014314	Uncharacterized protein conserved in bacteria (DUF2314); Region: DUF2314; pfam10077
529507014315	ferrous iron transport protein A; Reviewed; Region: feoA; PRK09555
529507014316	HMMPfam hit to PF04023, FeoA domain, score 1.9e-11
529507014317	ferrous iron transport protein B; Reviewed; Region: feoB; PRK09554
529507014318	Ferrous iron transport protein B (FeoB) family; Region: FeoB; cd01879
529507014319	G1 box; other site
529507014320	GTP/Mg2+ binding site [chemical binding]; other site
529507014321	Switch I region; other site
529507014322	G2 box; other site
529507014323	G3 box; other site
529507014324	Switch II region; other site
529507014325	G4 box; other site
529507014326	G5 box; other site
529507014327	Nucleoside recognition; Region: Gate; pfam07670
529507014328	Ferrous iron transport protein B C terminus; Region: FeoB_C; pfam07664
529507014329	Nucleoside recognition; Region: Gate; pfam07670
529507014330	HMMPfam hit to PF01926, GTPase of unknown function, score 3e-40
529507014331	PS00017 ATP/GTP-binding site motif A (P-loop).
529507014332	HMMPfam hit to PF02421, Ferrous iron transport protein B, score 5.5e-46
529507014333	10 probable transmembrane helices predicted for PMI2921 by TMHMM2.0 at aa 289-311, 321-343, 350-372, 387-409, 430-452, 456-478, 515-537, 667-689, 696-718 and 728-747
529507014334	HMMPfam hit to PF07670, Nucleoside recognition, score 3.3e-15
529507014335	PS00017 ATP/GTP-binding site motif A (P-loop).
529507014336	HMMPfam hit to PF07664, Ferrous iron transport protein B C terminus, score 7.8e-25
529507014337	HMMPfam hit to PF07670, Nucleoside recognition, score 1.2e-15
529507014338	FeoC like transcriptional regulator; Region: FeoC; cl17677
529507014339	OsmC-like protein; Region: OsmC; pfam02566
529507014340	carboxylesterase BioH; Provisional; Region: PRK10349
529507014341	methyl indole-3-acetate methyltransferase; Region: PLN02211; cl17657
529507014342	HMMPfam hit to PF00561, alpha/beta hydrolase fold, score 1.6e-27
529507014343	DNA utilization protein GntX; Provisional; Region: PRK11595
529507014344	Phosphoribosyl transferase (PRT)-type I domain; Region: PRTases_typeI; cd06223
529507014345	active site
529507014346	Fe/S biogenesis protein NfuA; Provisional; Region: PRK11190
529507014347	Fe-S cluster assembly scaffold protein [Posttranslational modification, protein turnover, chaperones]; Region: sufA; COG0316
529507014348	Thioredoxin-like proteins and domains [Posttranslational modification, protein turnover, chaperones]; Region: COG0694
529507014349	HMMPfam hit to PF01521, HesB-like domain, score 2.8e-39
529507014350	HMMPfam hit to PF01106, NifU-like domain, score 2.2e-07
529507014351	GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily. Unlike other rhodanese sulfurtransferases, GlpE is a single domain protein but indications are that it functions as a dimer. The active site contains a...; Region: GlpE_ST; cd01444
529507014352	active site residue [active]
529507014353	HMMPfam hit to PF00581, Rhodanese-like domain, score 3.6e-17
529507014354	intramembrane serine protease GlpG; Provisional; Region: PRK10907
529507014355	Protein of unknown function (DUF3582); Region: DUF3582; pfam12122
529507014356	Rhomboid family; Region: Rhomboid; pfam01694
529507014357	6 probable transmembrane helices predicted for PMI2928 by TMHMM2.0 at aa 99-121, 145-167, 180-199, 203-222, 229-251 and 256-273
529507014358	HMMPfam hit to PF01694, Rhomboid family, score 1.5e-29
529507014359	DNA-binding transcriptional repressor GlpR; Provisional; Region: PRK10906
529507014360	DeoR-like helix-turn-helix domain; Region: HTH_DeoR; pfam08220
529507014361	DeoR C terminal sensor domain; Region: DeoRC; pfam00455
529507014362	HMMPfam hit to PF00455, Bacterial regulatory proteins, deoR family, score 3.2e-113
529507014363	PS00894 Bacterial regulatory proteins, deoR family signature.
529507014364	glycerol-3-phosphate dehydrogenase; Reviewed; Region: glpD; PRK12266
529507014365	HMMPfam hit to PF01266, FAD dependent oxidoreductase, score 3.8e-68
529507014366	PS00977 FAD-dependent glycerol-3-phosphate dehydrogenase signature 1.
529507014367	Uncharacterized conserved protein [Function unknown]; Region: COG3189
529507014368	HMMPfam hit to PF04343, Protein of unknown function, DUF488, score 1.4e-41
529507014369	Methylenetetrahydrofolate reductase (MTHFR). 5,10-Methylenetetrahydrofolate is reduced to 5-methyltetrahydrofolate by methylenetetrahydrofolate reductase, a cytoplasmic, NAD(P)-dependent enzyme. 5-methyltetrahydrofolate is utilized by methionine synthase...; Region: MTHFR; cd00537
529507014370	FAD binding site [chemical binding]; other site
529507014371	HMMPfam hit to PF02219, Methylenetetrahydrofolate reductase, score 1.8e-158
529507014372	Domain of unknown function (DUF4291); Region: DUF4291; pfam14124
529507014373	Transcriptional regulators [Transcription]; Region: PurR; COG1609
529507014374	Helix-turn-helix (HTH) DNA binding domain of the LacI family of transcriptional regulators; Region: HTH_LacI; cd01392
529507014375	DNA binding site [nucleotide binding]
529507014376	domain linker motif; other site
529507014377	Type 1 periplasmic binding fold superfamily; Region: Periplasmic_Binding_Protein_Type_1; cl10011
529507014378	HMMPfam hit to PF00532, Periplasmic binding proteins and sugar b, score 0.0017
529507014379	Tripartite tricarboxylate transporter TctA family; Region: TctA; cl00772
529507014380	11 probable transmembrane helices predicted for PMI2935 by TMHMM2.0 at aa 7-29, 39-61, 68-90, 105-127, 134-156, 197-219, 323-345, 360-379, 391-413, 423-445 and 466-488
529507014381	HMMPfam hit to PF01970, Integral membrane protein DUF112, score 2.5e-173
529507014382	Tripartite tricarboxylate transporter TctB family; Region: TctB; pfam07331
529507014383	4 probable transmembrane helices predicted for PMI2936 by TMHMM2.0 at aa 7-24, 39-61, 82-115 and 120-142
529507014384	PS00038 Myc-type, 'helix-loop-helix' dimerization domain signature.
529507014385	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG3181
529507014386	HMMPfam hit to PF03401, Bordetella uptake gene (bug) product, score 2.7e-32
529507014387	Signal peptide predicted for PMI2937 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.999 between residues 28 and 29
529507014388	Predicted neuraminidase (sialidase) [Carbohydrate transport and metabolism]; Region: COG4692
529507014389	BNR repeat-like domain; Region: BNR_2; pfam13088
529507014390	HMMPfam hit to PF02012, BNR/Asp-box repeat, score 1.7
529507014391	HMMPfam hit to PF02012, BNR/Asp-box repeat, score 8.9
529507014392	HMMPfam hit to PF02012, BNR/Asp-box repeat, score 0.53
529507014393	Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane]; Region: DapA; COG0329
529507014394	Dihydrodipicolinate synthase family; Region: DHDPS-like; cd00408
529507014395	inhibitor site; inhibition site
529507014396	active site
529507014397	dimer interface [polypeptide binding]; other site
529507014398	catalytic residue [active]
529507014399	HMMPfam hit to PF00701, Dihydrodipicolinate synthetase family, score 4.2e-09
529507014400	L-fucose isomerase (FucIase) and L-arabinose isomerase (AI) family; composed of FucIase, AI and similar proteins. FucIase converts L-fucose, an aldohexose, to its ketose form, which prepares it for aldol cleavage (similar to the isomerization of glucose...; Region: L-fuc_L-ara-isomerases; cl00947
529507014401	hexamer (dimer of trimers) interface [polypeptide binding]; other site
529507014402	substrate binding site [chemical binding]; other site
529507014403	trimer interface [polypeptide binding]; other site
529507014404	Mn binding site [ion binding]; other site
529507014405	Ribulose kinase [Energy production and conversion]; Region: AraB; COG1069
529507014406	Yersinia Pseudotuberculosis carbohydrate kinase-like subgroup; belongs to the FGGY family of carbohydrate kinases; Region: FGGY_YpCarbK_like; cd07782
529507014407	N- and C-terminal domain interface [polypeptide binding]; other site
529507014408	active site
529507014409	MgATP binding site [chemical binding]; other site
529507014410	catalytic site [active]
529507014411	metal binding site [ion binding]; metal-binding site
529507014412	carbohydrate binding site [chemical binding]; other site
529507014413	putative homodimer interface [polypeptide binding]; other site
529507014414	HMMPfam hit to PF02782, FGGY family of carbohydrate kinases, C-termi, score 6.5e-10
529507014415	HMMPfam hit to PF00370, FGGY family of carbohydrate kinases, N-termi, score 2.9e-11
529507014416	Signal peptide predicted for PMI2942 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.994 between residues 20 and 21
529507014417	ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]; Region: DppF; COG1124
529507014418	ATP-binding cassette domain of nickel/oligopeptides specific transporters; Region: ABC_NikE_OppD_transporters; cd03257
529507014419	Walker A/P-loop; other site
529507014420	ATP binding site [chemical binding]; other site
529507014421	Q-loop/lid; other site
529507014422	ABC transporter signature motif; other site
529507014423	Walker B; other site
529507014424	D-loop; other site
529507014425	H-loop/switch region; other site
529507014426	HMMPfam hit to PF00005, ABC transporter, score 2.1e-48
529507014427	PS00211 ABC transporters family signature.
529507014428	PS00017 ATP/GTP-binding site motif A (P-loop).
529507014429	ATP-binding cassette domain of nickel/oligopeptides specific transporters; Region: ABC_NikE_OppD_transporters; cd03257
529507014430	nickel import ATP-binding protein NikD; Region: nickel_nikD; TIGR02770
529507014431	Walker A/P-loop; other site
529507014432	ATP binding site [chemical binding]; other site
529507014433	Q-loop/lid; other site
529507014434	ABC transporter signature motif; other site
529507014435	Walker B; other site
529507014436	D-loop; other site
529507014437	H-loop/switch region; other site
529507014438	HMMPfam hit to PF00005, ABC transporter, score 2.9e-47
529507014439	PS00211 ABC transporters family signature.
529507014440	PS00017 ATP/GTP-binding site motif A (P-loop).
529507014441	N-terminal TM domain of oligopeptide transport permease C; Region: OppC_N; pfam12911
529507014442	nickel ABC transporter, permease subunit NikC; Region: nickel_nikC; TIGR02790
529507014443	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
529507014444	dimer interface [polypeptide binding]; other site
529507014445	conserved gate region; other site
529507014446	putative PBP binding loops; other site
529507014447	ABC-ATPase subunit interface; other site
529507014448	HMMPfam hit to PF00528, Binding-protein-dependent transport syst, score 1.1e-37
529507014449	5 probable transmembrane helices predicted for PMI2945 by TMHMM2.0 at aa 15-37, 80-102, 126-148, 197-219 and 245-267
529507014450	PS00017 ATP/GTP-binding site motif A (P-loop).
529507014451	nickel ABC transporter, permease subunit NikB; Region: nickel_nikB; TIGR02789
529507014452	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
529507014453	dimer interface [polypeptide binding]; other site
529507014454	conserved gate region; other site
529507014455	putative PBP binding loops; other site
529507014456	ABC-ATPase subunit interface; other site
529507014457	HMMPfam hit to PF00528, Binding-protein-dependent transport syst, score 2.2e-51
529507014458	6 probable transmembrane helices predicted for PMI2946 by TMHMM2.0 at aa 12-34, 110-132, 145-167, 177-199, 237-259 and 283-305
529507014459	Signal peptide predicted for PMI2946 by SignalP 2.0 HMM (Signal peptide probability 0.930) with cleavage site probability 0.384 between residues 25 and 26
529507014460	ABC-type dipeptide transport system, periplasmic component [Amino acid transport and metabolism]; Region: DdpA; COG0747
529507014461	The substrate-binding component of an ABC-type nickel import system contains the type 2 periplasmic binding fold; Region: PBP2_NikA; cd08489
529507014462	substrate binding site [chemical binding]; other site
529507014463	HMMPfam hit to PF00496, Bacterial extracellular solute-binding prot, score 1.4e-72
529507014464	Signal peptide predicted for PMI2947 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.981 between residues 23 and 24
529507014465	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507014466	Methyltransferase domain; Region: Methyltransf_31; pfam13847
529507014467	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
529507014468	S-adenosylmethionine binding site [chemical binding]; other site
529507014469	HMMPfam hit to PF01209, ubiE/COQ5 methyltransferase family, score 2.8e-06
529507014470	1 probable transmembrane helix predicted for PMI2949 by TMHMM2.0 at aa 168-190
529507014471	Outer membrane protein beta-barrel domain; Region: OMP_b-brl; cl17254
529507014472	HMMPfam hit to PF06316, Enterobacterial Ail/Lom protein, score 2.1e-08
529507014473	Signal peptide predicted for PMI2950 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.992 between residues 22 and 23
529507014474	Enterococcus faecalis EF3048 and similar proteins; Region: YdjC_EF3048_like; cd10803
529507014475	putative active site [active]
529507014476	YdjC motif; other site
529507014477	Mg binding site [ion binding]; other site
529507014478	putative homodimer interface [polypeptide binding]; other site
529507014479	HMMPfam hit to PF04794, YdjC-like protein, score 9.1e-104
529507014480	Alpha-galactosidases/6-phospho-beta-glucosidases, family 4 of glycosyl hydrolases [Carbohydrate transport and metabolism]; Region: CelF; COG1486
529507014481	Glycoside Hydrolases Family 4; Phospho-beta-glucosidase; Region: GH4_P_beta_glucosidase; cd05296
529507014482	NAD binding site [chemical binding]; other site
529507014483	sugar binding site [chemical binding]; other site
529507014484	divalent metal binding site [ion binding]; other site
529507014485	tetramer (dimer of dimers) interface [polypeptide binding]; other site
529507014486	dimer interface [polypeptide binding]; other site
529507014487	HMMPfam hit to PF02056, Family 4 glycosyl hydrolase, score 1.6e-211
529507014488	PS01324 Glycosyl hydrolases family 4 signature.
529507014489	DNA-binding transcriptional regulator ChbR; Provisional; Region: PRK10296
529507014490	Cupin domain; Region: Cupin_2; pfam07883
529507014491	Bacterial regulatory helix-turn-helix proteins, AraC family; Region: HTH_AraC; pfam00165
529507014492	HMMPfam hit to PF00165, Bacterial regulatory helix-turn-helix protei, score 9e-13
529507014493	PS00041 Bacterial regulatory proteins, araC family signature.
529507014494	HMMPfam hit to PF00165, Bacterial regulatory helix-turn-helix protei, score 0.41
529507014495	HMMPfam hit to PF07883, Cupin domain, score 3e-07
529507014496	PTS_IIA, PTS system, lactose/cellobiose specific IIA subunit. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. This...; Region: PTS_IIA_lac; cd00215
529507014497	active site
529507014498	methionine cluster; other site
529507014499	phosphorylation site [posttranslational modification]
529507014500	metal binding site [ion binding]; metal-binding site
529507014501	HMMPfam hit to PF02255, PTS system, Lactose/Cellobiose specific IIA, score 7.3e-48
529507014502	PTS system N,N'-diacetylchitobiose-specific transporter subunit IIC; Provisional; Region: PRK10297
529507014503	cellobiose phosphotransferase system IIC component; Reviewed; Region: celD; PRK09592
529507014504	9 probable transmembrane helices predicted for PMI2955 by TMHMM2.0 at aa 40-62, 83-105, 115-137, 144-166, 186-208, 229-251, 297-319, 359-381 and 406-428
529507014505	HMMPfam hit to PF02378, Phosphotransferase system, EIIC, score 2.3e-80
529507014506	PS00017 ATP/GTP-binding site motif A (P-loop).
529507014507	PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme II (EII) of the N,N-diacetylchitobiose-specific and lichenan-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS). In these systems, EII is either a lichenan- or an N; Region: PTS_IIB_chitobiose_lichenan; cd05564
529507014508	active site
529507014509	P-loop; other site
529507014510	phosphorylation site [posttranslational modification]
529507014511	HMMPfam hit to PF02302, PTS system, Lactose/Cellobiose specific IIB, score 3.6e-27
529507014512	Signal peptide predicted for PMI2956 by SignalP 2.0 HMM (Signal peptide probability 0.832) with cleavage site probability 0.411 between residues 27 and 28
529507014513	ABC-type enterochelin transport system, periplasmic component [Inorganic ion transport and metabolism]; Region: CeuA; COG4607
529507014514	Siderophore binding protein FatB.  These proteins have been shown to function as ABC-type initial receptors in the siderophore-mediated iron uptake in some eubacterial species.  They belong to the TroA superfamily of periplasmic metal binding proteins...; Region: FatB; cd01140
529507014515	putative ligand binding residues [chemical binding]; other site
529507014516	Signal peptide predicted for PMI2957 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.982 between residues 24 and 25
529507014517	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507014518	HMMPfam hit to PF01497, Periplasmic binding protein, score 1.1e-48
529507014519	iron-hydroxamate transporter permease subunit; Provisional; Region: PRK10577
529507014520	Transmembrane subunit (TM), of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters involved in the uptake of siderophores, heme, vitamin B12, or the divalent cations Mg2+ and Zn2+. PBP-dependent ABC transporters consist of...; Region: TM_ABC_iron-siderophores_like; cd06550
529507014521	ABC-ATPase subunit  interface; other site
529507014522	dimer interface [polypeptide binding]; other site
529507014523	putative PBP binding regions; other site
529507014524	Signal peptide predicted for PMI2958 by SignalP 2.0 HMM (Signal peptide probability 0.998) with cleavage site probability 0.915 between residues 25 and 26
529507014525	9 probable transmembrane helices predicted for PMI2958 by TMHMM2.0 at aa 7-29, 49-71, 83-105, 109-131, 136-158, 185-207, 228-250, 265-287 and 294-312
529507014526	HMMPfam hit to PF01032, FecCD transport family, score 1.3e-37
529507014527	Transmembrane subunit (TM), of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters involved in the uptake of siderophores, heme, vitamin B12, or the divalent cations Mg2+ and Zn2+. PBP-dependent ABC transporters consist of...; Region: TM_ABC_iron-siderophores_like; cd06550
529507014528	ABC-ATPase subunit  interface; other site
529507014529	dimer interface [polypeptide binding]; other site
529507014530	putative PBP binding regions; other site
529507014531	Signal peptide predicted for PMI2959 by SignalP 2.0 HMM (Signal peptide probability 0.785) with cleavage site probability 0.334 between residues 50 and 51
529507014532	9 probable transmembrane helices predicted for PMI2959 by TMHMM2.0 at aa 29-46, 61-83, 88-110, 125-144, 151-173, 193-215, 244-266, 286-308 and 315-332
529507014533	HMMPfam hit to PF01032, FecCD transport family, score 5.8e-14
529507014534	PS00211 ABC transporters family signature.
529507014535	ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism]; Region: CeuD; COG4604
529507014536	ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins; Region: ABC_Iron-Siderophores_B12_Hemin; cd03214
529507014537	Walker A/P-loop; other site
529507014538	ATP binding site [chemical binding]; other site
529507014539	Q-loop/lid; other site
529507014540	ABC transporter signature motif; other site
529507014541	Walker B; other site
529507014542	D-loop; other site
529507014543	H-loop/switch region; other site
529507014544	HMMPfam hit to PF00005, ABC transporter, score 2.7e-50
529507014545	PS00017 ATP/GTP-binding site motif A (P-loop).
529507014546	PS00017 ATP/GTP-binding site motif A (P-loop).
529507014547	Transcriptional regulator [Transcription]; Region: AcrR; COG1309
529507014548	Bacterial regulatory proteins, tetR family; Region: TetR_N; pfam00440
529507014549	HMMPfam hit to PF00440, Bacterial regulatory proteins, tetR family, score 3.8e-08
529507014550	methyl viologen resistance protein SmvA; Provisional; Region: PRK14995
529507014551	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507014552	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507014553	Signal peptide predicted for PMI2962 by SignalP 2.0 HMM (Signal peptide probability 0.853) with cleavage site probability 0.363 between residues 30 and 31
529507014554	14 probable transmembrane helices predicted for PMI2962 by TMHMM2.0 at aa 9-31, 46-68, 75-97, 101-123, 136-158, 163-185, 198-215, 225-242, 263-285, 300-322, 327-349, 359-381, 394-416 and 466-488
529507014555	PS00043 Bacterial regulatory proteins, gntR family signature.
529507014556	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 1.1e-51
529507014557	Cupin domain; Region: Cupin_2; cl17218
529507014558	Helix-turn-helix domain; Region: HTH_18; pfam12833
529507014559	Bacterial regulatory helix-turn-helix proteins, AraC family; Region: HTH_AraC; pfam00165
529507014560	HMMPfam hit to PF00165, Bacterial regulatory helix-turn-helix protei, score 3.7e-07
529507014561	HMMPfam hit to PF00165, Bacterial regulatory helix-turn-helix protei, score 0.38
529507014562	anaerobic dimethyl sulfoxide reductase, A subunit, DmsA/YnfE family; Region: dmsA_ynfE; TIGR02166
529507014563	This CD (MopB_DmsA-EC) includes the DmsA enzyme of the dmsABC operon encoding the anaerobic dimethylsulfoxide reductase (DMSOR) of Escherichia coli and other related DMSOR-like enzymes. Unlike other DMSOR-like enzymes, this group has a  predicted...; Region: MopB_DmsA-EC; cd02770
529507014564	putative [Fe4-S4] binding site [ion binding]; other site
529507014565	putative molybdopterin cofactor binding site [chemical binding]; other site
529507014566	The MopB_CT_DmsA-EC CD includes the DmsA enzyme of the dmsABC operon encoding the anaerobic dimethylsulfoxide reductase (DMSOR) of Escherichia coli and other related DMSOR-like enzymes. Unlike other DMSOR-like enzymes, this group has a  predicted...; Region: MopB_CT_DmsA-EC; cd02794
529507014567	putative molybdopterin cofactor binding site; other site
529507014568	Signal peptide predicted for PMI2964 by SignalP 2.0 HMM (Signal peptide probability 0.998) with cleavage site probability 0.997 between residues 41 and 42
529507014569	HMMPfam hit to PF04879, Molybdopterin oxidoreductase Fe4S4 do, score 2.7e-08
529507014570	HMMPfam hit to PF00384, Molybdopterin oxidoreductase, score 2.8e-84
529507014571	PS00490 Prokaryotic molybdopterin oxidoreductases signature 2.
529507014572	HMMPfam hit to PF01568, Molydopterin dinucleotide binding dom, score 2.1e-29
529507014573	DMSO reductase, iron-sulfur subunit; Region: DMSO_dmsB; TIGR02951
529507014574	4Fe-4S binding domain; Region: Fer4; pfam00037
529507014575	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 0.012
529507014576	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507014577	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 7.5e-09
529507014578	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
529507014579	PS00215 Mitochondrial energy transfer proteins signature.
529507014580	DMSO reductase anchor subunit (DmsC); Region: DmsC; cl17519
529507014581	7 probable transmembrane helices predicted for PMI2966 by TMHMM2.0 at aa 5-27, 40-62, 82-104, 111-133, 148-166, 244-266 and 276-298
529507014582	Transcriptional regulators [Transcription]; Region: PurR; COG1609
529507014583	Helix-turn-helix (HTH) DNA binding domain of the LacI family of transcriptional regulators; Region: HTH_LacI; cd01392
529507014584	DNA binding site [nucleotide binding]
529507014585	domain linker motif; other site
529507014586	ABC-type sugar transport system, periplasmic component [Carbohydrate transport and metabolism]; Region: UgpB; COG1653
529507014587	HMMPfam hit to PF00356, Bacterial regulatory proteins, lacI family, score 4.9e-10
529507014588	PS00356 Bacterial regulatory proteins, lacI family signature.
529507014589	Metallo-beta-lactamase superfamily; Region: Lactamase_B; cl00446
529507014590	putative hydrolase; Provisional; Region: PRK02113
529507014591	nucleoside transporter; Region: 2A0110; TIGR00889
529507014592	Signal peptide predicted for PMI2969 by SignalP 2.0 HMM (Signal peptide probability 0.722) with cleavage site probability 0.419 between residues 45 and 46
529507014593	HMMPfam hit to PF03825, Nucleoside H+ symporter, score 7.2e-66
529507014594	12 probable transmembrane helices predicted for PMI2969 by TMHMM2.0 at aa 7-29, 39-61, 73-92, 97-119, 126-148, 158-177, 207-229, 244-263, 270-292, 296-313, 334-356 and 371-393
529507014595	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 0.00019
529507014596	Uncharacterized membrane protein [Function unknown]; Region: SapB; COG1285
529507014597	MgtC family; Region: MgtC; pfam02308
529507014598	4 probable transmembrane helices predicted for PMI2970 by TMHMM2.0 at aa 10-32, 44-66, 81-100 and 113-135
529507014599	HMMPfam hit to PF02308, MgtC family, score 4e-57
529507014600	Predicted acyltransferases [Lipid metabolism]; Region: COG1835
529507014601	11 probable transmembrane helices predicted for PMI2971 by TMHMM2.0 at aa 9-25, 35-57, 77-94, 134-156, 169-186, 196-218, 223-240, 244-266, 279-301, 316-333 and 346-365
529507014602	HMMPfam hit to PF01757, Acyltransferase family, score 1.9e-53
529507014603	Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane]; Region: DapA; COG0329
529507014604	Class I aldolases; Region: Aldolase_Class_I; cl17187
529507014605	catalytic residue [active]
529507014606	HMMPfam hit to PF00701, Dihydrodipicolinate synthetase family, score 1.7e-17
529507014607	Signal peptide predicted for PMI2973 by SignalP 2.0 HMM (Signal peptide probability 0.794) with cleavage site probability 0.733 between residues 16 and 17
529507014608	Transcriptional regulators [Transcription]; Region: RpiR; COG1737
529507014609	Helix-turn-helix domain, rpiR family; Region: HTH_6; pfam01418
529507014610	RpiR-like protein. RpiR contains a SIS (Sugar ISomerase) domain, which is found in many phosphosugar isomerases and phosphosugar binding proteins. In E. coli, rpiR negatively regulates the expression of rpiB gene. Both rpiB and rpiA are ribose phosphate...; Region: SIS_RpiR; cd05013
529507014611	putative active site [active]
529507014612	HMMPfam hit to PF01380, SIS domain, score 1.4e-24
529507014613	HMMPfam hit to PF01418, Helix-turn-helix domain, rpiR family, score 1.1e-31
529507014614	Beta-galactosidase, beta subunit [Carbohydrate transport and metabolism]; Region: EbgC; COG2731
529507014615	HMMPfam hit to PF04074, Domain of unknown function (DUF386), score 2.6e-58
529507014616	uncharacterized subgroup of the Na(+)/iodide (NIS) cotransporter subfamily; putative solute-binding domain; Region: SLC5sbd_NIS-like_u3; cd11495
529507014617	Na binding site [ion binding]; other site
529507014618	13 probable transmembrane helices predicted for PMI2976 by TMHMM2.0 at aa 6-28, 41-63, 78-100, 121-143, 158-180, 187-209, 229-248, 278-300, 315-337, 379-396, 406-428, 435-454 and 458-480
529507014619	HMMPfam hit to PF00474, Sodium:solute symporter family, score 4.4e-10
529507014620	N-acetylmannosamine kinase; Provisional; Region: PRK05082
529507014621	Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily; Region: NBD_sugar-kinase_HSP70_actin; cd00012
529507014622	nucleotide binding site [chemical binding]; other site
529507014623	HMMPfam hit to PF00480, ROK family, score 8.1e-65
529507014624	PS01125 ROK family signature.
529507014625	Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism]; Region: NanE; COG3010
529507014626	N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate. This reaction is part of the pathway that allows the usage of sialic acid as a carbohydrate source. Sialic acids are a family of...; Region: NanE; cd04729
529507014627	putative active site cavity [active]
529507014628	HMMPfam hit to PF04131, N-acetylmannosamine-6-phosphate epi, score 1.8e-120
529507014629	formate dehydrogenase, alpha subunit, archaeal-type; Region: Fdh-alpha; TIGR01591
529507014630	Formate dehydrogenase H (Formate-Dh-H) catalyzes the reversible oxidation of formate to CO2 with the release of a proton and two electrons. It is a component of the anaerobic formate hydrogen lyase complex. The E. coli formate dehydrogenase H (Fdh-H) is...; Region: MopB_Formate-Dh-H; cd02753
529507014631	[4Fe-4S] binding site [ion binding]; other site
529507014632	molybdopterin cofactor binding site; other site
529507014633	Formate dehydrogenase H (Formate-Dh-H) catalyzes the reversible oxidation of formate to CO2 with the release of a proton and two electrons. It is a component of the anaerobic formate hydrogen lyase complex. The E. coli formate dehydrogenase H (Fdh-H) is...; Region: MopB_CT_Formate-Dh_H; cd02790
529507014634	molybdopterin cofactor binding site; other site
529507014635	HMMPfam hit to PF01568, Molydopterin dinucleotide binding dom, score 6.6e-24
529507014636	HMMPfam hit to PF00384, Molybdopterin oxidoreductase, score 5.1e-135
529507014637	PS00490 Prokaryotic molybdopterin oxidoreductases signature 2.
529507014638	HMMPfam hit to PF04879, Molybdopterin oxidoreductase Fe4S4 do, score 3.8e-15
529507014639	solute carrier 6 subfamily, Fusobacterium nucleatum Tyt1-like; solute-binding domain; Region: SLC6sbd_Tyt1-Like; cd10336
529507014640	Na2 binding site [ion binding]; other site
529507014641	putative substrate binding site 1 [chemical binding]; other site
529507014642	Na binding site 1 [ion binding]; other site
529507014643	putative substrate binding site 2 [chemical binding]; other site
529507014644	Signal peptide predicted for PMI2980 by SignalP 2.0 HMM (Signal peptide probability 0.620) with cleavage site probability 0.445 between residues 33 and 34
529507014645	HMMPfam hit to PF00209, Sodium:neurotransmitter symporter family, score 2.4e-12
529507014646	11 probable transmembrane helices predicted for PMI2980 by TMHMM2.0 at aa 7-26, 36-58, 82-104, 138-160, 167-189, 215-237, 250-272, 287-309, 338-360, 375-397 and 418-437
529507014647	prokaryotic 3-carboxy-cis,cis-muconate cycloisomerase (CMLE)_like; Region: pCLME; cd01597
529507014648	Adenylosuccinate lyase [Nucleotide transport and metabolism]; Region: PurB; COG0015
529507014649	tetramer interface [polypeptide binding]; other site
529507014650	active site
529507014651	HMMPfam hit to PF00206, Lyase, score 3.5e-09
529507014652	PS00163 Fumarate lyases signature.
529507014653	Phosphotransferase system IIC components, glucose/maltose/N-acetylglucosamine-specific [Carbohydrate transport and metabolism]; Region: PtsG; COG1263
529507014654	PTS system, maltose and glucose-specific IIBC component; Region: PTS-IIBC-malX; TIGR02004
529507014655	PTS_IIB, PTS system, glucose/sucrose specific IIB subunit. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. This family...; Region: PTS_IIB_glc; cd00212
529507014656	active site turn [active]
529507014657	phosphorylation site [posttranslational modification]
529507014658	HMMPfam hit to PF00367, phosphotransferase system, EIIB, score 7.6e-10
529507014659	10 probable transmembrane helices predicted for PMI2982 by TMHMM2.0 at aa 15-37, 58-80, 90-112, 132-154, 176-198, 205-227, 286-308, 321-343, 348-370 and 391-413
529507014660	HMMPfam hit to PF02378, Phosphotransferase system, EIIC, score 6.1e-43
529507014661	Signal peptide predicted for PMI2982 by SignalP 2.0 HMM (Signal peptide probability 0.893) with cleavage site probability 0.370 between residues 38 and 39
529507014662	Helix-turn-helix domain, rpiR family; Region: HTH_6; pfam01418
529507014663	transcriptional regulator MurR; Provisional; Region: PRK15482
529507014664	RpiR-like protein. RpiR contains a SIS (Sugar ISomerase) domain, which is found in many phosphosugar isomerases and phosphosugar binding proteins. In E. coli, rpiR negatively regulates the expression of rpiB gene. Both rpiB and rpiA are ribose phosphate...; Region: SIS_RpiR; cd05013
529507014665	putative active site [active]
529507014666	HMMPfam hit to PF01380, SIS domain, score 7.2e-15
529507014667	Cold-Shock Protein (CSP) contains an S1-like cold-shock domain (CSD) that is found in eukaryotes, prokaryotes, and archaea.  CSP's include the major cold-shock proteins CspA and CspB in bacteria and the eukaryotic gene regulatory factor Y-box...; Region: CSP_CDS; cd04458
529507014668	DNA-binding site [nucleotide binding]; DNA binding site
529507014669	RNA-binding motif; other site
529507014670	HMMPfam hit to PF00313, 'Cold-shock' DNA-binding domain, score 3.4e-05
529507014671	Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis]; Region: RluA; COG0564
529507014672	Pseudouridine synthase, RsuA/RluD family; Region: PseudoU_synth_RluCD_like; cd02869
529507014673	active site
529507014674	HMMPfam hit to PF00849, RNA pseudouridylate synthase, score 1.2e-40
529507014675	PS01129 Rlu family of pseudouridine synthase signature.
529507014676	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG3122
529507014677	HNH nucleases; HNH endonuclease signature which is found in viral, prokaryotic, and eukaryotic proteins. The alignment includes members of the large group of homing endonucleases, yeast intron 1 protein, MutS, as well as bacterial colicins, pyocins, and...; Region: HNHc; cd00085
529507014678	active site
529507014679	HMMPfam hit to PF01844, HNH endonuclease, score 9.7e-07
529507014680	PS00190 Cytochrome c family heme-binding site signature.
529507014681	Transposase and inactivated derivatives [DNA replication, recombination, and repair]; Region: COG0675
529507014682	Helix-turn-helix domain; Region: HTH_OrfB_IS605; pfam12323
529507014683	Probable transposase; Region: OrfB_IS605; pfam01385
529507014684	transposase, IS605 OrfB family, central region; Region: tspaseT_teng_C; TIGR01766
529507014685	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507014686	HMMPfam hit to PF07282, transposase DNA-binding domai, score 5.8e-35
529507014687	HMMPfam hit to PF01385, Probable transposase, score 1.7e-117
529507014688	Transposase IS200 like; Region: Y1_Tnp; pfam01797
529507014689	HMMPfam hit to PF01797, Transposase IS200 like, score 4.4e-43
529507014690	type VI secretion system effector, Hcp1 family; Region: VI_effect_Hcp1; TIGR03344
529507014691	HMMPfam hit to PF05638, Protein of unknown function (DUF796), score 1.9e-87
529507014692	type VI secretion system Vgr family protein; Region: VI_Rhs_Vgr; TIGR03361
529507014693	Phage late control gene D protein (GPD); Region: Phage_GPD; pfam05954
529507014694	Phage-related baseplate assembly protein; Region: Phage_base_V; pfam04717
529507014695	HMMPfam hit to PF04524, Protein of unknown function, DUF586, score 1.1e-38
529507014696	Domain of unknown function (DUF4123); Region: DUF4123; pfam13503
529507014697	2 probable transmembrane helices predicted for PMI2993 by TMHMM2.0 at aa 693-710 and 781-803
529507014698	2 probable transmembrane helices predicted for PMI2994 by TMHMM2.0 at aa 58-80 and 153-175
529507014699	PS00017 ATP/GTP-binding site motif A (P-loop).
529507014700	PAAR motif; Region: PAAR_motif; pfam05488
529507014701	HMMPfam hit to PF05488, PAAR motif, score 0.99
529507014702	HMMPfam hit to PF05488, PAAR motif, score 7.4e-05
529507014703	Signal peptide predicted for PMI2996 by SignalP 2.0 HMM (Signal peptide probability 0.983) with cleavage site probability 0.963 between residues 32 and 33
529507014704	fimbrial operon 14
529507014705	1 probable transmembrane helix predicted for PMI2997 by TMHMM2.0 at aa 5-27
529507014706	Signal peptide predicted for PMI2997 by SignalP 2.0 HMM (Signal peptide probability 0.978) with cleavage site probability 0.730 between residues 24 and 25
529507014707	Signal peptide predicted for PMI2998 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.997 between residues 25 and 26
529507014708	This CDS appears to have a frameshift mutation around codon 106. The frameshift occurs within a (A)7 polymeric tract; fimbrial outer membrane usher protein (pseudogene)
529507014709	PS00163 Fumarate lyases signature.
529507014710	Signal peptide predicted for PMI3000 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.980 between residues 21 and 22
529507014711	Signal peptide predicted for PMI3001 by SignalP 2.0 HMM (Signal peptide probability 0.978) with cleavage site probability 0.642 between residues 21 and 22
529507014712	Signal peptide predicted for PMI3002 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.708 between residues 25 and 26
529507014713	Predicted transcriptional regulators [Transcription]; Region: HipB; COG1396
529507014714	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
529507014715	non-specific DNA binding site [nucleotide binding]; other site
529507014716	salt bridge; other site
529507014717	sequence-specific DNA binding site [nucleotide binding]; other site
529507014718	HMMPfam hit to PF01381, Helix-turn-helix, score 2.1e-11
529507014719	Virulence protein [General function prediction only]; Region: COG3943
529507014720	Virulence protein RhuM family; Region: Virulence_RhuM; pfam13310
529507014721	oligopeptidase A; Provisional; Region: PRK10911
529507014722	Peptidase family M3 dipeptidyl carboxypeptidase (DCP); Region: M3A_DCP; cd06456
529507014723	active site
529507014724	Zn binding site [ion binding]; other site
529507014725	HMMPfam hit to PF01432, Peptidase family M3, score 9.7e-229
529507014726	PS00142 Neutral zinc metallopeptidases, zinc-binding region signature.
529507014727	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
529507014728	S-adenosylmethionine binding site [chemical binding]; other site
529507014729	HMMPfam hit to PF04445, Protein of unknown function (DUF548), score 2.5e-162
529507014730	short chain dehydrogenase; Provisional; Region: PRK06841
529507014731	classical (c) SDRs; Region: SDR_c; cd05233
529507014732	NAD(P) binding site [chemical binding]; other site
529507014733	active site
529507014734	HMMPfam hit to PF00106, short chain dehydrogenase, score 7.5e-78
529507014735	PS00061 Short-chain dehydrogenases/reductases family signature.
529507014736	1 probable transmembrane helix predicted for PMI3007 by TMHMM2.0 at aa 13-32
529507014737	glutamate dehydrogenase; Provisional; Region: PRK09414
529507014738	Glu/Leu/Phe/Val dehydrogenase, dimerisation domain; Region: ELFV_dehydrog_N; pfam02812
529507014739	NAD(P) binding domain of glutamate dehydrogenase, subgroup 2; Region: NAD_bind_2_Glu_DH; cd05313
529507014740	NAD(P) binding site [chemical binding]; other site
529507014741	HMMPfam hit to PF00208, Glutamate/Leucine/Phenylalanine/Valin, score 1.4e-134
529507014742	HMMPfam hit to PF02812, Glu/Leu/Phe/Val dehydrogenase, dimeri, score 1.9e-83
529507014743	PS00074 Glu / Leu / Phe / Val dehydrogenases active site.
529507014744	Usp: Universal stress protein family. The universal stress protein Usp is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. Usp enhances the rate of cell survival during prolonged exposure to...; Region: USP_Like; cd00293
529507014745	Ligand Binding Site [chemical binding]; other site
529507014746	HMMPfam hit to PF00582, Universal stress protein family, score 5.6e-17
529507014747	universal stress protein UspB; Provisional; Region: PRK04960
529507014748	2 probable transmembrane helices predicted for PMI3010 by TMHMM2.0 at aa 5-24 and 90-109
529507014749	Phosphate/sulphate permeases [Inorganic ion transport and metabolism]; Region: PitA; COG0306
529507014750	Phosphate/sulphate permeases [Inorganic ion transport and metabolism]; Region: PitA; COG0306
529507014751	10 probable transmembrane helices predicted for PMI3011 by TMHMM2.0 at aa 23-45, 65-87, 107-129, 136-158, 168-190, 220-237, 247-269, 393-412, 427-449 and 483-505
529507014752	HMMPfam hit to PF01384, Phosphate transporter family, score 1.4e-105
529507014753	Predicted flavoproteins [General function prediction only]; Region: COG2081
529507014754	NAD(P)-binding Rossmann-like domain; Region: NAD_binding_8; cl17500
529507014755	Signal peptide predicted for PMI3012 by SignalP 2.0 HMM (Signal peptide probability 0.969) with cleavage site probability 0.500 between residues 25 and 26
529507014756	1 probable transmembrane helix predicted for PMI3012 by TMHMM2.0 at aa 10-32
529507014757	HMMPfam hit to PF03486, HI0933-like protein, score 7e-180
529507014758	2 probable transmembrane helices predicted for PMI3013 by TMHMM2.0 at aa 21-41 and 56-78
529507014759	Pirin-related protein [General function prediction only]; Region: COG1741
529507014760	Pirin; Region: Pirin; pfam02678
529507014761	HMMPfam hit to PF02678, Pirin, score 3.1e-61
529507014762	HMMPfam hit to PF07883, Cupin domain, score 0.0021
529507014763	Phosphoenolpyruvate carboxykinase; Region: PEPCK_ATP; pfam01293
529507014764	Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis. It catalyzes the reversible decarboxylation and...; Region: PEPCK_ATP; cd00484
529507014765	active site
529507014766	substrate-binding site [chemical binding]; other site
529507014767	metal-binding site [ion binding]
529507014768	ATP binding site [chemical binding]; other site
529507014769	HMMPfam hit to PF01293, Phosphoenolpyruvate carboxykinase, score 0
529507014770	PS00532 Phosphoenolpyruvate carboxykinase (ATP) signature.
529507014771	PS00017 ATP/GTP-binding site motif A (P-loop).
529507014772	Hsp33-like chaperonin; Reviewed; Region: hslO; PRK00114
529507014773	Heat shock protein 33 (Hsp33):  Cytosolic protein that acts as a molecular chaperone under oxidative conditions.  In normal (reducing) cytosolic conditions, four conserved Cys residues are coordinated by a Zn ion. Under oxidative stress (such as heat...; Region: Hsp33; cd00498
529507014774	dimerization interface [polypeptide binding]; other site
529507014775	domain crossover interface; other site
529507014776	redox-dependent activation switch; other site
529507014777	HMMPfam hit to PF01430, Hsp33 protein, score 3.2e-119
529507014778	S4/Hsp/ tRNA synthetase RNA-binding domain; The domain surface is populated by conserved, charged residues that define a likely RNA-binding site;  Found in stress proteins, ribosomal proteins and tRNA synthetases; This may imply a hitherto unrecognized...; Region: S4; cd00165
529507014779	RNA binding surface [nucleotide binding]; other site
529507014780	HMMPfam hit to PF01479, S4 domain, score 1.3e-12
529507014781	Intracellular growth attenuator protein IgaA; Region: IgaA; pfam07095
529507014782	HMMPfam hit to PF07095, Intracellular growth attenuator protein IgaA, score 0
529507014783	5 probable transmembrane helices predicted for PMI3018 by TMHMM2.0 at aa 5-24, 203-222, 226-248, 342-364 and 654-676
529507014784	Signal peptide predicted for PMI3018 by SignalP 2.0 HMM (Signal peptide probability 0.977) with cleavage site probability 0.776 between residues 19 and 20
529507014785	adenosine nucleotide hydrolase NudE; Provisional; Region: nudE; PRK11762
529507014786	ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate. Like other members of the Nudix hydrolase superfamily, it requires a divalent cation, such as Mg2+; Region: ADPRase_NUDT5; cd03424
529507014787	ADP-ribose binding site [chemical binding]; other site
529507014788	dimer interface [polypeptide binding]; other site
529507014789	active site
529507014790	nudix motif; other site
529507014791	metal binding site [ion binding]; metal-binding site
529507014792	HMMPfam hit to PF00293, NUDIX domain, score 6.2e-12
529507014793	PS00893 mutT domain signature.
529507014794	ABC-type metal ion transport system, periplasmic component/surface antigen [Inorganic ion transport and metabolism]; Region: NlpA; COG1464
529507014795	NLPA lipoprotein; Region: Lipoprotein_9; pfam03180
529507014796	HMMPfam hit to PF03180, NLPA lipoprotein, score 2.2e-109
529507014797	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507014798	Signal peptide predicted for PMI3020 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.971 between residues 19 and 20
529507014799	penicillin-binding protein 1a; Provisional; Region: mrcA; PRK11636
529507014800	Transglycosylase; Region: Transgly; pfam00912
529507014801	Penicillin binding protein transpeptidase domain; Region: Transpeptidase; cl17760
529507014802	HMMPfam hit to PF00905, Penicillin binding protein transpeptid, score 4.3e-25
529507014803	HMMPfam hit to PF00912, Transglycosylase, score 1.5e-89
529507014804	PS00017 ATP/GTP-binding site motif A (P-loop).
529507014805	1 probable transmembrane helix predicted for PMI3021 by TMHMM2.0 at aa 7-26
529507014806	Signal peptide predicted for PMI3021 by SignalP 2.0 HMM (Signal peptide probability 0.929) with cleavage site probability 0.328 between residues 24 and 25
529507014807	HMMPfam hit to PF05137, Fimbrial assembly protein (PilN), score 0.0024
529507014808	1 probable transmembrane helix predicted for PMI3023 by TMHMM2.0 at aa 21-43
529507014809	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507014810	Signal peptide predicted for PMI3024 by SignalP 2.0 HMM (Signal peptide probability 0.993) with cleavage site probability 0.953 between residues 43 and 44
529507014811	1 probable transmembrane helix predicted for PMI3024 by TMHMM2.0 at aa 7-29
529507014812	Bacterial type II/III secretion system short domain; Region: Secretin_N; pfam03958
529507014813	pilus (MSHA type) biogenesis protein MshL; Region: pilus_MshL; TIGR02519
529507014814	Bacterial type II and III secretion system protein; Region: Secretin; pfam00263
529507014815	Signal peptide predicted for PMI3025 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.771 between residues 23 and 24
529507014816	HMMPfam hit to PF00263, Bacterial type II and III secretion system p, score 3.4e-54
529507014817	PS00875 Bacterial type II secretion system protein D signature.
529507014818	shikimate kinase; Reviewed; Region: aroK; PRK00131
529507014819	Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants. Chorismic acid is a important intermediate in the synthesis...; Region: SK; cd00464
529507014820	ADP binding site [chemical binding]; other site
529507014821	magnesium binding site [ion binding]; other site
529507014822	putative shikimate binding site; other site
529507014823	PS00017 ATP/GTP-binding site motif A (P-loop).
529507014824	HMMPfam hit to PF01202, Shikimate kinase, score 8.2e-79
529507014825	PS01128 Shikimate kinase signature.
529507014826	Dehydroquinate synthase (DHQS) catalyzes the conversion of DAHP to DHQ in shikimate pathway for aromatic compounds synthesis; Region: DHQS; cd08195
529507014827	Glycerol dehydrogenase and related enzymes [Energy production and conversion]; Region: GldA; COG0371
529507014828	active site
529507014829	dimer interface [polypeptide binding]; other site
529507014830	metal binding site [ion binding]; metal-binding site
529507014831	HMMPfam hit to PF01761, 3-dehydroquinate synthase, score 4e-182
529507014832	hypothetical protein; Reviewed; Region: PRK11901
529507014833	cell division protein DamX; Validated; Region: PRK10905
529507014834	1 probable transmembrane helix predicted for PMI3028 by TMHMM2.0 at aa 50-69
529507014835	DNA adenine methylase; Provisional; Region: PRK10904
529507014836	HMMPfam hit to PF02086, D12 class N6 adenine-specific DNA met, score 5.2e-93
529507014837	PS00092 N-6 Adenine-specific DNA methylases signature.
529507014838	Ribulose-5-phosphate 3-epimerase (RPE). This enzyme catalyses the interconversion of D-ribulose 5-phosphate (Ru5P) into D-xylulose 5-phosphate, as part of the Calvin cycle (reductive pentose phosphate pathway) in chloroplasts and in the oxidative pentose...; Region: RPE; cd00429
529507014839	ribulose-phosphate 3-epimerase; Region: rpe; TIGR01163
529507014840	substrate binding site [chemical binding]; other site
529507014841	hexamer interface [polypeptide binding]; other site
529507014842	metal binding site [ion binding]; metal-binding site
529507014843	HMMPfam hit to PF00834, Ribulose-phosphate 3 epimerase family, score 2.3e-139
529507014844	PS01085 Ribulose-phosphate 3-epimerase family signature 1.
529507014845	PS01086 Ribulose-phosphate 3-epimerase family signature 2.
529507014846	phosphoglycolate phosphatase; Provisional; Region: PRK13222
529507014847	Haloacid dehalogenase-like hydrolases. The haloacid dehalogenase-like (HAD) superfamily includes L-2-haloacid dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, and many others; Region: HAD_like; cd01427
529507014848	motif II; other site
529507014849	HMMPfam hit to PF00702, haloacid dehalogenase-like hydrolase, score 3e-34
529507014850	tryptophanyl-tRNA synthetase II; Reviewed; Region: PRK12282
529507014851	catalytic core domain of tryptophanyl-tRNA synthetase; Region: TrpRS_core; cd00806
529507014852	active site
529507014853	HIGH motif; other site
529507014854	dimer interface [polypeptide binding]; other site
529507014855	KMSKS motif; other site
529507014856	HMMPfam hit to PF00579, tRNA synthetases class I (W and Y), score 1.6e-119
529507014857	PS00178 Aminoacyl-transfer RNA synthetases class-I signature.
529507014858	Helix-turn-helix domain; Region: HTH_OrfB_IS605; pfam12323
529507014859	Transposase and inactivated derivatives [DNA replication, recombination, and repair]; Region: COG0675
529507014860	Probable transposase; Region: OrfB_IS605; pfam01385
529507014861	transposase, IS605 OrfB family, central region; Region: tspaseT_teng_C; TIGR01766
529507014862	HMMPfam hit to PF07282, transposase DNA-binding domai, score 2.8e-34
529507014863	HMMPfam hit to PF01385, Probable transposase, score 1.7e-131
529507014864	Transposase IS200 like; Region: Y1_Tnp; pfam01797
529507014865	HMMPfam hit to PF01797, Transposase IS200 like, score 4.4e-43
529507014866	6-N-hydroxylaminopurine resistance protein; Provisional; Region: PRK11536
529507014867	MOSC domain; Region: MOSC; pfam03473
529507014868	3-alpha domain; Region: 3-alpha; pfam03475
529507014869	HMMPfam hit to PF03475, 3-alpha domain, score 3.4e-10
529507014870	HMMPfam hit to PF03473, MOSC domain, score 8e-42
529507014871	superoxide dismutase; Provisional; Region: PRK10925
529507014872	Iron/manganese superoxide dismutases, alpha-hairpin domain; Region: Sod_Fe_N; pfam00081
529507014873	Iron/manganese superoxide dismutases, C-terminal domain; Region: Sod_Fe_C; pfam02777
529507014874	HMMPfam hit to PF02777, Iron/manganese superoxide dismutases, C-term, score 2e-69
529507014875	PS00088 Manganese and iron superoxide dismutases signature.
529507014876	HMMPfam hit to PF00081, Iron/manganese superoxide dismutases, alpha-, score 4.2e-49
529507014877	acetyl-CoA synthetase; Provisional; Region: PRK00174
529507014878	Acetyl-CoA synthetase (also known as acetate-CoA ligase and acetyl-activating enzyme); Region: ACS; cd05966
529507014879	active site
529507014880	CoA binding site [chemical binding]; other site
529507014881	acyl-activating enzyme (AAE) consensus motif; other site
529507014882	AMP binding site [chemical binding]; other site
529507014883	acetate binding site [chemical binding]; other site
529507014884	HMMPfam hit to PF00501, AMP-binding enzyme, score 1.7e-138
529507014885	PS00455 AMP-binding domain signature.
529507014886	Predicted membrane protein [Function unknown]; Region: COG3162
529507014887	HMMPfam hit to PF04341, Protein of unknown function, DUF485, score 2.2e-47
529507014888	2 probable transmembrane helices predicted for PMI3038 by TMHMM2.0 at aa 25-47 and 62-84
529507014889	Predicted symporter [General function prediction only]; Region: DhlC; COG4147
529507014890	Uncharacterized bacterial solute carrier 5 subfamily; putative solute-binding domain; Region: SLC5sbd_u4; cd11480
529507014891	Na binding site [ion binding]; other site
529507014892	Signal peptide predicted for PMI3039 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.975 between residues 20 and 21
529507014893	14 probable transmembrane helices predicted for PMI3039 by TMHMM2.0 at aa 7-24, 34-56, 77-99, 104-126, 147-169, 179-201, 206-228, 265-287, 300-322, 363-385, 406-425, 430-452, 464-486 and 496-518
529507014894	HMMPfam hit to PF00474, Sodium:solute symporter family, score 2.4e-169
529507014895	PS00456 Sodium:solute symporter family signature 1.
529507014896	Predicted membrane-associated, metal-dependent hydrolase [General function prediction only]; Region: COG2194
529507014897	Sulfatase; Region: Sulfatase; pfam00884
529507014898	5 probable transmembrane helices predicted for PMI3040 by TMHMM2.0 at aa 21-43, 47-64, 71-90, 124-141 and 154-173
529507014899	HMMPfam hit to PF00884, Sulfatase, score 7.5e-53
529507014900	This CDS appears to have an internal deletion and a frameshift mutation; transposase (pseudogene)
529507014901	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507014902	HMMPfam hit to PF07282, transposase DNA-binding domai, score 1.2e-19
529507014903	HMMPfam hit to PF01385, Probable transposase, score 1.9e-15
529507014904	Transposase IS200 like; Region: Y1_Tnp; pfam01797
529507014905	HMMPfam hit to PF01797, Transposase IS200 like, score 9e-42
529507014906	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507014907	Uncharacterized conserved protein [Function unknown]; Region: COG1556
529507014908	HMMPfam hit to PF02589, Uncharacterized ACR, YkgG family COG1556, score 1.8e-54
529507014909	iron-sulfur cluster-binding protein; Region: TIGR00273
529507014910	Uncharacterized ACR, YkgG family COG1556; Region: DUF162; pfam02589
529507014911	The HCP family of iron-sulfur proteins includes hybrid cluster protein (HCP), acetyl-CoA synthase (ACS), and carbon monoxide dehydrogenase (CODH), all of which contain [Fe4-S4] metal clusters at their active sites. These proteins have a conserved...; Region: HCP_like; cl14655
529507014912	Domain of unknown function (DUF3390); Region: DUF3390; pfam11870
529507014913	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
529507014914	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 0.016
529507014915	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
529507014916	Fe-S oxidoreductase [Energy production and conversion]; Region: GlpC; COG0247
529507014917	Cysteine-rich domain; Region: CCG; pfam02754
529507014918	Cysteine-rich domain; Region: CCG; pfam02754
529507014919	HMMPfam hit to PF02754, Cysteine-rich domain, score 2.6e-16
529507014920	HMMPfam hit to PF02754, Cysteine-rich domain, score 1.3e-13
529507014921	Transcriptional regulators [Transcription]; Region: FadR; COG2186
529507014922	Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators; Region: WHTH_GntR; cd07377
529507014923	DNA-binding site [nucleotide binding]; DNA binding site
529507014924	This entry represents the C-terminal ligand binding domain of many members of the GntR family; Region: FCD; smart00895
529507014925	HMMPfam hit to PF00392, Bacterial regulatory proteins, gntR family, score 4.1e-18
529507014926	PS00043 Bacterial regulatory proteins, gntR family signature.
529507014927	HMMPfam hit to PF07729, FCD domain, score 9.7e-23
529507014928	putative transporter; Provisional; Region: PRK10504
529507014929	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507014930	putative substrate translocation pore; other site
529507014931	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507014932	Signal peptide predicted for PMI3048 by SignalP 2.0 HMM (Signal peptide probability 0.957) with cleavage site probability 0.688 between residues 26 and 27
529507014933	14 probable transmembrane helices predicted for PMI3048 by TMHMM2.0 at aa 9-31, 46-68, 81-103, 107-124, 136-158, 163-182, 195-217, 221-243, 263-285, 290-312, 324-346, 356-378, 391-413 and 428-450
529507014934	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 4.4e-49
529507014935	Sugar kinases, ribokinase family [Carbohydrate transport and metabolism]; Region: RbsK; COG0524
529507014936	Ribokinase catalyses the phosphorylation of ribose to ribose-5-phosphate using ATP. This reaction is the first step in the ribose metabolism. It traps ribose within the cell after uptake and also prepares the sugar for use in the synthesis of nucleotides...; Region: ribokinase; cd01174
529507014937	substrate binding site [chemical binding]; other site
529507014938	dimer interface [polypeptide binding]; other site
529507014939	ATP binding site [chemical binding]; other site
529507014940	HMMPfam hit to PF00294, pfkB family carbohydrate kinase, score 5.1e-85
529507014941	PS00584 pfkB family of carbohydrate kinases signature 2.
529507014942	PS00583 pfkB family of carbohydrate kinases signature 1.
529507014943	regulatory ATPase RavA; Provisional; Region: PRK13531
529507014944	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
529507014945	Walker A motif; other site
529507014946	ATP binding site [chemical binding]; other site
529507014947	Walker B motif; other site
529507014948	arginine finger; other site
529507014949	Protein of unknown function (DUF3763); Region: DUF3763; pfam12592
529507014950	HMMPfam hit to PF07728, ATPase family associated with various cellul, score 8.8e-55
529507014951	PS00179 Aminoacyl-transfer RNA synthetases class-II signature 1.
529507014952	hypothetical protein; Provisional; Region: yieM; PRK10997
529507014953	VWA YIEM type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF). Typically, the vWA domain is made up of approximately 200 amino acid residues folded into a classic a/b...; Region: VWA_YIEM_type; cd01462
529507014954	metal ion-dependent adhesion site (MIDAS); other site
529507014955	asparagine synthetase AsnA; Provisional; Region: PRK05425
529507014956	motif 1; other site
529507014957	dimer interface [polypeptide binding]; other site
529507014958	active site
529507014959	motif 2; other site
529507014960	motif 3; other site
529507014961	HMMPfam hit to PF03590, Aspartate-ammonia ligase, score 5.3e-170
529507014962	DNA-binding transcriptional regulator AsnC; Provisional; Region: PRK11179
529507014963	Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to...; Region: HTH_ARSR; cd00090
529507014964	putative DNA binding site [nucleotide binding]; other site
529507014965	putative Zn2+ binding site [ion binding]; other site
529507014966	AsnC family; Region: AsnC_trans_reg; pfam01037
529507014967	PS00519 Bacterial regulatory proteins, asnC family signature.
529507014968	HMMPfam hit to PF01037, AsnC family, score 1.2e-19
529507014969	origin of replication ttatccaca
529507014970	FMN-binding protein MioC; Provisional; Region: PRK09004
529507014971	HMMPfam hit to PF00258, Flavodoxin, score 9e-38
529507014972	origin of replication ttatccaca
529507014973	origin of replication ttatccaca
529507014974	tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated; Region: PRK05192
529507014975	NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis]; Region: Gid; COG1206
529507014976	GidA associated domain 3; Region: GIDA_assoc_3; pfam13932
529507014977	HMMPfam hit to PF01134, Glucose inhibited division protein A, score 4.6e-270
529507014978	PS01280 Glucose inhibited division protein A family signature 1.
529507014979	PS01281 Glucose inhibited division protein A family signature 2.
529507014980	Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane]; Region: GidB; COG0357
529507014981	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
529507014982	S-adenosylmethionine binding site [chemical binding]; other site
529507014983	HMMPfam hit to PF02527, Glucose inhibited division protein, score 2.1e-76
529507014984	F0F1 ATP synthase subunit I; Validated; Region: PRK08049
529507014985	HMMPfam hit to PF03899, ATP synthase I chain, score 4.3e-16
529507014986	4 probable transmembrane helices predicted for PMI3057 by TMHMM2.0 at aa 12-31, 36-58, 75-97 and 101-123
529507014987	F0F1 ATP synthase subunit A; Validated; Region: PRK05815
529507014988	F0F1-type ATP synthase, subunit a [Energy production and conversion]; Region: AtpB; COG0356
529507014989	5 probable transmembrane helices predicted for PMI3058 by TMHMM2.0 at aa 41-63, 103-125, 145-167, 214-236 and 246-268
529507014990	HMMPfam hit to PF00119, ATP synthase A chain, score 2e-67
529507014991	PS00449 ATP synthase a subunit signature.
529507014992	F0F1 ATP synthase subunit C; Validated; Region: PRK06876
529507014993	Signal peptide predicted for PMI3059 by SignalP 2.0 HMM (Signal peptide probability 0.758) with cleavage site probability 0.534 between residues 23 and 24
529507014994	HMMPfam hit to PF00137, ATP synthase subunit C, score 5.9e-25
529507014995	2 probable transmembrane helices predicted for PMI3059 by TMHMM2.0 at aa 10-32 and 53-75
529507014996	PS00605 ATP synthase c subunit signature.
529507014997	F0F1 ATP synthase subunit B; Validated; Region: PRK05759
529507014998	F0F1-type ATP synthase, subunit b [Energy production and conversion]; Region: AtpF; COG0711
529507014999	Signal peptide predicted for PMI3060 by SignalP 2.0 HMM (Signal peptide probability 0.722) with cleavage site probability 0.625 between residues 31 and 32
529507015000	1 probable transmembrane helix predicted for PMI3060 by TMHMM2.0 at aa 5-27
529507015001	HMMPfam hit to PF00430, ATP synthase B/B' CF(0), score 9.7e-38
529507015002	F0F1 ATP synthase subunit delta; Validated; Region: PRK05758
529507015003	ATP synthase delta (OSCP) subunit; Region: OSCP; pfam00213
529507015004	HMMPfam hit to PF00213, ATP synthase delta (OSCP) subunit, score 3.8e-66
529507015005	PS00389 ATP synthase delta (OSCP) subunit signature.
529507015006	F0F1 ATP synthase subunit alpha; Validated; Region: PRK09281
529507015007	ATP synthase alpha/beta family, beta-barrel domain; Region: ATP-synt_ab_N; pfam02874
529507015008	F1 ATP synthase alpha, central domain. The F-ATPase is found in bacterial plasma membranes, mitochondrial inner membranes and in chloroplast thylakoid membranes. It has also been found in the archaea Methanosarcina barkeri. It uses a proton gradient to...; Region: F1_ATPase_alpha; cd01132
529507015009	beta subunit interaction interface [polypeptide binding]; other site
529507015010	Walker A motif; other site
529507015011	ATP binding site [chemical binding]; other site
529507015012	Walker B motif; other site
529507015013	ATP synthase alpha/beta chain, C terminal domain; Region: ATP-synt_ab_C; pfam00306
529507015014	HMMPfam hit to PF02874, ATP synthase alpha/beta family, beta-ba, score 2.3e-16
529507015015	HMMPfam hit to PF00006, ATP synthase alpha/beta family, nucleot, score 8.4e-112
529507015016	PS00017 ATP/GTP-binding site motif A (P-loop).
529507015017	PS00152 ATP synthase alpha and beta subunits signature.
529507015018	HMMPfam hit to PF00306, ATP synthase alpha/beta chain, C termin, score 2.5e-27
529507015019	mitochondrial ATP synthase gamma subunit; Region: F1-ATPase_gamma; cd12151
529507015020	core domain interface [polypeptide binding]; other site
529507015021	delta subunit interface [polypeptide binding]; other site
529507015022	epsilon subunit interface [polypeptide binding]; other site
529507015023	HMMPfam hit to PF00231, ATP synthase, score 4.7e-167
529507015024	PS00041 Bacterial regulatory proteins, araC family signature.
529507015025	PS00153 ATP synthase gamma subunit signature.
529507015026	F0F1 ATP synthase subunit beta; Validated; Region: PRK09280
529507015027	ATP synthase alpha/beta family, beta-barrel domain; Region: ATP-synt_ab_N; pfam02874
529507015028	F1 ATP synthase beta subunit, nucleotide-binding domain. The F-ATPase is found in bacterial plasma membranes, mitochondrial inner membranes and in chloroplast thylakoid membranes. It has also been found in the archaea Methanosarcina barkeri. It uses a...; Region: F1-ATPase_beta; cd01133
529507015029	alpha subunit interaction interface [polypeptide binding]; other site
529507015030	Walker A motif; other site
529507015031	ATP binding site [chemical binding]; other site
529507015032	Walker B motif; other site
529507015033	inhibitor binding site; inhibition site
529507015034	ATP synthase alpha/beta chain, C terminal domain; Region: ATP-synt_ab_C; pfam00306
529507015035	HMMPfam hit to PF02874, ATP synthase alpha/beta family, beta-ba, score 8.8e-26
529507015036	HMMPfam hit to PF00006, ATP synthase alpha/beta family, nucleot, score 3.8e-89
529507015037	PS00017 ATP/GTP-binding site motif A (P-loop).
529507015038	PS00152 ATP synthase alpha and beta subunits signature.
529507015039	HMMPfam hit to PF00306, ATP synthase alpha/beta chain, C termin, score 1.7e-51
529507015040	F0F1 ATP synthase subunit epsilon; Validated; Region: atpC; PRK00571
529507015041	mitochondrial ATP synthase delta subunit; Region: F1-ATPase_delta; cd12152
529507015042	gamma subunit interface [polypeptide binding]; other site
529507015043	epsilon subunit interface [polypeptide binding]; other site
529507015044	LBP interface [polypeptide binding]; other site
529507015045	HMMPfam hit to PF02823, ATP synthase, Delta/Epsilon chain, beta, score 1.1e-32
529507015046	HMMPfam hit to PF00401, ATP synthase, Delta/Epsilon chain, long, score 3.3e-11
529507015047	bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional; Region: glmU; PRK09451
529507015048	N-terminal domain of bacterial GlmU; Region: GT2_GlmU_N_bac; cd02540
529507015049	Substrate binding site; other site
529507015050	Mg++ binding site; other site
529507015051	N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase. It is a bifunctional bacterial enzyme that catalyzes two...; Region: LbH_GlmU_C; cd03353
529507015052	active site
529507015053	substrate binding site [chemical binding]; other site
529507015054	CoA binding site [chemical binding]; other site
529507015055	HMMPfam hit to PF00483, Nucleotidyl transferase, score 1.4e-07
529507015056	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (th, score 0.26
529507015057	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (th, score 0.0048
529507015058	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (th, score 29
529507015059	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (th, score 12
529507015060	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (th, score 7
529507015061	PS00101 Hexapeptide-repeat containing-transferases signature.
529507015062	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (th, score 23
529507015063	glucosamine--fructose-6-phosphate aminotransferase; Reviewed; Region: PRK00331
529507015064	Glutamine amidotransferases class-II (Gn-AT)_GFAT-type. This domain is found at the N-terminus of glucosamine-6P synthase (GlmS, or GFAT in humans).  The glutaminase domain catalyzes amide nitrogen transfer from glutamine to the appropriate substrate. In...; Region: GFAT; cd00714
529507015065	glutaminase active site [active]
529507015066	SIS (Sugar ISomerase) domain repeat 1 found in Glucosamine 6-phosphate synthase (GlmS) and Glucosamine-6-phosphate deaminase (GlmD). The SIS domain is found in many phosphosugar isomerases and phosphosugar binding proteins. GlmS contains a N-terminal...; Region: SIS_GlmS_GlmD_1; cd05008
529507015067	dimer interface [polypeptide binding]; other site
529507015068	active site
529507015069	SIS (Sugar ISomerase) domain repeat 2 found in Glucosamine 6-phosphate synthase (GlmS) and Glucosamine-6-phosphate deaminase (GlmD). The SIS domain is found in many phosphosugar isomerases and phosphosugar binding proteins. GlmS contains a N-terminal...; Region: SIS_GlmS_GlmD_2; cd05009
529507015070	dimer interface [polypeptide binding]; other site
529507015071	active site
529507015072	HMMPfam hit to PF00310, Glutamine amidotransferases class-II, score 6.8e-51
529507015073	HMMPfam hit to PF01380, SIS domain, score 6.8e-37
529507015074	HMMPfam hit to PF01380, SIS domain, score 2.4e-33
529507015075	This CDS contains an in-frame stop codon; ABC transporter, ATP-binding protein (pseudogene)
529507015076	PS00017 ATP/GTP-binding site motif A (P-loop).
529507015077	HMMPfam hit to PF00005, ABC transporter, score 8.6e-07
529507015078	PS00211 ABC transporters family signature.
529507015079	putative 2-aminoethylphosphonate ABC transporter, permease protein; Region: PhnU2; TIGR03262
529507015080	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
529507015081	dimer interface [polypeptide binding]; other site
529507015082	conserved gate region; other site
529507015083	putative PBP binding loops; other site
529507015084	ABC-ATPase subunit interface; other site
529507015085	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
529507015086	dimer interface [polypeptide binding]; other site
529507015087	conserved gate region; other site
529507015088	putative PBP binding loops; other site
529507015089	ABC-ATPase subunit interface; other site
529507015090	12 probable transmembrane helices predicted for PMI3070 by TMHMM2.0 at aa 20-42, 74-96, 109-131, 146-168, 204-226, 246-268, 296-318, 350-372, 385-407, 417-439, 486-508 and 523-545
529507015091	HMMPfam hit to PF00528, Binding-protein-dependent transport syst, score 1.3e-08
529507015092	HMMPfam hit to PF00528, Binding-protein-dependent transport syst, score 9.7e-06
529507015093	putative 2-aminoethylphosphonate ABC transporter, periplasmic 2-aminoethylphosphonate-binding protein; Region: phnS2; TIGR03261
529507015094	Bacterial extracellular solute-binding protein; Region: SBP_bac_8; pfam13416
529507015095	Signal peptide predicted for PMI3071 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.999 between residues 21 and 22
529507015096	HMMPfam hit to PF01547, Bacterial extracellular solute-binding prot, score 5.3e-12
529507015097	hydroxyglutarate oxidase; Provisional; Region: PRK11728
529507015098	FAD dependent oxidoreductase TIGR03364; Region: HpnW_proposed
529507015099	HMMPfam hit to PF01266, FAD dependent oxidoreductase, score 8.2e-30
529507015100	Transposase IS200 like; Region: Y1_Tnp; pfam01797
529507015101	HMMPfam hit to PF01797, Transposase IS200 like, score 4.4e-43
529507015102	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507015103	Helix-turn-helix domain; Region: HTH_OrfB_IS605; pfam12323
529507015104	Transposase and inactivated derivatives [DNA replication, recombination, and repair]; Region: COG0675
529507015105	Probable transposase; Region: OrfB_IS605; pfam01385
529507015106	transposase, IS605 OrfB family, central region; Region: tspaseT_teng_C; TIGR01766
529507015107	HMMPfam hit to PF01385, Probable transposase, score 6.5e-129
529507015108	HMMPfam hit to PF07282, transposase DNA-binding domai, score 3e-34
529507015109	Protein of unknown function (DUF1240); Region: DUF1240; pfam06836
529507015110	HMMPfam hit to PF06836, Protein of unknown function (DUF1240), score 1.7e-28
529507015111	3 probable transmembrane helices predicted for PMI3075 by TMHMM2.0 at aa 9-31, 46-68 and 80-102
529507015112	Signal peptide predicted for PMI3075 by SignalP 2.0 HMM (Signal peptide probability 0.666) with cleavage site probability 0.651 between residues 53 and 54
529507015113	Also similar to the upstream CDS PMI3078; truncated at N-tertminus relative to database matches; membrane protein (fragment)
529507015114	membrane protein (pseudogene);This CDS contains a frameshift mutation; Also similar to the downstream CDS PMI3075
529507015115	PS00327 Bacterial rhodopsins retinal binding site.
529507015116	Signal peptide predicted for PMI3076 by SignalP 2.0 HMM (Signal peptide probability 0.906) with cleavage site probability 0.418 between residues 28 and 29
529507015117	1 probable transmembrane helix predicted for PMI3076 by TMHMM2.0 at aa 5-27
529507015118	2 probable transmembrane helices predicted for PMI3077 by TMHMM2.0 at aa 13-35 and 45-67
529507015119	Protein of unknown function (DUF2645); Region: DUF2645; pfam10840
529507015120	3 probable transmembrane helices predicted for PMI3078 by TMHMM2.0 at aa 7-26, 49-66 and 73-90
529507015121	phosphonoacetaldehyde hydrolase; Provisional; Region: PRK13478
529507015122	Haloacid dehalogenase-like hydrolases. The haloacid dehalogenase-like (HAD) superfamily includes L-2-haloacid dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, and many others; Region: HAD_like; cd01427
529507015123	motif II; other site
529507015124	HMMPfam hit to PF00702, haloacid dehalogenase-like hydrolase, score 4.3e-18
529507015125	glutamate carboxypeptidase; Reviewed; Region: PRK06133
529507015126	M20 Peptidase Glutamate carboxypeptidase, a periplasmic enzyme; Region: M20_CPDG2; cd03885
529507015127	metal binding site [ion binding]; metal-binding site
529507015128	dimer interface [polypeptide binding]; other site
529507015129	HMMPfam hit to PF01546, Peptidase family M20/M25/M40, score 6.3e-25
529507015130	HMMPfam hit to PF07687, Peptidase dimerisation domain, score 2.6e-25
529507015131	Predicted membrane protein [Function unknown]; Region: COG1288
529507015132	C4-dicarboxylate anaerobic carrier; Region: DcuC; pfam03606
529507015133	Signal peptide predicted for PMI3081 by SignalP 2.0 HMM (Signal peptide probability 0.693) with cleavage site probability 0.250 between residues 25 and 26
529507015134	HMMPfam hit to PF03606, C4-dicarboxylate anaerobic carrier, score 1e-61
529507015135	10 probable transmembrane helices predicted for PMI3081 by TMHMM2.0 at aa 15-37, 72-94, 117-139, 160-182, 197-219, 259-276, 281-303, 363-385, 412-434 and 441-463
529507015136	tetracycline repressor protein TetR; Provisional; Region: PRK13756
529507015137	Bacterial regulatory proteins, tetR family; Region: TetR_N; pfam00440
529507015138	Tetracyclin repressor, C-terminal all-alpha domain; Region: TetR_C; pfam02909
529507015139	HMMPfam hit to PF02909, Tetracyclin repressor, C-terminal all-alpha, score 3.7e-19
529507015140	HMMPfam hit to PF00440, Bacterial regulatory proteins, tetR family, score 1.9e-13
529507015141	Multidrug resistance efflux pump [Defense mechanisms]; Region: EmrA; COG1566
529507015142	HlyD family secretion protein; Region: HlyD_3; pfam13437
529507015143	1 probable transmembrane helix predicted for PMI3083 by TMHMM2.0 at aa 13-35
529507015144	HMMPfam hit to PF00529, HlyD family secretion protein, score 3.2e-19
529507015145	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507015146	putative substrate translocation pore; other site
529507015147	Signal peptide predicted for PMI3084 by SignalP 2.0 HMM (Signal peptide probability 0.802) with cleavage site probability 0.655 between residues 39 and 40
529507015148	14 probable transmembrane helices predicted for PMI3084 by TMHMM2.0 at aa 13-35, 55-77, 84-106, 110-132, 139-158, 173-195, 208-227, 237-259, 279-301, 311-333, 340-359, 369-391, 403-425 and 469-491
529507015149	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 1.3e-15
529507015150	Protein of unknown function, DUF; Region: DUF411; cl01142
529507015151	HMMPfam hit to PF04214, Protein of unknown function, DUF, score 3.6e-09
529507015152	Signal peptide predicted for PMI3085 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.996 between residues 22 and 23
529507015153	fimbrial operon 15
529507015154	putative fimbrial chaperone protein; Provisional; Region: PRK09918
529507015155	Gram-negative pili assembly chaperone, N-terminal domain; Region: Pili_assembly_N; pfam00345
529507015156	Signal peptide predicted for PMI3086 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.962 between residues 20 and 21
529507015157	PS00030 Eukaryotic RNA-binding region RNP-1 signature.
529507015158	This CDS appears to have a frameshift mutation around codon 102. The frameshift occurs within a (A)9 polymeric tract; outer membrane fimbrial usher protein (pseudogene)
529507015159	HMMPfam hit to PF00577, Fimbrial Usher protein, score 2e-10
529507015160	Signal peptide predicted for PMI3088 by SignalP 2.0 HMM (Signal peptide probability 0.985) with cleavage site probability 0.960 between residues 28 and 29
529507015161	Signal peptide predicted for PMI3089 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 1.000 between residues 25 and 26
529507015162	Protein of unknown function (DUF1120); Region: DUF1120; cl05856
529507015163	Signal peptide predicted for PMI3090 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 1.000 between residues 21 and 22
529507015164	Protein of unknown function (DUF1120); Region: DUF1120; cl05856
529507015165	Signal peptide predicted for PMI3091 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 1.000 between residues 21 and 22
529507015166	Protein of unknown function (DUF1120); Region: DUF1120; cl05856
529507015167	HMMPfam hit to PF06551, Protein of unknown function (DUF1120), score 1.4e-09
529507015168	PS00017 ATP/GTP-binding site motif A (P-loop).
529507015169	Signal peptide predicted for PMI3092 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.995 between residues 21 and 22
529507015170	Periplasmic protein with OB-fold [Function unknown]; Region: COG3111
529507015171	HMMPfam hit to PF04076, Domain unknown function (DUF388), score 5.1e-44
529507015172	Signal peptide predicted for PMI3093 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.503 between residues 19 and 20
529507015173	Rhomboid family; Region: Rhomboid; cl11446
529507015174	HMMPfam hit to PF01694, Rhomboid family, score 5.6e-14
529507015175	6 probable transmembrane helices predicted for PMI3094 by TMHMM2.0 at aa 13-35, 55-77, 84-103, 107-129, 136-158 and 162-179
529507015176	Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily; Region: NBD_sugar-kinase_HSP70_actin; cl17037
529507015177	fructokinase; Reviewed; Region: PRK09557
529507015178	nucleotide binding site [chemical binding]; other site
529507015179	HMMPfam hit to PF00480, ROK family, score 3.6e-53
529507015180	PS01125 ROK family signature.
529507015181	cellulose synthase catalytic subunit (UDP-forming); Region: CelA; TIGR03030
529507015182	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose; Region: CESA_CelA_like; cd06421
529507015183	DXD motif; other site
529507015184	PilZ domain; Region: PilZ; pfam07238
529507015185	Signal peptide predicted for PMI3097 by SignalP 2.0 HMM (Signal peptide probability 0.993) with cleavage site probability 0.496 between residues 45 and 46
529507015186	9 probable transmembrane helices predicted for PMI3097 by TMHMM2.0 at aa 21-43, 48-63, 70-87, 102-124, 404-421, 425-447, 459-481, 504-526 and 539-561
529507015187	HMMPfam hit to PF00535, Glycosyl transferase, score 1.2e-25
529507015188	cellulose synthase regulator protein; Provisional; Region: PRK11114
529507015189	Signal peptide predicted for PMI3098 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.972 between residues 24 and 25
529507015190	2 probable transmembrane helices predicted for PMI3098 by TMHMM2.0 at aa 7-29 and 742-764
529507015191	HMMPfam hit to PF03170, Bacterial cellulose synthase subunit, score 3.5e-48
529507015192	cellulose synthase subunit BcsC; Provisional; Region: PRK11447
529507015193	Cellulose synthase operon protein C C-terminus (BCSC_C); Region: BCSC_C; pfam05420
529507015194	Signal peptide predicted for PMI3099 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.655 between residues 29 and 30
529507015195	HMMPfam hit to PF07719, Tetratricopeptide repeat, score 3.3
529507015196	HMMPfam hit to PF07719, Tetratricopeptide repeat, score 2.5
529507015197	HMMPfam hit to PF07719, Tetratricopeptide repeat, score 2
529507015198	HMMPfam hit to PF07719, Tetratricopeptide repeat, score 1.5
529507015199	HMMPfam hit to PF07719, Tetratricopeptide repeat, score 1.9
529507015200	HMMPfam hit to PF05420, Cellulose synthase operon protein C C-termin, score 2.7e-66
529507015201	Cellulose synthase subunit D; Region: Cellsynth_D; pfam03500
529507015202	PAS domain; Region: PAS_9; pfam13426
529507015203	PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in...; Region: PAS; cl02459
529507015204	putative active site [active]
529507015205	heme pocket [chemical binding]; other site
529507015206	c-di-GMP synthetase (diguanylate cyclase, GGDEF domain) [Signal    transduction mechanisms]; Region: COG2199
529507015207	Diguanylate-cyclase (DGC) or GGDEF domain; Region: GGDEF; cd01949
529507015208	metal binding site [ion binding]; metal-binding site
529507015209	active site
529507015210	I-site; other site
529507015211	HMMPfam hit to PF00990, GGDEF domain, score 1.9e-44
529507015212	Prokaryotic UGPase catalyses the synthesis of UDP-glucose; Region: UGPase_prokaryotic; cd02541
529507015213	active site
529507015214	tetramer interface; other site
529507015215	HMMPfam hit to PF00483, Nucleotidyl transferase, score 1.4e-10
529507015216	PS00017 ATP/GTP-binding site motif A (P-loop).
529507015217	Glycosyl hydrolases family 8; Region: Glyco_hydro_8; cl01351
529507015218	Signal peptide predicted for PMI3103 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.990 between residues 31 and 32
529507015219	HMMPfam hit to PF01270, Glycosyl hydrolases family, score 9e-104
529507015220	1 probable transmembrane helix predicted for PMI3103 by TMHMM2.0 at aa 13-32
529507015221	PS00812 Glycosyl hydrolases family 8 signature.
529507015222	ABC-type transport system involved in multi-copper enzyme maturation, permease component [General function prediction only]; Region: NosY; COG1277
529507015223	Sulfatase; Region: Sulfatase; cl17466
529507015224	5 probable transmembrane helices predicted for PMI3104 by TMHMM2.0 at aa 5-22, 26-48, 53-72, 101-123 and 135-152
529507015225	Signal peptide predicted for PMI3104 by SignalP 2.0 HMM (Signal peptide probability 0.991) with cleavage site probability 0.783 between residues 55 and 56
529507015226	selenocysteinyl-tRNA-specific translation factor; Provisional; Region: PRK10512
529507015227	SelB, the dedicated elongation factor for delivery of selenocysteinyl-tRNA to the ribosome; Region: SelB; cd04171
529507015228	G1 box; other site
529507015229	putative GEF interaction site [polypeptide binding]; other site
529507015230	GTP/Mg2+ binding site [chemical binding]; other site
529507015231	Switch I region; other site
529507015232	G2 box; other site
529507015233	G3 box; other site
529507015234	Switch II region; other site
529507015235	G4 box; other site
529507015236	G5 box; other site
529507015237	selB_II: this subfamily represents the domain of elongation factor SelB, homologous to domain II of EF-Tu. SelB may function by replacing EF-Tu. In prokaryotes, the incorporation of selenocysteine as the 21st amino acid, encoded by TGA, requires several...; Region: selB_II; cd03696
529507015238	This family represents the domain of elongation factor SelB, homologous to domain III of EF-Tu. SelB may function by replacing EF-Tu. In prokaryotes, the incorporation of selenocysteine as the 21st amino acid, encoded by TGA, requires several elements:...; Region: selB_III; cd04094
529507015239	Elongation factor SelB, winged helix; Region: SelB-wing_2; pfam09106
529507015240	Elongation factor SelB, winged helix; Region: SelB-wing_3; pfam09107
529507015241	HMMPfam hit to PF03144, Elongation factor Tu domain, score 5.6e-09
529507015242	HMMPfam hit to PF00009, Elongation factor Tu GTP binding domain, score 3.2e-32
529507015243	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507015244	PS00017 ATP/GTP-binding site motif A (P-loop).
529507015245	selenocysteine synthase; Provisional; Region: PRK04311
529507015246	Selenocysteine synthase N terminal; Region: Se-cys_synth_N; pfam12390
529507015247	Selenocysteine synthase [seryl-tRNASer selenium transferase] [Amino acid transport and metabolism]; Region: SelA; COG1921
529507015248	pyridoxal 5'-phosphate binding pocket [chemical binding]; other site
529507015249	catalytic residue [active]
529507015250	HMMPfam hit to PF03841, L-seryl-tRNA selenium transferase, score 1e-224
529507015251	formate dehydrogenase accessory protein FdhE; Provisional; Region: PRK03564
529507015252	formate dehydrogenase accessory protein FdhE; Region: FdhE; TIGR01562
529507015253	HMMPfam hit to PF04216, Protein involved in formate dehydrogenase fo, score 9.4e-155
529507015254	formate dehydrogenase-O subunit gamma; Provisional; Region: PRK10639
529507015255	formate dehydrogenase, gamma subunit; Region: formate-DH-gamm; TIGR01583
529507015256	4 probable transmembrane helices predicted for PMI3108 by TMHMM2.0 at aa 20-42, 57-75, 116-138 and 153-175
529507015257	formate dehydrogenase, beta subunit, Fe-S containing; Region: FDH-beta; TIGR01582
529507015258	Formate dehydrogenase N, transmembrane; Region: Form-deh_trans; pfam09163
529507015259	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 2.3e-05
529507015260	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
529507015261	formate dehydrogenase, alpha subunit, proteobacterial-type; Region: formate-DH-alph; TIGR01553
529507015262	Formate dehydrogenase N, alpha subunit (Formate-Dh-Na) is a major component of nitrate respiration in bacteria such as in the E. coli formate dehydrogenase N (Fdh-N). Fdh-N is a membrane protein that is a complex of three different subunits and is the...; Region: MopB_Formate-Dh-Na-like; cd02752
529507015263	[4Fe-4S] binding site [ion binding]; other site
529507015264	Molybdopterin-Binding (MopB) domain of the MopB superfamily of proteins, a  large, diverse, heterogeneous superfamily of enzymes that, in general, bind molybdopterin as a cofactor. The MopB domain is found in a wide variety of molybdenum- and...; Region: Molybdopterin-Binding; cl09928
529507015265	Formate dehydrogenase N, alpha subunit (Formate-Dh-Na) is a major component of nitrate respiration in bacteria such as in the E. coli formate dehydrogenase N (Fdh-N). Fdh-N is a membrane protein that is a complex of three different subunits and is the...; Region: MopB_Formate-Dh-Na-like; cd02752
529507015266	Formate dehydrogenase N, alpha subunit (Formate-Dh-Na) is a major component of nitrate respiration in bacteria such as in the E. coli formate dehydrogenase N (Fdh-N). Fdh-N is a membrane protein that is a complex of three different subunits and is the...; Region: MopB_CT_Formate-Dh-Na-like; cd02792
529507015267	molybdopterin cofactor binding site; other site
529507015268	HMMPfam hit to PF01568, Molydopterin dinucleotide binding dom, score 9.5e-41
529507015269	PS00932 Prokaryotic molybdopterin oxidoreductases signature 3.
529507015270	HMMPfam hit to PF00384, Molybdopterin oxidoreductase, score 9e-07
529507015271	HMMPfam hit to PF04879, Molybdopterin oxidoreductase Fe4S4 dom, score 1.9e-22
529507015272	PS00551 Prokaryotic molybdopterin oxidoreductases signature 1.
529507015273	Signal peptide predicted for PMI3111 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.708 between residues 33 and 34
529507015274	1 probable transmembrane helix predicted for PMI3111 by TMHMM2.0 at aa 17-39
529507015275	formate dehydrogenase accessory protein; Reviewed; Region: PRK00724
529507015276	HMMPfam hit to PF02634, FdhD/NarQ family, score 1.1e-108
529507015277	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cd04301
529507015278	Coenzyme A binding pocket [chemical binding]; other site
529507015279	TupA-like ATPgrasp; Region: ATPgrasp_TupA; pfam14305
529507015280	Signal peptide predicted for PMI3115 by SignalP 2.0 HMM (Signal peptide probability 0.997) with cleavage site probability 0.994 between residues 23 and 24
529507015281	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507015282	Predicted amidohydrolase [General function prediction only]; Region: COG0388
529507015283	Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases); Region: nitrilase_7; cd07585
529507015284	putative active site [active]
529507015285	catalytic triad [active]
529507015286	putative dimer interface [polypeptide binding]; other site
529507015287	HMMPfam hit to PF00795, Carbon-nitrogen hydrolase, score 1.2e-34
529507015288	Transcriptional regulator [Transcription]; Region: LysR; COG0583
529507015289	Bacterial regulatory helix-turn-helix protein, lysR family; Region: HTH_1; pfam00126
529507015290	The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of aromatic compounds and that of other related regulators, contains type 2 periplasmic binding fold; Region: PBP2_LTTR_aromatics_like; cd08414
529507015291	dimerization interface [polypeptide binding]; other site
529507015292	substrate binding pocket [chemical binding]; other site
529507015293	HMMPfam hit to PF00126, Bacterial regulatory helix-turn-helix, score 1.6e-19
529507015294	PS00044 Bacterial regulatory proteins, lysR family signature.
529507015295	HMMPfam hit to PF03466, LysR substrate binding domain, score 4e-17
529507015296	Transferrin binding protein-like solute binding protein; Region: Lipoprotein_5; pfam01298
529507015297	Signal peptide predicted for PMI3118 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.751 between residues 20 and 21
529507015298	Protein of unknown function (DUF560); Region: DUF560; pfam04575
529507015299	Signal peptide predicted for PMI3119 by SignalP 2.0 HMM (Signal peptide probability 0.933) with cleavage site probability 0.457 between residues 24 and 25
529507015300	TonB-dependent Receptor Plug Domain; Region: Plug; pfam07715
529507015301	TonB dependent receptor; Region: TonB_dep_Rec; pfam00593
529507015302	Signal peptide predicted for PMI3120 by SignalP 2.0 HMM (Signal peptide probability 0.998) with cleavage site probability 0.976 between residues 27 and 28
529507015303	HMMPfam hit to PF07715, TonB-dependent Receptor Plug Domain, score 1.2e-07
529507015304	HMMPfam hit to PF00593, TonB dependent receptor, score 1.1e-24
529507015305	This hit extended beyond the end of the feature by 1 aa and was clipped.; PS01156 TonB-dependent receptor proteins signature 2.
529507015306	Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane]; Region: TonB; COG0810
529507015307	Gram-negative bacterial tonB protein; Region: TonB; pfam03544
529507015308	1 probable transmembrane helix predicted for PMI3121 by TMHMM2.0 at aa 12-31
529507015309	HMMPfam hit to PF03544, Gram-negative bacterial tonB protein, score 6.9e-08
529507015310	delta endotoxin, N-terminal domain; Region: Endotoxin_N; pfam03945
529507015311	metallophosphatase superfamily, metallophosphatase domain; Region: MPP_superfamily; cl13995
529507015312	Calcineurin-like phosphoesterase; Region: Metallophos; pfam00149
529507015313	active site
529507015314	metal binding site [ion binding]; metal-binding site
529507015315	HMMPfam hit to PF00149, Calcineurin-like phosphoesterase, score 6.6e-08
529507015316	Protein of unknown function (DUF1097); Region: DUF1097; pfam06496
529507015317	HMMPfam hit to PF06496, Protein of unknown function (DUF1097), score 3e-64
529507015318	5 probable transmembrane helices predicted for PMI3124 by TMHMM2.0 at aa 12-34, 49-71, 78-96, 100-117 and 124-146
529507015319	Signal peptide predicted for PMI3124 by SignalP 2.0 HMM (Signal peptide probability 0.981) with cleavage site probability 0.435 between residues 41 and 42
529507015320	HipA N-terminal domain; Region: Couple_hipA; pfam13657
529507015321	Toxin module HipA, protein kinase of phosphatidylinositol 3/4-kinase superfamily [General function prediction only]; Region: HipA; COG3550
529507015322	HipA-like N-terminal domain; Region: HipA_N; pfam07805
529507015323	HipA-like C-terminal domain; Region: HipA_C; pfam07804
529507015324	HMMPfam hit to PF07804, HipA-like C-terminal domain, score 1.9e-37
529507015325	HMMPfam hit to PF07805, HipA-like N-terminal domain, score 2.4e-21
529507015326	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
529507015327	non-specific DNA binding site [nucleotide binding]; other site
529507015328	salt bridge; other site
529507015329	sequence-specific DNA binding site [nucleotide binding]; other site
529507015330	HMMPfam hit to PF01381, Helix-turn-helix, score 5.6e-09
529507015331	tRNA modification GTPase TrmE; Reviewed; Region: trmE; PRK05291
529507015332	GTP-binding protein TrmE N-terminus; Region: TrmE_N; pfam10396
529507015333	trmE is a tRNA modification GTPase; Region: trmE; cd04164
529507015334	G1 box; other site
529507015335	GTP/Mg2+ binding site [chemical binding]; other site
529507015336	Switch I region; other site
529507015337	G2 box; other site
529507015338	Switch II region; other site
529507015339	G3 box; other site
529507015340	G4 box; other site
529507015341	G5 box; other site
529507015342	Catalytic cysteine-containing C-terminus of GTPase, MnmE; Region: GTPase_Cys_C; pfam12631
529507015343	HMMPfam hit to PF01926, GTPase of unknown function, score 4.9e-41
529507015344	PS00017 ATP/GTP-binding site motif A (P-loop).
529507015345	membrane protein insertase; Provisional; Region: PRK01318
529507015346	membrane protein insertase, YidC/Oxa1 family, C-terminal domain; Region: yidC_oxa1_cterm; TIGR03592
529507015347	HMMPfam hit to PF02096, 60Kd inner membrane protein, score 1.4e-118
529507015348	3 probable transmembrane helices predicted for PMI3128 by TMHMM2.0 at aa 307-329, 376-398 and 454-476
529507015349	PS00496 P-II protein urydylation site.
529507015350	Haemolytic domain; Region: Haemolytic; pfam01809
529507015351	HMMPfam hit to PF01809, Domain of unknown function DUF37, score 5.9e-43
529507015352	ribonuclease P; Reviewed; Region: rnpA; PRK01732
529507015353	HMMPfam hit to PF00825, Ribonuclease P, score 8.5e-60
529507015354	PS00648 Bacterial ribonuclease P protein component signature.
529507015355	50S ribosomal protein L34; Reviewed; Region: rpmH; PRK00399
529507015356	HMMPfam hit to PF00468, Ribosomal protein L34, score 9.8e-22
529507015357	PS00784 Ribosomal protein L34 signature.
529507015358	DnaA N-terminal domain; Region: DnaA_N; pfam11638
529507015359	chromosomal replication initiator protein DnaA; Region: DnaA; TIGR00362
529507015360	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
529507015361	Walker A motif; other site
529507015362	ATP binding site [chemical binding]; other site
529507015363	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cl17189
529507015364	Walker B motif; other site
529507015365	arginine finger; other site
529507015366	C-terminal domain of bacterial DnaA proteins. The DNA-binding C-terminal domain of DnaA contains a helix-turn-helix motif that specifically interacts with the DnaA box, a 9-mer motif that occurs repetitively in the replication origin oriC. Multiple...; Region: Bac_DnaA_C; cd06571
529507015367	DnaA box-binding interface [nucleotide binding]; other site
529507015368	HMMPfam hit to PF00308, Bacterial dnaA protein, score 4e-217
529507015369	PS00017 ATP/GTP-binding site motif A (P-loop).
529507015370	PS01008 DnaA protein signature.
529507015371	DNA polymerase III subunit beta; Validated; Region: PRK05643
529507015372	Beta clamp domain.  The beta subunit (processivity factor) of DNA polymerase III holoenzyme, refered to as the beta clamp, forms a ring shaped dimer that encircles dsDNA (sliding clamp) in bacteria.  The beta-clamp is structurally similar to the trimeric...; Region: beta_clamp; cd00140
529507015373	putative DNA binding surface [nucleotide binding]; other site
529507015374	dimer interface [polypeptide binding]; other site
529507015375	beta-clamp/clamp loader binding surface; other site
529507015376	beta-clamp/translesion DNA polymerase binding surface; other site
529507015377	HMMPfam hit to PF00712, DNA polymerase III beta subunit, N-te, score 2.3e-66
529507015378	HMMPfam hit to PF02767, DNA polymerase III beta subunit, cent, score 1.5e-66
529507015379	HMMPfam hit to PF02768, DNA polymerase III beta subunit, C-te, score 1.2e-63
529507015380	recF protein; Region: recf; TIGR00611
529507015381	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
529507015382	Walker A/P-loop; other site
529507015383	ATP binding site [chemical binding]; other site
529507015384	Q-loop/lid; other site
529507015385	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
529507015386	ABC transporter signature motif; other site
529507015387	Walker B; other site
529507015388	D-loop; other site
529507015389	H-loop/switch region; other site
529507015390	HMMPfam hit to PF02463, RecF/RecN/SMC N terminal domain, score 3.4e-158
529507015391	PS00017 ATP/GTP-binding site motif A (P-loop).
529507015392	PS00617 RecF protein signature 1.
529507015393	PS00618 RecF protein signature 2.
529507015394	DNA gyrase subunit B; Provisional; Region: gyrB; PRK14939
529507015395	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
529507015396	ATP binding site [chemical binding]; other site
529507015397	Mg2+ binding site [ion binding]; other site
529507015398	G-X-G motif; other site
529507015399	TopoIIA_Trans_DNA_gyrase: Transducer domain, having a ribosomal S5 domain 2-like fold, of the type found in proteins of the type IIA family of DNA topoisomerases similar to the B subunits of E. coli DNA gyrase and E. coli Topoisomerase IV which are; Region: TopoII_Trans_DNA_gyrase; cd00822
529507015400	anchoring element; other site
529507015401	dimer interface [polypeptide binding]; other site
529507015402	ATP binding site [chemical binding]; other site
529507015403	TOPRIM_TopoIIA_GyrB: topoisomerase-primase (TOPRIM) nucleotidyl transferase/hydrolase domain of the type found in proteins of the type IIA family of DNA topoisomerases similar to the Escherichia coli GyrB subunit. TopoIIA enzymes cut both strands of the...; Region: TOPRIM_TopoIIA_GyrB; cd03366
529507015404	active site
529507015405	putative metal-binding site [ion binding]; other site
529507015406	DNA gyrase B subunit, carboxyl terminus; Region: DNA_gyraseB_C; pfam00986
529507015407	HMMPfam hit to PF02518, Histidine kinase-, DNA gyrase B-, and H, score 2.4e-33
529507015408	HMMPfam hit to PF00204, DNA gyrase B, score 5.3e-92
529507015409	HMMPfam hit to PF01751, Toprim domain, score 9.1e-05
529507015410	PS00177 DNA topoisomerase II signature.
529507015411	HMMPfam hit to PF00986, DNA gyrase B subunit, carboxyl terminus, score 4.3e-45
529507015412	aspartate-semialdehyde dehydrogenase; Reviewed; Region: PRK06598
529507015413	Semialdehyde dehydrogenase, NAD binding domain; Region: Semialdhyde_dh; smart00859
529507015414	HMMPfam hit to PF02774, Semialdehyde dehydrogenase, dimerisat, score 1e-80
529507015415	PS01103 Aspartate-semialdehyde dehydrogenase signature.
529507015416	HMMPfam hit to PF01118, Semialdehyde dehydrogenase, NAD bindi, score 3.8e-43
529507015417	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
529507015418	S-adenosylmethionine binding site [chemical binding]; other site
529507015419	N-acetylmuramic acid-6-phosphate etherase; Reviewed; Region: murQ; PRK05441
529507015420	N-acetylmuramic acid 6-phosphate etherase. Members of this family contain the SIS (Sugar ISomerase) domain. The SIS domain is found in many phosphosugar isomerases and phosphosugar binding proteins. The bacterial cell wall sugar N-acetylmuramic acid...; Region: SIS_Etherase; cd05007
529507015421	putative active site [active]
529507015422	HMMPfam hit to PF01380, SIS domain, score 0.0014
529507015423	PS01272 Glucokinase regulatory protein family signature.
529507015424	mobile element
529507015425	possible frameshift at N-terminus; transposase (pseudogene)
529507015426	Restriction endonuclease; Region: Mrr_cat; pfam04471
529507015427	HMMPfam hit to PF04471, Restriction endonuclease, score 2.7e-15
529507015428	PS00092 N-6 Adenine-specific DNA methylases signature.
529507015429	DNA methylase; Region: N6_N4_Mtase; pfam01555
529507015430	DNA modification methylase [DNA replication, recombination, and repair]; Region: COG0863
529507015431	DNA methylase; Region: N6_N4_Mtase; cl17433
529507015432	PS00017 ATP/GTP-binding site motif A (P-loop).
529507015433	PS00092 N-6 Adenine-specific DNA methylases signature.
529507015434	D12 class N6 adenine-specific DNA methyltransferase; Region: MethyltransfD12; cl17344
529507015435	PS00092 N-6 Adenine-specific DNA methylases signature.
529507015436	HMMPfam hit to PF02086, D12 class N6 adenine-specific DNA met, score 0.00019
529507015437	Helix-turn-helix domain; Region: HTH_17; pfam12728
529507015438	Helix-turn-helix domain; Region: HTH_28; pfam13518
529507015439	Winged helix-turn helix; Region: HTH_29; pfam13551
529507015440	Integrase core domain; Region: rve; pfam00665
529507015441	Integrase core domain; Region: rve_3; pfam13683
529507015442	HMMPfam hit to PF00665, Integrase core domain, score 2.2e-28
529507015443	transposase (fragment)
529507015444	integrase (fragment)
529507015445	hypothetical protein; Provisional; Region: PRK11820
529507015446	YicC-like family, N-terminal region; Region: YicC_N; pfam03755
529507015447	Domain of unknown function (DUF1732); Region: DUF1732; pfam08340
529507015448	HMMPfam hit to PF03755, YicC-like family, N-terminal region, score 2e-73
529507015449	ribonuclease PH; Reviewed; Region: rph; PRK00173
529507015450	Ribonuclease PH; Region: RNase_PH_bact; cd11362
529507015451	hexamer interface [polypeptide binding]; other site
529507015452	active site
529507015453	HMMPfam hit to PF01138, 3' exoribonuclease family, domain, score 1.8e-54
529507015454	PS01277 Ribonuclease PH signature.
529507015455	HMMPfam hit to PF03725, 3' exoribonuclease family, domain, score 2.3e-21
529507015456	Phosphoribosyl transferase (PRT)-type I domain; Region: PRTases_typeI; cd06223
529507015457	active site
529507015458	HMMPfam hit to PF00156, Phosphoribosyl transferase domain, score 9e-29
529507015459	PS00103 Purine/pyrimidine phosphoribosyl transferases signature.
529507015460	division inhibitor protein; Provisional; Region: slmA; PRK09480
529507015461	Bacterial regulatory proteins, tetR family; Region: TetR_N; pfam00440
529507015462	HMMPfam hit to PF00440, Bacterial regulatory proteins, tetR family, score 1.5e-08
529507015463	PS01081 Bacterial regulatory proteins, tetR family signature.
529507015464	Trimeric dUTP diphosphatases; Region: trimeric_dUTPase; cd07557
529507015465	trimer interface [polypeptide binding]; other site
529507015466	active site
529507015467	HMMPfam hit to PF00692, dUTPase, score 6.5e-51
529507015468	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated; Region: PRK05579
529507015469	Flavoprotein; Region: Flavoprotein; pfam02441
529507015470	DNA / pantothenate metabolism flavoprotein; Region: DFP; pfam04127
529507015471	HMMPfam hit to PF04127, DNA / pantothenate metabolism flavoprote, score 2.4e-42
529507015472	HMMPfam hit to PF02441, Flavoprotein, score 6.5e-45
529507015473	hypothetical protein; Reviewed; Region: PRK00024
529507015474	Mov34/MPN/PAD-1 family; Region: MPN_DUF2466; cd08071
529507015475	MPN+ (JAMM) motif; other site
529507015476	Zinc-binding site [ion binding]; other site
529507015477	HMMPfam hit to PF04002, RadC, DNA repair protein, score 1.7e-70
529507015478	PS01302 DNA repair protein radC family signature.
529507015479	50S ribosomal protein L28; Reviewed; Region: rpmB; PRK00359
529507015480	HMMPfam hit to PF00830, Ribosomal L28 family, score 6.8e-36
529507015481	50S ribosomal protein L33; Validated; Region: rpmG; PRK00595
529507015482	HMMPfam hit to PF00471, Ribosomal protein L33, score 4e-23
529507015483	PS00582 Ribosomal protein L33 signature.
529507015484	Glycosyltransferase [Cell envelope biogenesis, outer membrane]; Region: RfaG; COG0438
529507015485	This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to...; Region: GT1_YqgM_like; cd03801
529507015486	HMMPfam hit to PF00534, Glycosyl transferases group, score 1.9e-42
529507015487	ADP-heptose:LPS heptosyltransferase [Cell envelope biogenesis, outer membrane]; Region: RfaF; COG0859
529507015488	Lipopolysaccharide heptosyltransferase is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from...; Region: GT1_LPS_heptosyltransferase; cd03789
529507015489	putative active site [active]
529507015490	HMMPfam hit to PF01075, Glycosyltransferase family, score 1.8e-07
529507015491	Glycosyltransferase [Cell envelope biogenesis, outer membrane]; Region: RfaG; COG0438
529507015492	This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to...; Region: GT1_YqgM_like; cd03801
529507015493	HMMPfam hit to PF00534, Glycosyl transferases group, score 4.6e-46
529507015494	Glycosyltransferase [Cell envelope biogenesis, outer membrane]; Region: RfaG; COG0438
529507015495	This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to...; Region: GT1_YqgM_like; cd03801
529507015496	HMMPfam hit to PF00534, Glycosyl transferases group, score 4.6e-17
529507015497	O-antigen ligase RfaL; Provisional; Region: PRK15487
529507015498	Lipid A core - O-antigen ligase and related enzymes [Cell envelope biogenesis, outer membrane]; Region: RfaL; COG3307
529507015499	12 probable transmembrane helices predicted for PMI3163 by TMHMM2.0 at aa 12-31, 36-50, 63-85, 95-112, 125-144, 164-181, 186-205, 209-226, 231-250, 327-349, 362-384 and 388-407
529507015500	HMMPfam hit to PF04932, O-Antigen Polymerase, score 3.7e-13
529507015501	formamidopyrimidine/5-formyluracil/ 5-hydroxymethyluracil DNA glycosylase; Validated; Region: PRK01103
529507015502	N-terminal domain of Escherichia coli Fpg1/MutM and related bacterial DNA glycosylases; Region: EcFpg-like_N; cd08966
529507015503	DNA binding site [nucleotide binding]
529507015504	catalytic residue [active]
529507015505	H2TH interface [polypeptide binding]; other site
529507015506	putative catalytic residues [active]
529507015507	turnover-facilitating residue; other site
529507015508	intercalation triad [nucleotide binding]; other site
529507015509	8OG recognition residue [nucleotide binding]; other site
529507015510	putative reading head residues; other site
529507015511	Formamidopyrimidine-DNA glycosylase H2TH domain; Region: H2TH; pfam06831
529507015512	Zinc finger found in FPG and IleRS; Region: zf-FPG_IleRS; pfam06827
529507015513	HMMPfam hit to PF01149, Formamidopyrimidine-DNA glycosylase N-, score 1.9e-51
529507015514	HMMPfam hit to PF06831, Formamidopyrimidine-DNA glycosylase H2, score 3.3e-46
529507015515	HMMPfam hit to PF06827, Zinc finger found in FPG and IleRS, score 7.2e-07
529507015516	phosphopantetheine adenylyltransferase; Provisional; Region: coaD; PRK00168
529507015517	Phosphopantetheine adenylyltransferase; Region: PPAT; cd02163
529507015518	active site
529507015519	(T/H)XGH motif; other site
529507015520	HMMPfam hit to PF01467, Cytidylyltransferase, score 1.4e-30
529507015521	Glycosyltransferases involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane]; Region: WcaA; COG0463
529507015522	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide; Region: Beta4Glucosyltransferase; cd02511
529507015523	putative metal binding site; other site
529507015524	HMMPfam hit to PF00535, Glycosyl transferase, score 2.4e-20
529507015525	3-deoxy-D-manno-octulosonic-acid transferase; Reviewed; Region: PRK05749
529507015526	3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase); Region: Glycos_transf_N; pfam04413
529507015527	Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate...; Region: Glycosyltransferase_GTB_type; cl10013
529507015528	HMMPfam hit to PF00534, Glycosyl transferases group, score 6.4e-05
529507015529	HMMPfam hit to PF04413, 3-Deoxy-D-manno-octulosonic-acid tran, score 1.8e-105
529507015530	lipopolysaccharide core biosynthesis protein; Provisional; Region: PRK10422
529507015531	Lipopolysaccharide heptosyltransferase is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from...; Region: GT1_LPS_heptosyltransferase; cd03789
529507015532	Lipopolysaccharide heptosyltransferase is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from...; Region: GT1_LPS_heptosyltransferase; cd03789
529507015533	putative active site [active]
529507015534	HMMPfam hit to PF01075, Glycosyltransferase family, score 6.7e-49
529507015535	Glycosyltransferase [Cell envelope biogenesis, outer membrane]; Region: RfaG; COG0438
529507015536	This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to...; Region: GT1_YqgM_like; cd03801
529507015537	HMMPfam hit to PF00534, Glycosyl transferases group, score 4.9e-28
529507015538	Glycosyltransferase [Cell envelope biogenesis, outer membrane]; Region: RfaG; COG0438
529507015539	This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core; Region: GT1_WabH_like; cd03811
529507015540	putative ADP-binding pocket [chemical binding]; other site
529507015541	HMMPfam hit to PF00534, Glycosyl transferases group, score 8.7e-22
529507015542	Putative catalytic domain of lipopolysaccharide biosynthesis protein WalW and its bacterial homologs; Region: CE4_WalW; cd10935
529507015543	putative active site [active]
529507015544	putative catalytic site [active]
529507015545	Lipopolysaccharide heptosyltransferase is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from...; Region: GT1_LPS_heptosyltransferase; cd03789
529507015546	ADP-heptose:LPS heptosyltransferase [Cell envelope biogenesis, outer membrane]; Region: RfaF; COG0859
529507015547	putative active site [active]
529507015548	HMMPfam hit to PF01075, Glycosyltransferase family, score 7.4e-08
529507015549	Glycosyl transferase family 2; Region: Glycos_transf_2; pfam00535
529507015550	active site
529507015551	HMMPfam hit to PF00535, Glycosyl transferase, score 1.9e-20
529507015552	ADP-heptose:LPS heptosyltransferase [Cell envelope biogenesis, outer membrane]; Region: RfaF; COG0859
529507015553	Lipopolysaccharide heptosyltransferase is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from...; Region: GT1_LPS_heptosyltransferase; cd03789
529507015554	putative active site [active]
529507015555	HMMPfam hit to PF01075, Glycosyltransferase family, score 2.5e-91
529507015556	ADP-heptose:LPS heptosyltransferase [Cell envelope biogenesis, outer membrane]; Region: RfaF; COG0859
529507015557	Lipopolysaccharide heptosyltransferase is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from...; Region: GT1_LPS_heptosyltransferase; cd03789
529507015558	putative active site [active]
529507015559	HMMPfam hit to PF01075, Glycosyltransferase family, score 2e-107
529507015560	ADP-L-glycero-D-mannoheptose 6-epimerase (GME), extended (e) SDRs; Region: ADP_GME_SDR_e; cd05248
529507015561	ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional; Region: rfaD; PRK11150
529507015562	NADP binding site [chemical binding]; other site
529507015563	homopentamer interface [polypeptide binding]; other site
529507015564	substrate binding site [chemical binding]; other site
529507015565	active site
529507015566	HMMPfam hit to PF01370, NAD dependent epimerase/dehydratase family, score 1.1e-12
529507015567	pyridoxal phosphate-dependent acyltransferase, putative; Region: gly_Cac_T_rel; TIGR01825
529507015568	KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD corresponds to serine palmitoyltransferase (SPT), 5-aminolevulinate synthase (ALAS); Region: KBL_like; cd06454
529507015569	substrate-cofactor binding pocket; other site
529507015570	pyridoxal 5'-phosphate binding site [chemical binding]; other site
529507015571	catalytic residue [active]
529507015572	HMMPfam hit to PF00155, Aminotransferase class I and II, score 3.2e-69
529507015573	PS00599 Aminotransferases class-II pyridoxal-phosphate attachment site.
529507015574	L-threonine 3-dehydrogenase; Validated; Region: tdh; PRK05396
529507015575	Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family; Region: MDR; cl16912
529507015576	NAD(P) binding site [chemical binding]; other site
529507015577	HMMPfam hit to PF00107, Zinc-binding dehydrogenase, score 8.3e-111
529507015578	PS00059 Zinc-containing alcohol dehydrogenases signature.
529507015579	Putative catalytic domain of family 2 polysaccharide deacetylases (DACs) from bacteria; Region: CE4_DAC2; cd10936
529507015580	NodB motif; other site
529507015581	putative active site [active]
529507015582	putative catalytic site [active]
529507015583	Zn binding site [ion binding]; other site
529507015584	HMMPfam hit to PF04748, Divergent polysaccharide deacetylase, score 1.5e-104
529507015585	Signal peptide predicted for PMI3179 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.992 between residues 30 and 31
529507015586	Membrane-bound metallopeptidase [Cell division and chromosome partitioning]; Region: COG4942
529507015587	Peptidase family M23; Region: Peptidase_M23; pfam01551
529507015588	HMMPfam hit to PF01551, Peptidase family M23, score 1.5e-41
529507015589	Signal peptide predicted for PMI3180 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.992 between residues 39 and 40
529507015590	ribosomal protein S12 methylthiotransferase; Provisional; Region: rimO; PRK14862
529507015591	Uncharacterized protein family UPF0004; Region: UPF0004; pfam00919
529507015592	Radical SAM superfamily. Enzymes of this family generate radicals by combining a 4Fe-4S cluster and S-adenosylmethionine (SAM) in close proximity. They are characterized by a conserved CxxxCxxC motif, which coordinates the conserved iron-sulfur cluster; Region: Radical_SAM; cd01335
529507015593	FeS/SAM binding site; other site
529507015594	HMMPfam hit to PF01938, TRAM domain, score 0.022
529507015595	HMMPfam hit to PF04055, Radical SAM superfamily, score 2.5e-31
529507015596	PS01278 Uncharacterized protein family UPF0004 signature.
529507015597	HMMPfam hit to PF00919, Uncharacterized protein family UPF0004, score 4.7e-42
529507015598	Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein. The cysteine containing enzymatically active version of the domain is also found in the Cdc25 class of protein phosphatases and a variety of proteins...; Region: RHOD; cd00158
529507015599	active site residue [active]
529507015600	1 probable transmembrane helix predicted for PMI3182 by TMHMM2.0 at aa 13-35
529507015601	HMMPfam hit to PF00581, Rhodanese-like domain, score 2.4e-12
529507015602	Preprotein translocase subunit SecB. SecB is a cytoplasmic component of the multisubunit membrane-bound enzyme termed Sec protein translocase, which is the main constituent of the General Secretory (type II) Pathway involved in translocation of nascent...; Region: Translocase_SecB; cd00557
529507015603	SecA binding site; other site
529507015604	Preprotein binding site; other site
529507015605	HMMPfam hit to PF02556, Preprotein translocase subunit SecB, score 4.7e-92
529507015606	NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated; Region: gpsA; PRK00094
529507015607	NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; Region: NAD_Gly3P_dh_N; pfam01210
529507015608	NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus; Region: NAD_Gly3P_dh_C; pfam07479
529507015609	Signal peptide predicted for PMI3184 by SignalP 2.0 HMM (Signal peptide probability 0.661) with cleavage site probability 0.575 between residues 18 and 19
529507015610	HMMPfam hit to PF01210, NAD-dependent glycerol-3-phosphate deh, score 3.5e-73
529507015611	HMMPfam hit to PF07479, NAD-dependent glycerol-3-phosphate deh, score 5.5e-80
529507015612	PS00957 NAD-dependent glycerol-3-phosphate dehydrogenase signature.
529507015613	serine acetyltransferase; Provisional; Region: cysE; PRK11132
529507015614	Serine acetyltransferase, N-terminal; Region: SATase_N; pfam06426
529507015615	Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of...; Region: LbH_SAT; cd03354
529507015616	trimer interface [polypeptide binding]; other site
529507015617	active site
529507015618	substrate binding site [chemical binding]; other site
529507015619	CoA binding site [chemical binding]; other site
529507015620	HMMPfam hit to PF06426, Serine acetyltransferase, N-terminal, score 3.4e-60
529507015621	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 1e+02
529507015622	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 5.5
529507015623	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 16
529507015624	PS00101 Hexapeptide-repeat containing-transferases signature.
529507015625	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 0.16
529507015626	Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). Proteins containing hexapeptide repeats are often enzymes...; Region: LbetaH; cl00160
529507015627	putative trimer interface [polypeptide binding]; other site
529507015628	putative CoA binding site [chemical binding]; other site
529507015629	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 0.32
529507015630	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 5.9
529507015631	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 18
529507015632	O antigen biosynthesis locus
529507015633	SpoU rRNA Methylase family; Region: SpoU_methylase; cl17307
529507015634	HMMPfam hit to PF00588, SpoU rRNA Methylase family, score 1.2e-48
529507015635	Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]; Region: WcaG; COG0451
529507015636	UDP glucuronic acid epimerase, extended (e) SDRs; Region: UDP_GE_SDE_e; cd05253
529507015637	putative NAD(P) binding site [chemical binding]; other site
529507015638	active site
529507015639	putative substrate binding site [chemical binding]; other site
529507015640	HMMPfam hit to PF01370, NAD dependent epimerase/dehydratase family, score 1.2e-118
529507015641	UDP-glucose 6-dehydrogenase; Provisional; Region: PRK15057
529507015642	NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family; Region: LDH_MDH_like; cl17195
529507015643	LDH/MDH dimer interface [polypeptide binding]; other site
529507015644	UDP-glucose/GDP-mannose dehydrogenase family, central domain; Region: UDPG_MGDP_dh; pfam00984
529507015645	UDP binding domain; Region: UDPG_MGDP_dh_C; smart00984
529507015646	HMMPfam hit to PF03720, UDP-glucose/GDP-mannose dehydrogenase, score 5.5e-07
529507015647	HMMPfam hit to PF00984, UDP-glucose/GDP-mannose dehydrogenase, score 2.4e-33
529507015648	HMMPfam hit to PF03721, UDP-glucose/GDP-mannose dehydrogenase, score 3.7e-49
529507015649	This family is most closely related to the GT1 family of glycosyltransferases. cap1E in Streptococcus pneumoniae is required for the synthesis of type 1 capsular polysaccharides; Region: GT1_cap1E_like; cd03808
529507015650	Glycosyltransferase [Cell envelope biogenesis, outer membrane]; Region: RfaG; COG0438
529507015651	putative ADP-binding pocket [chemical binding]; other site
529507015652	HMMPfam hit to PF00534, Glycosyl transferases group, score 2.7e-31
529507015653	Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate...; Region: Glycosyltransferase_GTB_type; cl10013
529507015654	Glycosyltransferase [Cell envelope biogenesis, outer membrane]; Region: RfaG; COG0438
529507015655	HMMPfam hit to PF00534, Glycosyl transferases group, score 1.9e-06
529507015656	9 probable transmembrane helices predicted for PMI3192 by TMHMM2.0 at aa 24-46, 61-83, 96-115, 125-147, 164-186, 201-223, 230-252, 310-332 and 358-380
529507015657	This group contains class II terpene cyclases, protein prenyltransferases beta subunit, two broadly specific proteinase inhibitors alpha2-macroglobulin (alpha (2)-M) and pregnancy zone protein (PZP) and, the C3 C4 and C5 components of vertebrate...; Region: ISOPREN_C2_like; cl08267
529507015658	Prenyltransferase-like; Region: Prenyltrans_2; pfam13249
529507015659	Signal peptide predicted for PMI3193 by SignalP 2.0 HMM (Signal peptide probability 0.993) with cleavage site probability 0.932 between residues 43 and 44
529507015660	Membrane protein involved in the export of O-antigen and teichoic acid [General function prediction only]; Region: RfbX; COG2244
529507015661	Multidrug and toxic compound extrusion family and similar proteins; Region: MATE_like; cl09326
529507015662	11 probable transmembrane helices predicted for PMI3194 by TMHMM2.0 at aa 42-64, 77-99, 104-126, 139-156, 160-182, 203-225, 240-262, 274-296, 311-330, 337-359 and 364-386
529507015663	HMMPfam hit to PF01943, Polysaccharide biosynthesis protein, score 5e-11
529507015664	putative glycosyl transferase; Provisional; Region: PRK10073
529507015665	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold; Region: Glyco_tranf_GTA_type; cd00761
529507015666	active site
529507015667	HMMPfam hit to PF00535, Glycosyl transferase, score 1.6e-41
529507015668	Glycosyltransferases involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane]; Region: WcaA; COG0463
529507015669	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold; Region: Glyco_tranf_GTA_type; cd00761
529507015670	active site
529507015671	HMMPfam hit to PF00535, Glycosyl transferase, score 7.1e-43
529507015672	TupA-like ATPgrasp; Region: ATPgrasp_TupA; pfam14305
529507015673	two-component sensor protein; Provisional; Region: cpxA; PRK09470
529507015674	Histidine kinase, Adenylyl cyclase, Methyl-accepting protein, and Phosphatase (HAMP) domain. HAMP is a signaling domain which occurs in a wide variety of signaling proteins, many of which are bacterial. The HAMP domain consists of two alpha helices...; Region: HAMP; cd06225
529507015675	dimerization interface [polypeptide binding]; other site
529507015676	Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via...; Region: HisKA; cd00082
529507015677	dimer interface [polypeptide binding]; other site
529507015678	phosphorylation site [posttranslational modification]
529507015679	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
529507015680	ATP binding site [chemical binding]; other site
529507015681	Mg2+ binding site [ion binding]; other site
529507015682	G-X-G motif; other site
529507015683	HMMPfam hit to PF02518, Histidine kinase-, DNA gyrase B-, and HSP90, score 5.2e-36
529507015684	HMMPfam hit to PF00512, His Kinase A (phosphoacceptor) domain, score 8.3e-18
529507015685	HMMPfam hit to PF00672, HAMP domain, score 3.2e-12
529507015686	2 probable transmembrane helices predicted for PMI3198 by TMHMM2.0 at aa 5-27 and 165-187
529507015687	Signal peptide predicted for PMI3198 by SignalP 2.0 HMM (Signal peptide probability 0.848) with cleavage site probability 0.423 between residues 26 and 27
529507015688	DNA-binding transcriptional regulator CpxR; Provisional; Region: PRK10955
529507015689	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
529507015690	active site
529507015691	phosphorylation site [posttranslational modification]
529507015692	intermolecular recognition site; other site
529507015693	dimerization interface [polypeptide binding]; other site
529507015694	Effector domain of response regulator. Bacteria and certain eukaryotes like protozoa and higher plants use two-component signal transduction systems to detect and respond to changes in the environment. The system consists of a sensor histidine kinase and...; Region: trans_reg_C; cd00383
529507015695	DNA binding site [nucleotide binding]
529507015696	HMMPfam hit to PF00486, Transcriptional regulatory protein, C te, score 1.5e-21
529507015697	HMMPfam hit to PF00072, Response regulator receiver domain, score 8.9e-43
529507015698	CpxP component of the bacterial Cpx-two-component system and related proteins; Region: CpxP_like; cd09916
529507015699	dimer interface [polypeptide binding]; other site
529507015700	Signal peptide predicted for PMI3200 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.961 between residues 22 and 23
529507015701	HMMPfam hit to PF07813, LTXXQ motif, score 0.0032
529507015702	HMMPfam hit to PF07813, LTXXQ motif, score 0.00015
529507015703	Predicted transcriptional regulator [Transcription]; Region: COG2944
529507015704	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
529507015705	non-specific DNA binding site [nucleotide binding]; other site
529507015706	salt bridge; other site
529507015707	sequence-specific DNA binding site [nucleotide binding]; other site
529507015708	HMMPfam hit to PF01381, Helix-turn-helix, score 9.7e-05
529507015709	3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed; Region: PRK12826
529507015710	classical (c) SDRs; Region: SDR_c; cd05233
529507015711	NAD(P) binding site [chemical binding]; other site
529507015712	active site
529507015713	HMMPfam hit to PF00106, short chain dehydrogenase, score 1.9e-68
529507015714	Phosphofructokinase, a key regulatory enzyme in glycolysis, catalyzes the phosphorylation of fructose-6-phosphate to fructose-1,6-biphosphate. The members belong to a subfamily of the PFKA family (cd00363) and include bacterial ATP-dependent...; Region: Bacterial_PFK; cd00763
529507015715	6-phosphofructokinase; Region: PFKA_ATP; TIGR02482
529507015716	active site
529507015717	ADP/pyrophosphate binding site [chemical binding]; other site
529507015718	dimerization interface [polypeptide binding]; other site
529507015719	allosteric effector site; other site
529507015720	fructose-1,6-bisphosphate binding site; other site
529507015721	HMMPfam hit to PF00365, Phosphofructokinase, score 1.7e-180
529507015722	PS00433 Phosphofructokinase signature.
529507015723	sulfate transporter subunit; Provisional; Region: PRK10752
529507015724	Bacterial extracellular solute-binding protein; Region: SBP_bac_11; pfam13531
529507015725	Signal peptide predicted for PMI3204 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.998 between residues 23 and 24
529507015726	HMMPfam hit to PF01547, Bacterial extracellular solute-binding prot, score 4.8e-08
529507015727	PS00757 Prokaryotic sulfate-binding proteins signature 2.
529507015728	Triosephosphate isomerase (TIM) is a glycolytic enzyme that catalyzes the interconversion of dihydroxyacetone phosphate and D-glyceraldehyde-3-phosphate. The reaction is very efficient and requires neither cofactors nor metal ions. TIM, usually...; Region: TIM; cd00311
529507015729	triosephosphate isomerase; Provisional; Region: PRK14567
529507015730	substrate binding site [chemical binding]; other site
529507015731	dimer interface [polypeptide binding]; other site
529507015732	catalytic triad [active]
529507015733	HMMPfam hit to PF00121, Triosephosphate isomerase, score 3.3e-146
529507015734	PS00171 Triosephosphate isomerase active site.
529507015735	PS00017 ATP/GTP-binding site motif A (P-loop).
529507015736	PS00290 Immunoglobulins and major histocompatibility complex proteins signature.
529507015737	Protein of unknown function (DUF1454); Region: DUF1454; pfam07305
529507015738	HMMPfam hit to PF07305, Protein of unknown function (DUF1454), score 9.3e-22
529507015739	Signal peptide predicted for PMI3206 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.908 between residues 27 and 28
529507015740	Predicted membrane protein [Function unknown]; Region: COG3152
529507015741	HMMPfam hit to PF05656, Protein of unknown function (DUF805), score 4.6e-29
529507015742	4 probable transmembrane helices predicted for PMI3207 by TMHMM2.0 at aa 19-36, 40-62, 74-91 and 101-123
529507015743	ferredoxin-NADP reductase; Provisional; Region: PRK10926
529507015744	Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently...; Region: FNR1; cd06195
529507015745	FAD binding pocket [chemical binding]; other site
529507015746	FAD binding motif [chemical binding]; other site
529507015747	phosphate binding motif [ion binding]; other site
529507015748	beta-alpha-beta structure motif; other site
529507015749	NAD binding pocket [chemical binding]; other site
529507015750	HMMPfam hit to PF00175, Oxidoreductase NAD-binding domain, score 3.2e-20
529507015751	HMMPfam hit to PF00970, Oxidoreductase FAD-binding domain, score 5.8e-06
529507015752	multidrug resistance protein D; Provisional; Region: emrD; PRK11652
529507015753	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507015754	putative substrate translocation pore; other site
529507015755	Signal peptide predicted for PMI3209 by SignalP 2.0 HMM (Signal peptide probability 0.957) with cleavage site probability 0.446 between residues 20 and 21
529507015756	12 probable transmembrane helices predicted for PMI3209 by TMHMM2.0 at aa 7-29, 44-66, 75-92, 96-115, 136-158, 163-182, 203-225, 240-262, 275-297, 301-323, 330-352 and 362-384
529507015757	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 2.3e-38
529507015758	glycerol kinase; Provisional; Region: glpK; PRK00047
529507015759	Escherichia coli glycerol kinase-like proteins; belongs to the FGGY family of carbohydrate kinases; Region: FGGY_EcGK_like; cd07786
529507015760	N- and C-terminal domain interface [polypeptide binding]; other site
529507015761	active site
529507015762	MgATP binding site [chemical binding]; other site
529507015763	catalytic site [active]
529507015764	metal binding site [ion binding]; metal-binding site
529507015765	glycerol binding site [chemical binding]; other site
529507015766	homotetramer interface [polypeptide binding]; other site
529507015767	homodimer interface [polypeptide binding]; other site
529507015768	FBP binding site [chemical binding]; other site
529507015769	protein IIAGlc interface [polypeptide binding]; other site
529507015770	HMMPfam hit to PF02782, FGGY family of carbohydrate kinases, C-termi, score 7.3e-103
529507015771	PS00445 FGGY family of carbohydrate kinases signature 2.
529507015772	HMMPfam hit to PF00370, FGGY family of carbohydrate kinases, N-termi, score 5.1e-127
529507015773	PS00933 FGGY family of carbohydrate kinases signature 1.
529507015774	Major intrinsic protein (MIP) superfamily. Members of the MIP superfamily function as membrane channels that selectively transport water, small neutral molecules, and ions out of and between cells. The channel proteins share a common fold: the N-terminal...; Region: MIP; cd00333
529507015775	amphipathic channel; other site
529507015776	Asn-Pro-Ala signature motifs; other site
529507015777	6 probable transmembrane helices predicted for PMI3211 by TMHMM2.0 at aa 13-35, 45-67, 88-110, 144-166, 179-201 and 231-253
529507015778	HMMPfam hit to PF00230, Major intrinsic protein, score 5.1e-110
529507015779	PS00221 MIP family signature.
529507015780	Signal peptide predicted for PMI3211 by SignalP 2.0 HMM (Signal peptide probability 0.817) with cleavage site probability 0.420 between residues 38 and 39
529507015781	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507015782	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG3074
529507015783	HMMPfam hit to PF06005, Protein of unknown function (DUF904), score 2e-42
529507015784	ribonuclease activity regulator protein RraA; Provisional; Region: PRK09372
529507015785	HMMPfam hit to PF03737, Demethylmenaquinone methyltransferase, score 3e-74
529507015786	1,4-dihydroxy-2-naphthoate octaprenyltransferase; Validated; Region: PRK06080
529507015787	UbiA prenyltransferase family; Region: UbiA; pfam01040
529507015788	9 probable transmembrane helices predicted for PMI3214 by TMHMM2.0 at aa 20-42, 46-68, 103-122, 132-149, 156-178, 182-204, 230-252, 256-273 and 286-308
529507015789	HMMPfam hit to PF01040, UbiA prenyltransferase family, score 2.4e-32
529507015790	Signal peptide predicted for PMI3214 by SignalP 2.0 HMM (Signal peptide probability 0.970) with cleavage site probability 0.970 between residues 36 and 37
529507015791	ATP-dependent protease ATP-binding subunit HslU; Provisional; Region: hslU; PRK05201
529507015792	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
529507015793	Walker A motif; other site
529507015794	ATP binding site [chemical binding]; other site
529507015795	AAA domain (Cdc48 subfamily); Region: AAA_2; pfam07724
529507015796	Walker B motif; other site
529507015797	arginine finger; other site
529507015798	C-terminal, D2-small domain, of ClpB protein; Region: ClpB_D2-small; smart01086
529507015799	HMMPfam hit to PF00004, ATPase family associated with various cellul, score 1.7e-06
529507015800	HMMPfam hit to PF07724, ATPase family associated with various cellul, score 7.9e-54
529507015801	PS00017 ATP/GTP-binding site motif A (P-loop).
529507015802	Protease HslV and the ATPase/chaperone HslU are part of an ATP-dependent proteolytic system that is the prokaryotic homolog of the proteasome. HslV is a dimer of hexamers (a dodecamer) that forms a central proteolytic chamber with active sites on the...; Region: protease_HslV; cd01913
529507015803	active site
529507015804	HslU subunit interaction site [polypeptide binding]; other site
529507015805	HMMPfam hit to PF00227, Proteasome A-type and B-type, score 4.3e-47
529507015806	Sporulation related domain; Region: SPOR; cl10051
529507015807	cell division protein FtsN; Provisional; Region: PRK12757
529507015808	Sporulation related domain; Region: SPOR; cl10051
529507015809	HMMPfam hit to PF05036, Sporulation related repeat, score 0.019
529507015810	HMMPfam hit to PF05036, Sporulation related repeat, score 6.3e-07
529507015811	1 probable transmembrane helix predicted for PMI3217 by TMHMM2.0 at aa 21-43
529507015812	Signal peptide predicted for PMI3217 by SignalP 2.0 HMM (Signal peptide probability 0.971) with cleavage site probability 0.534 between residues 43 and 44
529507015813	Helix-turn-helix (HTH) DNA binding domain of the LacI family of transcriptional regulators; Region: HTH_LacI; cd01392
529507015814	DNA binding site [nucleotide binding]
529507015815	DNA-binding transcriptional regulator CytR; Provisional; Region: PRK11041
529507015816	domain linker motif; other site
529507015817	Ligand-binding domain of an uncharacterized transcription regulator from Actinobacillus succinogenes and its close homologs from other bacteria; Region: PBP1_LacI_like_6; cd06284
529507015818	dimerization interface [polypeptide binding]; other site
529507015819	ligand binding site [chemical binding]; other site
529507015820	HMMPfam hit to PF00532, Periplasmic binding proteins and sugar b, score 1.4e-28
529507015821	HMMPfam hit to PF00356, Bacterial regulatory proteins, lacI fami, score 6.8e-11
529507015822	Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]; Region: PriA; COG1198
529507015823	DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region; Region: DEXDc; cd00046
529507015824	ATP binding site [chemical binding]; other site
529507015825	putative Mg++ binding site [ion binding]; other site
529507015826	helicase superfamily c-terminal domain; Region: HELICc; smart00490
529507015827	ATP-binding site [chemical binding]; other site
529507015828	HMMPfam hit to PF00271, Helicase conserved C-terminal domain, score 1.1e-06
529507015829	HMMPfam hit to PF00270, DEAD/DEAH box helicase, score 4.5e-20
529507015830	HMMPfam hit to PF04851, Type III restriction enzyme, res subunit, score 1.7e-08
529507015831	PS00017 ATP/GTP-binding site motif A (P-loop).
529507015832	50S ribosomal protein L31; Reviewed; Region: rpmE; PRK00019
529507015833	HMMPfam hit to PF01197, Ribosomal protein L31, score 2e-39
529507015834	PS00190 Cytochrome c family heme-binding site signature.
529507015835	conserved hypothetical protein (fragment)
529507015836	Met Repressor, MetJ.  MetJ is a bacterial regulatory protein that uses S-adenosylmethionine (SAM) as a corepressor to regulate the production of Methionine. MetJ binds arrays of two to five adjacent copies of an eight base-pair 'metbox'...; Region: Met_repressor_MetJ; cd00490
529507015837	dimerization interface [polypeptide binding]; other site
529507015838	DNA binding site [nucleotide binding]
529507015839	corepressor binding sites; other site
529507015840	HMMPfam hit to PF01340, Met Apo-repressor, MetJ, score 2.3e-83
529507015841	cystathionine gamma-synthase; Provisional; Region: PRK08045
529507015842	CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis. This pathway is unique to microorganisms and plants, rendering the enzyme an attractive target for the development of...; Region: CGS_like; cd00614
529507015843	homodimer interface [polypeptide binding]; other site
529507015844	substrate-cofactor binding pocket; other site
529507015845	pyridoxal 5'-phosphate binding site [chemical binding]; other site
529507015846	catalytic residue [active]
529507015847	HMMPfam hit to PF01053, Cys/Met metabolism PLP-dependent enzy, score 1.6e-197
529507015848	PS00868 Cys/Met metabolism enzymes pyridoxal-phosphate attachment site.
529507015849	bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional; Region: metL; PRK09466
529507015850	AAK_AK-HSDH: Amino Acid Kinase Superfamily (AAK), AK-HSDH; this CD includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK - homoserine dehydrogenase (HSDH). These aspartokinases are found in bacteria (E. coli...; Region: AAK_AK-HSDH; cd04257
529507015851	putative catalytic residues [active]
529507015852	putative nucleotide binding site [chemical binding]; other site
529507015853	putative aspartate binding site [chemical binding]; other site
529507015854	ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme; Region: ACT; cl09141
529507015855	Homoserine dehydrogenase, NAD binding domain; Region: NAD_binding_3; pfam03447
529507015856	Homoserine dehydrogenase; Region: Homoserine_dh; pfam00742
529507015857	HMMPfam hit to PF00696, Amino acid kinase family, score 5e-41
529507015858	PS00324 Aspartokinase signature.
529507015859	HMMPfam hit to PF03447, homoserine dehydrogenase, NAD binding d, score 7.2e-32
529507015860	HMMPfam hit to PF00742, homoserine dehydrogenase, score 3.7e-96
529507015861	PS01042 homoserine dehydrogenase signature.
529507015862	hypothetical protein; Provisional; Region: PRK05208
529507015863	HMMPfam hit to PF03350, Uncharacterized protein family, UPF0114, score 2.7e-95
529507015864	Signal peptide predicted for PMI3225 by SignalP 2.0 HMM (Signal peptide probability 0.658) with cleavage site probability 0.578 between residues 29 and 30
529507015865	4 probable transmembrane helices predicted for PMI3225 by TMHMM2.0 at aa 13-35, 55-77, 109-126 and 136-155
529507015866	phosphoenolpyruvate carboxylase; Reviewed; Region: PRK00009
529507015867	Phosphoenolpyruvate carboxylase [Energy production and conversion]; Region: Ppc; COG2352
529507015868	HMMPfam hit to PF00311, Phosphoenolpyruvate carboxylase, score 7.6e-227
529507015869	PS00781 Phosphoenolpyruvate carboxylase active site 1.
529507015870	PS00393 Phosphoenolpyruvate carboxylase active site 2.
529507015871	putative glycosyl transferase; Provisional; Region: PRK10073
529507015872	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold; Region: Glyco_tranf_GTA_type; cd00761
529507015873	active site
529507015874	HMMPfam hit to PF00535, Glycosyl transferase, score 3.7e-37
529507015875	deoxyribodipyrimidine photolyase; Provisional; Region: PRK10674
529507015876	DNA photolyase; Region: DNA_photolyase; pfam00875
529507015877	HMMPfam hit to PF03441, FAD binding domain of DNA photolyase, score 5.7e-136
529507015878	PS00691 DNA photolyases class 1 signature 2.
529507015879	PS00394 DNA photolyases class 1 signature 1.
529507015880	HMMPfam hit to PF00875, DNA photolyase, score 1.3e-43
529507015881	proline/glycine betaine transporter; Provisional; Region: PRK10642
529507015882	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507015883	putative substrate translocation pore; other site
529507015884	Osmosensory transporter coiled coil; Region: Osmo_CC; pfam08946
529507015885	HMMPfam hit to PF00083, Sugar (and other) transporter, score 6.2e-89
529507015886	12 probable transmembrane helices predicted for PMI3230 by TMHMM2.0 at aa 42-64, 69-91, 98-120, 125-147, 168-190, 200-222, 261-283, 298-320, 327-345, 355-377, 390-412 and 422-440
529507015887	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 1.2e-24
529507015888	PS00216 Sugar transport proteins signature 1.
529507015889	transcriptional regulator CysB; Reviewed; Region: cysB; PRK12681
529507015890	Bacterial regulatory helix-turn-helix protein, lysR family; Region: HTH_1; pfam00126
529507015891	The C-terminal substrate domain of LysR-type transcriptional regulators CysB-like contains type 2 periplasmic binding fold; Region: PBP2_CysB_like; cd08413
529507015892	substrate binding site [chemical binding]; other site
529507015893	dimerization interface [polypeptide binding]; other site
529507015894	HMMPfam hit to PF00126, Bacterial regulatory helix-turn-helix, score 1.9e-15
529507015895	PS00044 Bacterial regulatory proteins, lysR family signature.
529507015896	HMMPfam hit to PF03466, LysR substrate binding domain, score 6.3e-28
529507015897	M20 Peptidase Aminoacylase 1 family; Region: M20_Acy1; cd03886
529507015898	Metal-dependent amidase/aminoacylase/carboxypeptidase [General function prediction only]; Region: AbgB; COG1473
529507015899	metal binding site [ion binding]; metal-binding site
529507015900	dimer interface [polypeptide binding]; other site
529507015901	HMMPfam hit to PF01546, Peptidase family M20/M25/M40, score 7.1e-35
529507015902	HMMPfam hit to PF07687, Peptidase dimerisation domain, score 2.2e-08
529507015903	4 probable transmembrane helices predicted for PMI3233 by TMHMM2.0 at aa 21-43, 53-75, 82-104 and 114-136
529507015904	Protein of unknown function (DUF3100); Region: DUF3100; pfam11299
529507015905	7 probable transmembrane helices predicted for PMI3234 by TMHMM2.0 at aa 7-29, 39-61, 78-100, 110-132, 167-189, 199-221 and 233-255
529507015906	Signal peptide predicted for PMI3234 by SignalP 2.0 HMM (Signal peptide probability 0.952) with cleavage site probability 0.940 between residues 30 and 31
529507015907	pyruvate dehydrogenase; Provisional; Region: PRK09124
529507015908	Pyrimidine (PYR) binding domain of POX; Region: TPP_PYR_POX; cd07039
529507015909	PYR/PP interface [polypeptide binding]; other site
529507015910	dimer interface [polypeptide binding]; other site
529507015911	tetramer interface [polypeptide binding]; other site
529507015912	TPP binding site [chemical binding]; other site
529507015913	Thiamine pyrophosphate enzyme, central domain; Region: TPP_enzyme_M; pfam00205
529507015914	Thiamine pyrophosphate (TPP) family, Pyruvate oxidase (POX) subfamily, TPP-binding module; composed of proteins similar to Lactobacillus plantarum POX, which plays a key role in controlling acetate production under aerobic conditions. POX decarboxylates...; Region: TPP_POX; cd02014
529507015915	TPP-binding site [chemical binding]; other site
529507015916	HMMPfam hit to PF02776, Thiamine pyrophosphate enzyme, N-termina, score 3.1e-72
529507015917	HMMPfam hit to PF00205, Thiamine pyrophosphate enzyme, central d, score 5.2e-38
529507015918	acetylornithine deacetylase; Provisional; Region: PRK05111
529507015919	M20 Peptidase acetylornithine deacetylase; Region: M20_ArgE; cd03894
529507015920	metal binding site [ion binding]; metal-binding site
529507015921	putative dimer interface [polypeptide binding]; other site
529507015922	HMMPfam hit to PF01546, Peptidase family M20/M25/M40, score 1.1e-35
529507015923	HMMPfam hit to PF07687, Peptidase dimerisation domain, score 2.5e-30
529507015924	PS00759 ArgE / dapE / ACY1 / CPG2 / yscS family signature 2.
529507015925	PS00758 ArgE / dapE / ACY1 / CPG2 / yscS family signature 1.
529507015926	N-acetyl-gamma-glutamyl-phosphate reductase; Validated; Region: argC; PRK00436
529507015927	Semialdehyde dehydrogenase, NAD binding domain; Region: Semialdhyde_dh; smart00859
529507015928	HMMPfam hit to PF01118, Semialdehyde dehydrogenase, NAD bindi, score 3.3e-42
529507015929	PS00142 Neutral zinc metallopeptidases, zinc-binding region signature.
529507015930	HMMPfam hit to PF02774, Semialdehyde dehydrogenase, dimerisat, score 3.2e-36
529507015931	AAK_NAGK-NC: N-Acetyl-L-glutamate kinase - noncyclic (NAGK-NC) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of microbial arginine biosynthesis using the acetylated, noncyclic route of...; Region: AAK_NAGK-NC; cd04249
529507015932	nucleotide binding site [chemical binding]; other site
529507015933	N-acetyl-L-glutamate binding site [chemical binding]; other site
529507015934	HMMPfam hit to PF00696, Amino acid kinase family, score 4.7e-40
529507015935	argininosuccinate synthase; Provisional; Region: PRK13820
529507015936	Argininosuccinate synthase. The Argininosuccinate synthase is a urea cycle enzyme that catalyzes the penultimate step in arginine biosynthesis: the ATP-dependent ligation of citrulline to aspartate to form argininosuccinate, AMP and pyrophosphate .  In...; Region: Argininosuccinate_Synthase; cd01999
529507015937	ANP binding site [chemical binding]; other site
529507015938	Substrate Binding Site II [chemical binding]; other site
529507015939	Substrate Binding Site I [chemical binding]; other site
529507015940	HMMPfam hit to PF00764, Arginosuccinate synthase, score 1.4e-177
529507015941	PS00564 Argininosuccinate synthase signature 1.
529507015942	PS00565 Argininosuccinate synthase signature 2.
529507015943	argininosuccinate lyase; Provisional; Region: PRK04833
529507015944	Argininosuccinate lyase (argininosuccinase, ASAL); Region: Argininosuccinate_lyase; cd01359
529507015945	active sites [active]
529507015946	tetramer interface [polypeptide binding]; other site
529507015947	HMMPfam hit to PF00206, Lyase, score 8.8e-130
529507015948	PS00163 Fumarate lyases signature.
529507015949	DNA-binding transcriptional regulator OxyR; Provisional; Region: PRK11151
529507015950	Bacterial regulatory helix-turn-helix protein, lysR family; Region: HTH_1; pfam00126
529507015951	The C-terminal substrate-binding domain of the LysR-type transcriptional regulator OxyR, a member of the type 2 periplasmic binding fold protein superfamily; Region: PBP2_OxyR; cd08411
529507015952	dimerization interface [polypeptide binding]; other site
529507015953	HMMPfam hit to PF00126, Bacterial regulatory helix-turn-helix, score 1.5e-20
529507015954	PS00044 Bacterial regulatory proteins, lysR family signature.
529507015955	HMMPfam hit to PF03466, LysR substrate binding domain, score 4.9e-55
529507015956	PS00139 Eukaryotic thiol (cysteine) proteases cysteine active site.
529507015957	soluble pyridine nucleotide transhydrogenase; Provisional; Region: PRK05249
529507015958	Pyridine nucleotide-disulphide oxidoreductase; Region: Pyr_redox; pfam00070
529507015959	Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain; Region: Pyr_redox_dim; pfam02852
529507015960	HMMPfam hit to PF02852, Pyridine nucleotide-disulphide oxidored, score 2.3e-38
529507015961	HMMPfam hit to PF00070, Pyridine nucleotide-disulphide oxidored, score 1.4e-71
529507015962	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507015963	DNA-binding transcriptional repressor FabR; Provisional; Region: PRK11202
529507015964	Bacterial regulatory proteins, tetR family; Region: TetR_N; pfam00440
529507015965	HMMPfam hit to PF00440, Bacterial regulatory proteins, tetR family, score 1.2e-11
529507015966	hypothetical protein; Provisional; Region: PRK11056
529507015967	HMMPfam hit to PF07226, Protein of unknown function (DUF1422), score 1e-33
529507015968	4 probable transmembrane helices predicted for PMI3244 by TMHMM2.0 at aa 12-30, 34-53, 65-82 and 92-109
529507015969	tRNA (uracil-5-)-methyltransferase; Validated; Region: PRK05031
529507015970	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
529507015971	S-adenosylmethionine binding site [chemical binding]; other site
529507015972	HMMPfam hit to PF05958, tRNA (Uracil-5-)-methyltransferase, score 1.9e-271
529507015973	PS01231 RNA methyltransferase trmA family signature 2.
529507015974	PS01230 RNA methyltransferase trmA family signature 1.
529507015975	vitamin B12/cobalamin outer membrane transporter; Provisional; Region: btuB; PRK10641
529507015976	TonB dependent/Ligand-Gated channels are created by a monomeric 22 strand (22,24) anti-parallel beta-barrel. Ligands apparently bind to the large extracellular loops. The N-terminal 150-200 residues form a plug from the periplasmic end of barrel; Region: ligand_gated_channel; cd01347
529507015977	N-terminal plug; other site
529507015978	ligand-binding site [chemical binding]; other site
529507015979	PS00430 TonB-dependent receptor proteins signature 1.
529507015980	Signal peptide predicted for PMI3246 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.516 between residues 27 and 28
529507015981	HMMPfam hit to PF07715, TonB-dependent Receptor Plug Domain, score 6.7e-25
529507015982	HMMPfam hit to PF00593, TonB dependent receptor, score 2.8e-31
529507015983	This hit extended beyond the end of the feature by 1 aa and was clipped.; PS01156 TonB-dependent receptor proteins signature 2.
529507015984	glutamate racemase; Provisional; Region: PRK00865
529507015985	HMMPfam hit to PF01177, Asp/Glu/Hydantoin racemase, score 8.2e-83
529507015986	PS00923 Aspartate and glutamate racemases signature 1.
529507015987	PS00924 Aspartate and glutamate racemases signature 2.
529507015988	UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional; Region: murB; PRK00046
529507015989	FAD binding domain; Region: FAD_binding_4; pfam01565
529507015990	UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain; Region: MurB_C; pfam02873
529507015991	HMMPfam hit to PF01565, FAD binding domain, score 6.4e-06
529507015992	HMMPfam hit to PF02873, UDP-N-acetylenolpyruvoylglucosamine red, score 3.3e-52
529507015993	Biotin operon repressor [Transcription]; Region: BirA; COG1654
529507015994	bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin operon repressor; Provisional; Region: PRK11886
529507015995	Biotin/lipoate A/B protein ligase family; Region: BPL_LplA_LipB; pfam03099
529507015996	Biotin protein ligase C terminal domain; Region: BPL_C; pfam02237
529507015997	HMMPfam hit to PF03099, Biotin/lipoate A/B protein ligase famil, score 5.7e-37
529507015998	HMMPfam hit to PF02237, Biotin protein ligase C terminal domain, score 8.6e-11
529507015999	pantothenate kinase; Provisional; Region: PRK05439
529507016000	Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway. The reaction carried out by this enzyme is a key regulatory point...; Region: PanK; cd02025
529507016001	ATP-binding site [chemical binding]; other site
529507016002	CoA-binding site [chemical binding]; other site
529507016003	Mg2+-binding site [ion binding]; other site
529507016004	HMMPfam hit to PF00485, Phosphoribulokinase / Uridine kinase family, score 4.9e-07
529507016005	PS00017 ATP/GTP-binding site motif A (P-loop).
529507016006	elongation factor Tu; Reviewed; Region: PRK00049
529507016007	Elongation Factor Tu (EF-Tu) GTP-binding proteins; Region: EF_Tu; cd01884
529507016008	G1 box; other site
529507016009	GEF interaction site [polypeptide binding]; other site
529507016010	GTP/Mg2+ binding site [chemical binding]; other site
529507016011	Switch I region; other site
529507016012	G2 box; other site
529507016013	G3 box; other site
529507016014	Switch II region; other site
529507016015	G4 box; other site
529507016016	G5 box; other site
529507016017	EFTU_II: Elongation factor Tu domain II. Elongation factors Tu (EF-Tu) are three-domain GTPases with an essential function in the elongation phase of mRNA translation. The GTPase center of EF-Tu is in the N-terminal domain (domain I), also known as the...; Region: EFTU_II; cd03697
529507016018	Domain III of elongation factor (EF) Tu. Ef-Tu consists of three structural domains, designated I, II and III. Domain III adopts a beta barrel structure. Domain III is involved in binding to both charged tRNA and binding to elongation factor Ts (EF-Ts); Region: EFTU_III; cd03707
529507016019	Antibiotic Binding Site [chemical binding]; other site
529507016020	HMMPfam hit to PF00009, Elongation factor Tu GTP binding domain, score 7e-98
529507016021	PS00017 ATP/GTP-binding site motif A (P-loop).
529507016022	PS00301 GTP-binding elongation factors signature.
529507016023	HMMPfam hit to PF03144, Elongation factor Tu domain, score 8e-26
529507016024	HMMPfam hit to PF03143, Elongation factor Tu C-terminal domain, score 9.6e-62
529507016025	BFD-like [2Fe-2S] binding domain; Region: Fer2_BFD; cl01093
529507016026	HMMPfam hit to PF04324, BFD-like [2Fe-2S] binding domain, score 6.3e-16
529507016027	Bacterioferritin (cytochrome b1) [Inorganic ion transport and metabolism]; Region: Bfr; COG2193
529507016028	Bacterioferritin, ferritin-like diiron-binding domain; Region: Bacterioferritin; cd00907
529507016029	heme binding site [chemical binding]; other site
529507016030	ferroxidase pore; other site
529507016031	ferroxidase diiron center [ion binding]; other site
529507016032	HMMPfam hit to PF00210, Ferritin-like domain, score 1.3e-50
529507016033	30S ribosomal protein S10; Reviewed; Region: rpsJ; PRK00596
529507016034	HMMPfam hit to PF00338, Ribosomal protein S10p/S20e, score 7.9e-61
529507016035	PS00361 Ribosomal protein S10 signature.
529507016036	50S ribosomal protein L3, bacterial; Region: L3_bact; TIGR03625
529507016037	HMMPfam hit to PF00297, Ribosomal protein L3, score 1.4e-103
529507016038	PS00474 Ribosomal protein L3 signature.
529507016039	50S ribosomal protein L4; Provisional; Region: rplD; PRK05319
529507016040	HMMPfam hit to PF00573, Ribosomal protein L4/L1 family, score 3.4e-57
529507016041	50S ribosomal protein L23; Reviewed; Region: rplW; PRK05738
529507016042	HMMPfam hit to PF00276, Ribosomal protein L23, score 1.9e-43
529507016043	PS00050 Ribosomal protein L23 signature.
529507016044	50S ribosomal protein L2; Validated; Region: rplB; PRK09374
529507016045	Ribosomal Proteins L2, RNA binding domain; Region: Ribosomal_L2; pfam00181
529507016046	Ribosomal Proteins L2, C-terminal domain; Region: Ribosomal_L2_C; pfam03947
529507016047	HMMPfam hit to PF00181, Ribosomal Proteins L2, RNA binding dom, score 4.1e-46
529507016048	HMMPfam hit to PF03947, Ribosomal Proteins L2, C-terminal doma, score 2.5e-85
529507016049	PS00467 Ribosomal protein L2 signature.
529507016050	30S ribosomal protein S19; Reviewed; Region: rpsS; PRK00357
529507016051	HMMPfam hit to PF00203, Ribosomal protein S19, score 8.3e-55
529507016052	PS00323 Ribosomal protein S19 signature.
529507016053	Ribosomal protein L22/L17e.  L22 (L17 in eukaryotes) is a core protein of the large ribosomal subunit.  It is the only ribosomal protein that interacts with all six domains of 23S rRNA, and is one of the proteins important for directing the proper...; Region: Ribosomal_L22; cd00336
529507016054	protein-rRNA interface [nucleotide binding]; other site
529507016055	putative translocon binding site; other site
529507016056	HMMPfam hit to PF00237, Ribosomal protein L22p/L17e, score 6.7e-58
529507016057	PS00464 Ribosomal protein L22 signature.
529507016058	30S ribosomal protein S3; Reviewed; Region: rpsC; PRK00310
529507016059	K homology RNA-binding (KH) domain of the prokaryotic 30S small ribosomal subunit protein S3. S3  is part of the head region of the 30S ribosomal subunit and is believed to interact with mRNA as it threads its way from the latch into the channel.  The KH...; Region: 30S_S3_KH; cd02412
529507016060	G-X-X-G motif; other site
529507016061	Ribosomal protein S3, C-terminal domain; Region: Ribosomal_S3_C; pfam00189
529507016062	HMMPfam hit to PF00417, Ribosomal protein S3, N-terminal domai, score 4.3e-28
529507016063	HMMPfam hit to PF07650, KH domain, score 3.9e-20
529507016064	HMMPfam hit to PF00189, Ribosomal protein S3, C-terminal domai, score 1.2e-54
529507016065	PS00548 Ribosomal protein S3 signature.
529507016066	Ribosomal_L16_L10e: L16 is an essential protein in the large ribosomal subunit of bacteria, mitochondria, and chloroplasts. Large subunits that lack L16 are defective in peptidyl transferase activity, peptidyl-tRNA hydrolysis activity, association with...; Region: Ribosomal_L16_L10e; cd01433
529507016067	23S rRNA interface [nucleotide binding]; other site
529507016068	5S rRNA interface [nucleotide binding]; other site
529507016069	putative antibiotic binding site [chemical binding]; other site
529507016070	L25 interface [polypeptide binding]; other site
529507016071	L27 interface [polypeptide binding]; other site
529507016072	HMMPfam hit to PF00252, Ribosomal protein L16, score 1.2e-92
529507016073	PS00586 Ribosomal protein L16 signature 1.
529507016074	PS00701 Ribosomal protein L16 signature 2.
529507016075	Ribosomal L29 protein/HIP.  L29 is a protein of the large ribosomal Subunit. A homolog, called heparin/heparan sulfate interacting protein (HIP), has also been identified in mammals.  L29 is located on the surface of the large ribosomal subunit, where it...; Region: Ribosomal_L29_HIP; cd00427
529507016076	23S rRNA interface [nucleotide binding]; other site
529507016077	putative translocon interaction site; other site
529507016078	signal recognition particle (SRP54) interaction site; other site
529507016079	L23 interface [polypeptide binding]; other site
529507016080	trigger factor interaction site; other site
529507016081	HMMPfam hit to PF00831, Ribosomal L29 protein, score 9.1e-29
529507016082	PS00579 Ribosomal protein L29 signature.
529507016083	30S ribosomal protein S17; Reviewed; Region: rpsQ; PRK05610
529507016084	HMMPfam hit to PF00366, Ribosomal protein S17, score 1e-40
529507016085	PS00056 Ribosomal protein S17 signature.
529507016086	50S ribosomal protein L14; Validated; Region: rplN; PRK05483
529507016087	HMMPfam hit to PF00238, Ribosomal protein L14p/L23e, score 4.3e-78
529507016088	PS00049 Ribosomal protein L14 signature.
529507016089	50S ribosomal protein L24; Reviewed; Region: rplX; PRK00004
529507016090	KOW motif of Ribosomal Protein L26; Region: KOW_RPL26; cd06089
529507016091	RNA binding site [nucleotide binding]; other site
529507016092	HMMPfam hit to PF00467, KOW motif, score 4.7e-06
529507016093	PS01108 Ribosomal protein L24 signature.
529507016094	50S ribosomal protein L5; Validated; Region: rplE; PRK00010
529507016095	Ribosomal protein L5; Region: Ribosomal_L5; pfam00281
529507016096	ribosomal L5P family C-terminus; Region: Ribosomal_L5_C; pfam00673
529507016097	HMMPfam hit to PF00281, Ribosomal protein L5, score 1.4e-33
529507016098	PS00358 Ribosomal protein L5 signature.
529507016099	HMMPfam hit to PF00673, ribosomal L5P family C-terminus, score 4.3e-59
529507016100	30S ribosomal protein S14; Reviewed; Region: rpsN; PRK08881
529507016101	HMMPfam hit to PF00253, Ribosomal protein S14p/S29e, score 1.1e-24
529507016102	PS00527 Ribosomal protein S14 signature.
529507016103	30S ribosomal protein S8; Validated; Region: rpsH; PRK00136
529507016104	HMMPfam hit to PF00410, Ribosomal protein S8, score 8.3e-72
529507016105	PS00053 Ribosomal protein S8 signature.
529507016106	This hit extended beyond the end of the feature by 1 aa and was clipped.; PS00294 Prenyl group binding site (CAAX box).
529507016107	50S ribosomal protein L6; Validated; Region: rplF; PRK05498
529507016108	Ribosomal protein L6; Region: Ribosomal_L6; pfam00347
529507016109	Ribosomal protein L6; Region: Ribosomal_L6; pfam00347
529507016110	HMMPfam hit to PF00347, Ribosomal protein L6, score 1e-22
529507016111	HMMPfam hit to PF00347, Ribosomal protein L6, score 8.2e-30
529507016112	PS00525 Ribosomal protein L6 signature 1.
529507016113	Ribosomal L18/L5e:  L18 (L5e) is a ribosomal protein found in the central protuberance (CP) of the large subunit. L18 binds 5S rRNA and induces a conformational change that stimulates the binding of L5 to 5S rRNA. Association of 5S rRNA with 23S rRNA...; Region: Ribosomal_L18_L5e; cd00432
529507016114	5S rRNA interface [nucleotide binding]; other site
529507016115	23S rRNA interface [nucleotide binding]; other site
529507016116	L5 interface [polypeptide binding]; other site
529507016117	HMMPfam hit to PF00861, Ribosomal L18p/L5e family, score 5.3e-53
529507016118	30S ribosomal protein S5; Validated; Region: rpsE; PRK00550
529507016119	Ribosomal protein S5, N-terminal domain; Region: Ribosomal_S5; pfam00333
529507016120	Ribosomal protein S5, C-terminal domain; Region: Ribosomal_S5_C; pfam03719
529507016121	HMMPfam hit to PF00333, Ribosomal protein S5, N-terminal domai, score 6.7e-40
529507016122	PS00585 Ribosomal protein S5 signature.
529507016123	HMMPfam hit to PF03719, Ribosomal protein S5, C-terminal domai, score 5.4e-40
529507016124	Ribosomal protein L30, which is found in eukaryotes and prokaryotes but not in archaea, is one of the smallest ribosomal proteins with a molecular mass of about 7kDa. L30 binds the 23SrRNA as well as the 5S rRNA and is one of five ribosomal proteins that...; Region: Ribosomal_L30; cd01658
529507016125	23S rRNA binding site [nucleotide binding]; other site
529507016126	HMMPfam hit to PF00327, Ribosomal protein L30p/L7e, score 6.2e-25
529507016127	PS00634 Ribosomal protein L30 signature.
529507016128	50S ribosomal protein L15; Reviewed; Region: rplO; PRK05592
529507016129	HMMPfam hit to PF01305, Ribosomal protein L15 amino terminal re, score 4.6e-57
529507016130	HMMPfam hit to PF00256, Ribosomal protein L15, score 1.6e-08
529507016131	PS00475 Ribosomal protein L15 signature.
529507016132	preprotein translocase subunit SecY; Reviewed; Region: secY; PRK09204
529507016133	SecY translocase; Region: SecY; pfam00344
529507016134	10 probable transmembrane helices predicted for PMI3275 by TMHMM2.0 at aa 22-44, 76-98, 119-138, 153-175, 182-204, 215-237, 273-295, 315-337, 369-391 and 401-423
529507016135	HMMPfam hit to PF00344, eubacterial secY protein, score 3.1e-197
529507016136	PS00755 Protein secY signature 1.
529507016137	PS00756 Protein secY signature 2.
529507016138	PS00095 C-5 cytosine-specific DNA methylases C-terminal signature.
529507016139	PS00027 'Homeobox' domain signature.
529507016140	Ribosomal protein L36; Region: Ribosomal_L36; pfam00444
529507016141	HMMPfam hit to PF00444, Ribosomal protein L36, score 9.6e-16
529507016142	PS00828 Ribosomal protein L36 signature.
529507016143	30S ribosomal protein S13; Validated; Region: rpsM; PRK05179
529507016144	30S ribosomal protein S13; Region: bact_S13; TIGR03631
529507016145	HMMPfam hit to PF00416, Ribosomal protein S13/S18, score 2.9e-59
529507016146	PS00061 Short-chain dehydrogenases/reductases family signature.
529507016147	PS00646 Ribosomal protein S13 signature.
529507016148	30S ribosomal protein S11; Validated; Region: PRK05309
529507016149	HMMPfam hit to PF00411, Ribosomal protein S11, score 2.9e-76
529507016150	PS00054 Ribosomal protein S11 signature.
529507016151	30S ribosomal protein S4; Validated; Region: rpsD; PRK05327
529507016152	Ribosomal protein S4/S9 N-terminal domain; Region: Ribosomal_S4; pfam00163
529507016153	S4/Hsp/ tRNA synthetase RNA-binding domain; The domain surface is populated by conserved, charged residues that define a likely RNA-binding site;  Found in stress proteins, ribosomal proteins and tRNA synthetases; This may imply a hitherto unrecognized...; Region: S4; cd00165
529507016154	RNA binding surface [nucleotide binding]; other site
529507016155	HMMPfam hit to PF00163, Ribosomal protein S4/S9 N-terminal domai, score 1e-35
529507016156	PS00632 Ribosomal protein S4 signature.
529507016157	HMMPfam hit to PF01479, S4 domain, score 5e-21
529507016158	DNA-directed RNA polymerase subunit alpha; Provisional; Region: PRK05182
529507016159	N-terminal domain of the Alpha subunit of Bacterial RNA polymerase; Region: RNAP_alpha_NTD; cd06928
529507016160	alphaNTD homodimer interface [polypeptide binding]; other site
529507016161	alphaNTD - beta interaction site [polypeptide binding]; other site
529507016162	alphaNTD - beta' interaction site [polypeptide binding]; other site
529507016163	Bacterial RNA polymerase, alpha chain C terminal domain; Region: RNA_pol_A_CTD; pfam03118
529507016164	HMMPfam hit to PF01193, RNA polymerase Rpb3/Rpb11 dimerisation, score 1.1e-20
529507016165	HMMPfam hit to PF01000, RNA polymerase Rpb3/RpoA insert domain, score 3.6e-56
529507016166	HMMPfam hit to PF03118, Bacterial RNA polymerase, alpha chain C, score 1.8e-35
529507016167	50S ribosomal protein L17; Validated; Region: rplQ; PRK05591
529507016168	HMMPfam hit to PF01196, Ribosomal protein L17, score 2.6e-66
529507016169	PS01167 Ribosomal protein L17 signature.
529507016170	zinc-responsive transcriptional regulator; Provisional; Region: zntR; PRK09514
529507016171	Helix-Turn-Helix DNA binding domain of Heavy Metal Resistance transcription regulators; Region: HTH_HMRTR; cd04770
529507016172	DNA binding residues [nucleotide binding]
529507016173	dimer interface [polypeptide binding]; other site
529507016174	metal binding site [ion binding]; metal-binding site
529507016175	HMMPfam hit to PF00376, MerR family regulatory protein, score 1.4e-12
529507016176	PS00552 Bacterial regulatory proteins, merR family signature.
529507016177	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG3036
529507016178	HMMPfam hit to PF03889, Domain of unknown function, score 8.1e-31
529507016179	Large-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane]; Region: MscL; COG1970
529507016180	large-conductance mechanosensitive channel; Reviewed; Region: mscL; PRK00567
529507016181	HMMPfam hit to PF01741, Large-conductance mechanosensitive channel,, score 3.9e-83
529507016182	2 probable transmembrane helices predicted for PMI3284 by TMHMM2.0 at aa 20-42 and 77-99
529507016183	PS01327 Large-conductance mechanosensitive channels mscL family signature.
529507016184	potassium transporter peripheral membrane component; Reviewed; Region: trkA; PRK09496
529507016185	TrkA-N domain; Region: TrkA_N; pfam02254
529507016186	TrkA-C domain; Region: TrkA_C; pfam02080
529507016187	TrkA-N domain; Region: TrkA_N; pfam02254
529507016188	TrkA-C domain; Region: TrkA_C; pfam02080
529507016189	HMMPfam hit to PF02080, TrkA-C domain, score 2.7e-13
529507016190	HMMPfam hit to PF02254, TrkA-N domain, score 2.4e-11
529507016191	HMMPfam hit to PF02080, TrkA-C domain, score 9.7e-12
529507016192	HMMPfam hit to PF02254, TrkA-N domain, score 4.5e-21
529507016193	16S rRNA methyltransferase B; Provisional; Region: PRK10901
529507016194	N-terminal RNA binding domain of the methyltransferase Sun. The rRNA-specific 5-methylcytidine transferase Sun, also known as RrmB or Fmu shares the RNA-binding non-catalytic domain with the transcription termination factor NusB. The precise biological...; Region: Methyltransferase_Sun; cd00620
529507016195	putative RNA binding site [nucleotide binding]; other site
529507016196	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
529507016197	S-adenosylmethionine binding site [chemical binding]; other site
529507016198	HMMPfam hit to PF01189, NOL1/NOP2/sun family, score 3.9e-112
529507016199	PS01153 NOL1/NOP2/sun family signature.
529507016200	HMMPfam hit to PF01029, NusB family, score 5.1e-45
529507016201	methionyl-tRNA formyltransferase; Reviewed; Region: fmt; PRK00005
529507016202	Methionyl-tRNA formyltransferase, N-terminal hydrolase domain; Region: FMT_core_Met-tRNA-FMT_N; cd08646
529507016203	putative active site [active]
529507016204	substrate binding site [chemical binding]; other site
529507016205	putative cosubstrate binding site; other site
529507016206	catalytic site [active]
529507016207	C-terminal domain of Formyltransferase and other enzymes; Region: Met_tRNA_FMT_C; cd08704
529507016208	substrate binding site [chemical binding]; other site
529507016209	HMMPfam hit to PF02911, Formyl transferase, C-terminal domain, score 1.1e-40
529507016210	HMMPfam hit to PF00551, Formyl transferase, score 1.8e-71
529507016211	PS00373 Phosphoribosylglycinamide formyltransferase active site.
529507016212	Polypeptide or peptide deformylase; a family of metalloenzymes that catalyzes the removal of the N-terminal formyl group in a growing polypeptide chain following translation initiation during protein synthesis in prokaryotes. These enzymes utilize Fe(II)...; Region: Pep_deformylase; cd00487
529507016213	active site
529507016214	catalytic residues [active]
529507016215	metal binding site [ion binding]; metal-binding site
529507016216	HMMPfam hit to PF01327, Polypeptide deformylase, score 9.3e-83
529507016217	hypothetical protein; Provisional; Region: PRK10736
529507016218	DNA protecting protein DprA; Region: dprA; TIGR00732
529507016219	HMMPfam hit to PF02481, SMF family, score 7.8e-97
529507016220	Topoisomerase DNA binding C4 zinc finger; Region: zf-C4_Topoisom; pfam01396
529507016221	Zn-finger domain associated with topoisomerase type I [DNA replication, recombination, and repair]; Region: TopA; COG0551
529507016222	Topoisomerase DNA binding C4 zinc finger; Region: zf-C4_Topoisom; pfam01396
529507016223	Topoisomerase DNA binding C4 zinc finger; Region: zf-C4_Topoisom; pfam01396
529507016224	HMMPfam hit to PF01396, Topoisomerase DNA binding C4 zinc fing, score 7.2e-17
529507016225	HMMPfam hit to PF01396, Topoisomerase DNA binding C4 zinc fing, score 2.8e-17
529507016226	HMMPfam hit to PF01396, Topoisomerase DNA binding C4 zinc fing, score 1.8e-14
529507016227	tRNA(ANN) t(6)A37 threonylcarbamoyladenosine modification protein; Provisional; Region: PRK10634
529507016228	HMMPfam hit to PF01300, yrdC domain, score 2.7e-67
529507016229	PS01147 SUA5/yciO/yrdC family signature.
529507016230	shikimate 5-dehydrogenase; Reviewed; Region: aroE; PRK00258
529507016231	Shikimate dehydrogenase substrate binding domain; Region: Shikimate_dh_N; pfam08501
529507016232	NAD(P) binding domain of Shikimate dehydrogenase; Region: NAD_bind_Shikimate_DH; cd01065
529507016233	NAD(P) binding site [chemical binding]; other site
529507016234	shikimate binding site; other site
529507016235	HMMPfam hit to PF01488, Shikimate / quinate 5-dehydrogenase, score 4.6e-86
529507016236	Protein of unknown function (DUF1488); Region: DUF1488; pfam07369
529507016237	HMMPfam hit to PF07369, Protein of unknown function (DUF1488), score 4.4e-15
529507016238	Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only]; Region: PaaY; COG0663
529507016239	Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E. coli paaY protein, and similar proteins. CAs are zinc-containing enzymes that catalyze the reversible hydration of carbon...; Region: LbH_gamma_CA_like; cd04645
529507016240	trimer interface [polypeptide binding]; other site
529507016241	putative metal binding site [ion binding]; other site
529507016242	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 2
529507016243	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 1.2
529507016244	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 30
529507016245	HMMPfam hit to PF00132, Bacterial transferase hexapeptide (three rep, score 7.7
529507016246	transcriptional regulator HdfR; Provisional; Region: PRK03601
529507016247	Bacterial regulatory helix-turn-helix protein, lysR family; Region: HTH_1; pfam00126
529507016248	LysR substrate binding domain; Region: LysR_substrate; pfam03466
529507016249	dimerization interface [polypeptide binding]; other site
529507016250	HMMPfam hit to PF03466, LysR substrate binding domain, score 4.1e-05
529507016251	HMMPfam hit to PF00126, Bacterial regulatory helix-turn-helix, score 1.4e-17
529507016252	PS00044 Bacterial regulatory proteins, lysR family signature.
529507016253	hypothetical protein; Provisional; Region: PRK11027
529507016254	HMMPfam hit to PF04219, Protein of unknown function, DUF, score 4.2e-50
529507016255	putative ATP-dependent protease; Provisional; Region: PRK09862
529507016256	Subunit ChlI of Mg-chelatase; Region: ChlI; pfam13541
529507016257	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
529507016258	Walker A motif; other site
529507016259	ATP binding site [chemical binding]; other site
529507016260	Walker B motif; other site
529507016261	arginine finger; other site
529507016262	Magnesium chelatase, subunit ChlI; Region: Mg_chelatase_2; pfam13335
529507016263	HMMPfam hit to PF01078, Magnesium chelatase, subunit ChlI, score 4.7e-67
529507016264	PS00017 ATP/GTP-binding site motif A (P-loop).
529507016265	1 probable transmembrane helix predicted for PMI3298 by TMHMM2.0 at aa 26-48
529507016266	acetolactate synthase 2 catalytic subunit; Reviewed; Region: PRK08978
529507016267	Pyrimidine (PYR) binding domain of POX and related proteins; Region: TPP_PYR_POX_like; cd07035
529507016268	PYR/PP interface [polypeptide binding]; other site
529507016269	dimer interface [polypeptide binding]; other site
529507016270	TPP binding site [chemical binding]; other site
529507016271	Thiamine pyrophosphate enzyme, central domain; Region: TPP_enzyme_M; pfam00205
529507016272	Thiamine pyrophosphate (TPP) family, Acetohydroxyacid synthase (AHAS) subfamily, TPP-binding module; composed of proteins similar to the large catalytic subunit of AHAS. AHAS catalyzes the condensation of two molecules of pyruvate to give the...; Region: TPP_AHAS; cd02015
529507016273	TPP-binding site [chemical binding]; other site
529507016274	dimer interface [polypeptide binding]; other site
529507016275	HMMPfam hit to PF02776, Thiamine pyrophosphate enzyme, N-termina, score 1.9e-94
529507016276	PS00044 Bacterial regulatory proteins, lysR family signature.
529507016277	HMMPfam hit to PF00205, Thiamine pyrophosphate enzyme, central d, score 1.1e-63
529507016278	PS00187 Thiamine pyrophosphate enzymes signature.
529507016279	acetolactate synthase 2 regulatory subunit; Provisional; Region: ilvM; PRK11152
529507016280	Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase [Amino acid transport and metabolism / Coenzyme metabolism]; Region: IlvE; COG0115
529507016281	BCAT_beta_family: Branched-chain aminotransferase catalyses the transamination of the branched-chain amino acids  leusine, isoleucine and valine to their respective alpha-keto acids, alpha-ketoisocaproate, alpha-keto-beta-methylvalerate and...; Region: BCAT_beta_family; cd01557
529507016282	homodimer interface [polypeptide binding]; other site
529507016283	substrate-cofactor binding pocket; other site
529507016284	catalytic residue [active]
529507016285	HMMPfam hit to PF01063, Aminotransferase class IV, score 1.6e-137
529507016286	PS00770 Aminotransferases class-IV signature.
529507016287	dihydroxy-acid dehydratase; Provisional; Region: PRK12448
529507016288	HMMPfam hit to PF00920, Dehydratase family, score 0
529507016289	PS00886 Dihydroxy-acid and 6-phosphogluconate dehydratases signature 1.
529507016290	PS00017 ATP/GTP-binding site motif A (P-loop).
529507016291	PS00887 Dihydroxy-acid and 6-phosphogluconate dehydratases signature 2.
529507016292	threonine dehydratase; Reviewed; Region: PRK09224
529507016293	Threonine dehydratase: The first step in amino acid degradation is the removal of nitrogen. Although the nitrogen atoms of most amino acids are transferred to alpha-ketoglutarate before removal, the alpha-amino group of threonine can be directly...; Region: Thr-dehyd; cd01562
529507016294	tetramer interface [polypeptide binding]; other site
529507016295	pyridoxal 5'-phosphate binding site [chemical binding]; other site
529507016296	catalytic residue [active]
529507016297	First of two tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase); Region: ACT_ThrD-I_1; cd04906
529507016298	putative Ile/Val binding site [chemical binding]; other site
529507016299	Second of two tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase); Region: ACT_ThrD-I_2; cd04907
529507016300	putative Ile/Val binding site [chemical binding]; other site
529507016301	HMMPfam hit to PF00291, Pyridoxal-phosphate dependent enzyme, score 2.1e-96
529507016302	PS00165 Serine/threonine dehydratases pyridoxal-phosphate attachment site.
529507016303	HMMPfam hit to PF00585, C-terminal regulatory domain of Threon, score 7.3e-40
529507016304	HMMPfam hit to PF00585, C-terminal regulatory domain of Threon, score 1.7e-39
529507016305	Bacterial regulatory helix-turn-helix protein, lysR family; Region: HTH_1; pfam00126
529507016306	DNA-binding transcriptional regulator IlvY; Provisional; Region: PRK11716
529507016307	The C-terminal substrate binding of LysR-type transcriptional regulator IlvY, which activates the expression of ilvC gene that encoding acetohydroxy acid isomeroreductase for the biosynthesis of branched amino acids; contains the type 2 periplasmic bindin; Region: PBP2_IlvY; cd08430
529507016308	putative dimerization interface [polypeptide binding]; other site
529507016309	HMMPfam hit to PF03466, LysR substrate binding domain, score 2.5e-30
529507016310	HMMPfam hit to PF00126, Bacterial regulatory helix-turn-helix, score 3e-23
529507016311	PS00044 Bacterial regulatory proteins, lysR family signature.
529507016312	ketol-acid reductoisomerase; Validated; Region: PRK05225
529507016313	Acetohydroxy acid isomeroreductase, catalytic domain; Region: IlvN; pfam07991
529507016314	Acetohydroxy acid isomeroreductase, catalytic domain; Region: IlvC; pfam01450
529507016315	Acetohydroxy acid isomeroreductase, catalytic domain; Region: IlvC; pfam01450
529507016316	HMMPfam hit to PF01450, Acetohydroxy acid isomeroreductase, catalyti, score 4e-133
529507016317	Transposase IS200 like; Region: Y1_Tnp; pfam01797
529507016318	HMMPfam hit to PF01797, Transposase IS200 like, score 2.1e-35
529507016319	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507016320	Helix-turn-helix domain; Region: HTH_OrfB_IS605; pfam12323
529507016321	Transposase and inactivated derivatives [DNA replication, recombination, and repair]; Region: COG0675
529507016322	Probable transposase; Region: OrfB_IS605; pfam01385
529507016323	transposase, IS605 OrfB family, central region; Region: tspaseT_teng_C; TIGR01766
529507016324	HMMPfam hit to PF01385, Probable transposase, score 2.3e-130
529507016325	HMMPfam hit to PF07282, transposase DNA-binding domai, score 3.9e-32
529507016326	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507016327	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG3041
529507016328	HMMPfam hit to PF05016, Plasmid stabilisation system protein, score 1.4e-08
529507016329	ATP-dependent DNA helicase Rep; Provisional; Region: PRK10919
529507016330	Part of AAA domain; Region: AAA_19; pfam13245
529507016331	Family description; Region: UvrD_C_2; pfam13538
529507016332	HMMPfam hit to PF00580, UvrD/REP helicase, score 2.3e-213
529507016333	PS00017 ATP/GTP-binding site motif A (P-loop).
529507016334	guanosine pentaphosphate phosphohydrolase; Provisional; Region: PRK11031
529507016335	Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily; Region: NBD_sugar-kinase_HSP70_actin; cd00012
529507016336	nucleotide binding site [chemical binding]; other site
529507016337	HMMPfam hit to PF02541, Ppx/GppA phosphatase family, score 1.3e-117
529507016338	ATP-dependent RNA helicase RhlB; Provisional; Region: PRK04837
529507016339	DEAD-box helicases. A diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker  B motif; Region: DEADc; cd00268
529507016340	ATP binding site [chemical binding]; other site
529507016341	Mg++ binding site [ion binding]; other site
529507016342	motif III; other site
529507016343	Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may...; Region: HELICc; cd00079
529507016344	nucleotide binding region [chemical binding]; other site
529507016345	ATP-binding site [chemical binding]; other site
529507016346	HMMPfam hit to PF00271, Helicase conserved C-terminal domain, score 1.2e-34
529507016347	HMMPfam hit to PF00270, DEAD/DEAH box helicase, score 1.3e-56
529507016348	PS00039 DEAD-box subfamily ATP-dependent helicases signature.
529507016349	PS00017 ATP/GTP-binding site motif A (P-loop).
529507016350	TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains. Group I TRX is a small ancient protein that alter the redox...; Region: TRX_family; cd02947
529507016351	Thioredoxin-like; Region: Thioredoxin_8; pfam13905
529507016352	catalytic residues [active]
529507016353	HMMPfam hit to PF00085, Thioredoxin, score 1.8e-47
529507016354	PS00194 Thioredoxin family active site.
529507016355	transcription termination factor Rho; Provisional; Region: rho; PRK09376
529507016356	Rho termination factor, N-terminal domain; Region: Rho_N; smart00959
529507016357	Rho_CSD: Rho protein cold-shock domain (CSD). Rho protein is a transcription termination factor in most bacteria. In bacteria, there are two distinct mechanisms for mRNA transcription termination. In intrinsic termination, RNA polymerase and nascent mRNA...; Region: Rho_CSD; cd04459
529507016358	RNA binding site [nucleotide binding]; other site
529507016359	Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase. It is a homohexamer. Each monomer consists of an N-terminal domain of the OB fold, which is responsible for binding to cysteine rich nucleotides. This alignment is of the...; Region: rho_factor; cd01128
529507016360	multimer interface [polypeptide binding]; other site
529507016361	Walker A motif; other site
529507016362	ATP binding site [chemical binding]; other site
529507016363	Walker B motif; other site
529507016364	HMMPfam hit to PF07498, Rho termination factor, N-terminal domai, score 4.1e-20
529507016365	HMMPfam hit to PF07497, Rho termination factor, RNA-binding doma, score 2.1e-58
529507016366	HMMPfam hit to PF00006, ATP synthase alpha/beta family, nucleoti, score 1e-68
529507016367	PS00017 ATP/GTP-binding site motif A (P-loop).
529507016368	1 probable transmembrane helix predicted for PMI3315 by TMHMM2.0 at aa 2-24
529507016369	undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase; Provisional; Region: PRK15119
529507016370	This subfamily contains Escherichia coli WecA, Bacillus subtilis TagO and related proteins. WecA is an UDP-N-acetylglucosamine (GlcNAc):undecaprenyl-phosphate (Und-P) GlcNAc-1-phosphate transferase that catalyzes the formation of a phosphodiester bond...; Region: GT_WecA_like; cd06853
529507016371	Mg++ binding site [ion binding]; other site
529507016372	putative catalytic motif [active]
529507016373	substrate binding site [chemical binding]; other site
529507016374	11 probable transmembrane helices predicted for PMI3316 by TMHMM2.0 at aa 10-24, 45-64, 68-87, 99-116, 131-153, 160-179, 184-206, 213-232, 242-261, 294-311 and 321-343
529507016375	HMMPfam hit to PF00953, Glycosyl transferase, score 1.1e-08
529507016376	lipopolysaccharide biosynthesis protein WzzE; Provisional; Region: PRK11638
529507016377	Chain length determinant protein; Region: Wzz; cl15801
529507016378	HMMPfam hit to PF02706, Chain length determinant protein, score 1.6e-06
529507016379	2 probable transmembrane helices predicted for PMI3317 by TMHMM2.0 at aa 34-53 and 327-346
529507016380	PS00221 MIP family signature.
529507016381	UDP-N-acetylglucosamine 2-epimerase [Cell envelope biogenesis, outer membrane]; Region: WecB; COG0381
529507016382	Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase  family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc). The enzyme serves to produce an activated form of ManNAc residues; Region: GT1_UDP-GlcNAc_2-Epimerase; cd03786
529507016383	active site
529507016384	homodimer interface [polypeptide binding]; other site
529507016385	HMMPfam hit to PF02350, UDP-N-acetylglucosamine 2-epimerase, score 2.4e-195
529507016386	UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional; Region: wecC; PRK11064
529507016387	Ketopantoate reductase PanE/ApbA; Region: ApbA; pfam02558
529507016388	UDP-glucose/GDP-mannose dehydrogenase family, central domain; Region: UDPG_MGDP_dh; pfam00984
529507016389	UDP binding domain; Region: UDPG_MGDP_dh_C; smart00984
529507016390	Signal peptide predicted for PMI3319 by SignalP 2.0 HMM (Signal peptide probability 0.674) with cleavage site probability 0.574 between residues 23 and 24
529507016391	HMMPfam hit to PF03721, UDP-glucose/GDP-mannose dehydrogenase, score 2e-89
529507016392	HMMPfam hit to PF00984, UDP-glucose/GDP-mannose dehydrogenase, score 5.6e-41
529507016393	PS00678 Trp-Asp (WD) repeats signature.
529507016394	HMMPfam hit to PF03720, UDP-glucose/GDP-mannose dehydrogenase, score 8e-26
529507016395	PS00017 ATP/GTP-binding site motif A (P-loop).
529507016396	dTDP-glucose 4,6-dehydratase; Provisional; Region: PRK10217
529507016397	dTDP-D-glucose 4,6-dehydratase, extended (e) SDRs; Region: dTDP_GD_SDR_e; cd05246
529507016398	NAD binding site [chemical binding]; other site
529507016399	substrate binding site [chemical binding]; other site
529507016400	homodimer interface [polypeptide binding]; other site
529507016401	active site
529507016402	HMMPfam hit to PF01370, NAD dependent epimerase/dehydratase family, score 9.4e-210
529507016403	G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase; Region: G1P_TT_short; cd02538
529507016404	glucose-1-phosphate thymidylyltransferase, short form; Region: rmlA; TIGR01207
529507016405	substrate binding site; other site
529507016406	tetramer interface; other site
529507016407	HMMPfam hit to PF00483, Nucleotidyl transferase, score 1.6e-112
529507016408	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cd04301
529507016409	Coenzyme A binding pocket [chemical binding]; other site
529507016410	HMMPfam hit to PF00583, Acetyltransferase (GNAT) family, score 1.3e-13
529507016411	Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane]; Region: WecE; COG0399
529507016412	3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn). AHBA_syn family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The members of this CD are involved in various biosynthetic pathways for secondary...; Region: AHBA_syn; cd00616
529507016413	inhibitor-cofactor binding pocket; inhibition site
529507016414	pyridoxal 5'-phosphate binding site [chemical binding]; other site
529507016415	catalytic residue [active]
529507016416	HMMPfam hit to PF01041, DegT/DnrJ/EryC1/StrS aminotransferase, score 3.9e-88
529507016417	Uncharacterized subfamily of the multidrug and toxic compound extrusion (MATE) proteins; Region: MATE_like_10; cd13125
529507016418	HMMPfam hit to PF01943, Polysaccharide biosynthesis protein, score 1.6e-05
529507016419	12 probable transmembrane helices predicted for PMI3324 by TMHMM2.0 at aa 13-35, 45-67, 88-110, 120-139, 151-173, 178-197, 218-240, 255-277, 298-320, 335-357, 364-383 and 393-415
529507016420	4-alpha-L-fucosyltransferase glycosyl transferase group 56; Region: Glyco_transf_56; cl07929
529507016421	HMMPfam hit to PF07429, 4-alpha-L-fucosyltransferase (Fuc4NAc, score 8.4e-189
529507016422	putative common antigen polymerase; Provisional; Region: PRK02975
529507016423	HMMPfam hit to PF06899, WzyE protein, score 0
529507016424	11 probable transmembrane helices predicted for PMI3326 by TMHMM2.0 at aa 4-25, 38-60, 70-89, 110-132, 152-174, 181-200, 204-223, 225-244, 337-359, 380-397 and 407-429
529507016425	PS00225 Crystallins beta and gamma 'Greek key' motif signature.
529507016426	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507016427	Teichoic acid biosynthesis proteins [Cell envelope biogenesis, outer membrane]; Region: WecG; COG1922
529507016428	The glycosyltransferase WecG/TagA superfamily contains Escherichia coli WecG, Bacillus subtilis TagA and related proteins. E. coli WecG is believed to be a UDP-N-acetyl-D-mannosaminuronic acid transferase, and is involved in enterobacterial common...; Region: Glyco_transf_WecG_TagA; cd06533
529507016429	HMMPfam hit to PF03808, Glycosyl transferase WecB/TagA/CpsF f, score 4.2e-88
529507016430	3 probable transmembrane helices predicted for PMI3328 by TMHMM2.0 at aa 13-35, 40-59 and 79-101
529507016431	putative protoheme IX biogenesis protein; Provisional; Region: PRK10747
529507016432	HemY protein N-terminus; Region: HemY_N; pfam07219
529507016433	HMMPfam hit to PF07719, Tetratricopeptide repeat, score 0.00014
529507016434	HMMPfam hit to PF07219, HemY protein N-terminus, score 7.9e-55
529507016435	2 probable transmembrane helices predicted for PMI3329 by TMHMM2.0 at aa 7-29 and 39-61
529507016436	Signal peptide predicted for PMI3329 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.977 between residues 22 and 23
529507016437	putative uroporphyrinogen III C-methyltransferase; Provisional; Region: PRK10920
529507016438	Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism]; Region: HemX; COG2959
529507016439	HMMPfam hit to PF04375, HemX, score 4.4e-124
529507016440	1 probable transmembrane helix predicted for PMI3330 by TMHMM2.0 at aa 38-60
529507016441	uroporphyrinogen-III synthase; Reviewed; Region: hemD; PRK05928
529507016442	Uroporphyrinogen-III synthase (HemD) catalyzes the asymmetrical cyclization of tetrapyrrole (linear) to uroporphyrinogen-III, the fourth step in the biosynthesis of heme. This ubiquitous enzyme is present in eukaryotes, bacteria and archaea. Mutations in...; Region: HemD; cd06578
529507016443	active site
529507016444	HMMPfam hit to PF02602, Uroporphyrinogen-III synthase HemD, score 3.3e-25
529507016445	porphobilinogen deaminase; Reviewed; Region: hemC; PRK00072
529507016446	Hydroxymethylbilane synthase (HMBS), also known as porphobilinogen deaminase (PBGD), is an intermediate enzyme in the biosynthetic pathway of tetrapyrrolic ring systems, such as heme, chlorophylls, and vitamin B12. HMBS catalyzes the conversion of...; Region: HMBS; cd00494
529507016447	domain interfaces; other site
529507016448	active site
529507016449	HMMPfam hit to PF03900, Porphobilinogen deaminase, C-terminal, score 2.1e-31
529507016450	PS00533 Porphobilinogen deaminase cofactor-binding site.
529507016451	HMMPfam hit to PF01379, Porphobilinogen deaminase, dipyrometh, score 1.1e-137
529507016452	adenylate cyclase; Provisional; Region: cyaA; PRK09450
529507016453	Adenylate cyclase NT domain; Region: Adenyl_cycl_N; pfam12633
529507016454	Adenylate cyclase, class-I; Region: Adenylate_cycl; pfam01295
529507016455	HMMPfam hit to PF01295, Adenylate cyclase, class-I, score 0
529507016456	PS01092 Adenylate cyclases class-I signature 1.
529507016457	PS01093 Adenylate cyclases class-I signature 2.
529507016458	Frataxin is a nuclear-encoded mitochondrial protein implicated in Friedreich's ataxia (FRDA), an human autosomal recessive neurodegenerative disease; Frataxin is found in eukaryotes and in purple bacteria; lack of frataxin causes iron to accumulate...; Region: Frataxin; cd00503
529507016459	putative iron binding site [ion binding]; other site
529507016460	HMMPfam hit to PF01491, Frataxin-like domain, score 4.9e-57
529507016461	Predicted small periplasmic lipoprotein [Cell motility and secretion]; Region: COG5567
529507016462	Signal peptide predicted for PMI3335 by SignalP 2.0 HMM (Signal peptide probability 0.796) with cleavage site probability 0.495 between residues 29 and 30
529507016463	1 probable transmembrane helix predicted for PMI3335 by TMHMM2.0 at aa 13-35
529507016464	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507016465	diaminopimelate epimerase; Provisional; Region: dapF; PRK00450
529507016466	Diaminopimelate epimerase; Region: DAP_epimerase; pfam01678
529507016467	Diaminopimelate epimerase; Region: DAP_epimerase; pfam01678
529507016468	HMMPfam hit to PF01678, Diaminopimelate epimerase, score 1.1e-47
529507016469	PS01326 Diaminopimelate epimerase signature.
529507016470	HMMPfam hit to PF01678, Diaminopimelate epimerase, score 6.4e-49
529507016471	hypothetical protein; Provisional; Region: PRK10963
529507016472	HMMPfam hit to PF04340, Protein of unknown function, DUF484, score 5e-72
529507016473	Site-specific recombinase XerC [DNA replication, recombination, and repair]; Region: XerC; COG4973
529507016474	XerD and XerC integrases, DNA breaking-rejoining enzymes, N- and C-terminal domains. XerD-like integrases are involved in the site-specific integration and excision of lysogenic bacteriophage genomes, transposition of conjugative transposons, termination...; Region: INT_XerDC; cd00798
529507016475	active site
529507016476	Int/Topo IB signature motif; other site
529507016477	HMMPfam hit to PF02899, Phage integrase, N-terminal SAM-like, score 4.1e-30
529507016478	HMMPfam hit to PF00589, Phage integrase family, score 1.2e-59
529507016479	flavin mononucleotide phosphatase; Provisional; Region: PRK10748
529507016480	Haloacid dehalogenase-like hydrolases. The haloacid dehalogenase-like (HAD) superfamily includes L-2-haloacid dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, and many others; Region: HAD_like; cd01427
529507016481	motif II; other site
529507016482	HMMPfam hit to PF00702, haloacid dehalogenase-like hydrolase, score 8.1e-20
529507016483	PS00761 Signal peptidases I signature 3.
529507016484	DNA-dependent helicase II; Provisional; Region: uvrD; PRK11773
529507016485	Part of AAA domain; Region: AAA_19; pfam13245
529507016486	Family description; Region: UvrD_C_2; pfam13538
529507016487	HMMPfam hit to PF00580, UvrD/REP helicase, score 7.5e-215
529507016488	PS00017 ATP/GTP-binding site motif A (P-loop).
529507016489	putative chloramphenical resistance permease RarD; Provisional; Region: PRK15430
529507016490	EamA-like transporter family; Region: EamA; pfam00892
529507016491	10 probable transmembrane helices predicted for PMI3342 by TMHMM2.0 at aa 33-50, 65-87, 100-122, 126-148, 155-172, 177-194, 207-226, 236-258, 265-287 and 297-316
529507016492	HMMPfam hit to PF00892, Integral membrane protein DUF6, score 3.9e-12
529507016493	PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria.  Although orthologs of PaaI exist in archaea and eukaryotes, their function has not...; Region: PaaI_thioesterase; cd03443
529507016494	CoenzymeA binding site [chemical binding]; other site
529507016495	subunit interaction site [polypeptide binding]; other site
529507016496	PHB binding site; other site
529507016497	HMMPfam hit to PF03061, Thioesterase superfamily, score 5e-06
529507016498	The outer membrane phospholipase A (OMPLA) is an integral membrane enzyme that catalyses the hydrolysis of acylester bonds in phospholipids using calcium as a cofactor. The enzyme has a fold of transmembrane beta-barrels and is widespread among...; Region: OMPLA; cd00541
529507016499	dimerization interface [polypeptide binding]; other site
529507016500	substrate binding site [chemical binding]; other site
529507016501	active site
529507016502	calcium binding site [ion binding]; other site
529507016503	Signal peptide predicted for PMI3344 by SignalP 2.0 HMM (Signal peptide probability 0.689) with cleavage site probability 0.442 between residues 21 and 22
529507016504	HMMPfam hit to PF02253, Phospholipase A1, score 1.2e-151
529507016505	ATP-dependent DNA helicase RecQ; Provisional; Region: PRK11057
529507016506	DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region; Region: DEXDc; cd00046
529507016507	ATP binding site [chemical binding]; other site
529507016508	putative Mg++ binding site [ion binding]; other site
529507016509	Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may...; Region: HELICc; cd00079
529507016510	nucleotide binding region [chemical binding]; other site
529507016511	ATP-binding site [chemical binding]; other site
529507016512	This DNA-binding domain is found in the RecQ helicase among others and has a helix-turn-helix structure; Region: RQC; smart00956
529507016513	HRDC domain; Region: HRDC; pfam00570
529507016514	HMMPfam hit to PF00270, DEAD/DEAH box helicase, score 1.4e-33
529507016515	HMMPfam hit to PF00271, Helicase conserved C-terminal domain, score 9.1e-30
529507016516	HMMPfam hit to PF00570, HRDC domain, score 2.5e-24
529507016517	lysophospholipase L2; Provisional; Region: PRK10749
529507016518	Putative lysophospholipase; Region: Hydrolase_4; pfam12146
529507016519	HMMPfam hit to PF00561, alpha/beta hydrolase fold, score 9.8e-20
529507016520	putative hydrolase; Provisional; Region: PRK10976
529507016521	Haloacid dehalogenase-like hydrolases. The haloacid dehalogenase-like (HAD) superfamily includes L-2-haloacid dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, and many others; Region: HAD_like; cd01427
529507016522	active site
529507016523	motif I; other site
529507016524	motif II; other site
529507016525	Haloacid dehalogenase-like hydrolases. The haloacid dehalogenase-like (HAD) superfamily includes L-2-haloacid dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, and many others; Region: HAD_like; cl17915
529507016526	HMMPfam hit to PF00702, haloacid dehalogenase-like hydrolase, score 8.8e-05
529507016527	PS01228 Hypothetical cof family signature 1.
529507016528	PS01229 Hypothetical cof family signature 2.
529507016529	fimbrial operon 16
529507016530	putative major fimbrial protein SthE; Provisional; Region: PRK15292
529507016531	Fimbrial protein; Region: Fimbrial; cl01416
529507016532	HMMPfam hit to PF00419, Fimbrial protein, score 2.5e-06
529507016533	Signal peptide predicted for PMI3348 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.908 between residues 24 and 25
529507016534	Cellular and retroviral pepsin-like aspartate proteases; Region: pepsin_retropepsin_like; cl11403
529507016535	P pilus assembly protein, porin PapC [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimD; COG3188
529507016536	PapC N-terminal domain; Region: PapC_N; pfam13954
529507016537	Type VII secretion system (T7SS), usher protein; Region: Usher; pfam00577
529507016538	PapC C-terminal domain; Region: PapC_C; pfam13953
529507016539	HMMPfam hit to PF00577, Fimbrial Usher protein, score 0
529507016540	Signal peptide predicted for PMI3349 by SignalP 2.0 HMM (Signal peptide probability 0.610) with cleavage site probability 0.593 between residues 42 and 43
529507016541	1 probable transmembrane helix predicted for PMI3349 by TMHMM2.0 at aa 20-42
529507016542	fimbrial chaperone protein PefD; Provisional; Region: PRK15211
529507016543	Gram-negative pili assembly chaperone, N-terminal domain; Region: Pili_assembly_N; pfam00345
529507016544	Gram-negative pili assembly chaperone, C-terminal domain; Region: Pili_assembly_C; pfam02753
529507016545	HMMPfam hit to PF00345, Gram-negative pili assembly chaperone, score 5.8e-35
529507016546	P pilus assembly protein, pilin FimA [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimA; COG3539
529507016547	HMMPfam hit to PF00419, Fimbrial protein, score 1.4e-41
529507016548	1 probable transmembrane helix predicted for PMI3352 by TMHMM2.0 at aa 7-29
529507016549	Signal peptide predicted for PMI3352 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.945 between residues 25 and 26
529507016550	Transcriptional regulator [Transcription]; Region: LysR; COG0583
529507016551	Bacterial regulatory helix-turn-helix protein, lysR family; Region: HTH_1; pfam00126
529507016552	The substrate binding domain of LysR-type transcriptional regulators (LTTRs), a member of the type 2 periplasmic binding fold protein superfamily; Region: PBP2_LTTR_substrate; cl11398
529507016553	HMMPfam hit to PF00126, Bacterial regulatory helix-turn-helix protei, score 1.1e-12
529507016554	PS00044 Bacterial regulatory proteins, lysR family signature.
529507016555	putative mechanosensitive channel protein; Provisional; Region: PRK10929
529507016556	Mechanosensitive ion channel inner membrane domain 1; Region: MscS_TM; pfam12794
529507016557	Mechanosensitive ion channel; Region: MS_channel; pfam00924
529507016558	HMMPfam hit to PF00924, Mechanosensitive ion channel, score 4.5e-69
529507016559	11 probable transmembrane helices predicted for PMI3354 by TMHMM2.0 at aa 478-495, 525-547, 557-579, 600-622, 632-652, 673-695, 700-722, 786-805, 836-858, 878-900 and 910-932
529507016560	Signal peptide predicted for PMI3354 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 1.000 between residues 23 and 24
529507016561	phosphatidylserine decarboxylase; Reviewed; Region: psd; PRK00044
529507016562	HMMPfam hit to PF02666, Phosphatidylserine decarboxylase, score 1.3e-95
529507016563	GTPase RsgA; Reviewed; Region: PRK12288
529507016564	S1_like: Ribosomal protein S1-like RNA-binding domain. Found in a wide variety of RNA-associated proteins. Originally identified in S1 ribosomal protein. This superfamily also contains the Cold Shock Domain (CSD), which is a homolog of the S1 domain; Region: S1_like; cl09927
529507016565	RNA binding site [nucleotide binding]; other site
529507016566	Ribosomal interacting GTPase YjeQ/EngC, a circularly permuted subfamily of the Ras GTPases; Region: YjeQ_EngC; cd01854
529507016567	GTPase/Zn-binding domain interface [polypeptide binding]; other site
529507016568	GTP/Mg2+ binding site [chemical binding]; other site
529507016569	G4 box; other site
529507016570	G5 box; other site
529507016571	G1 box; other site
529507016572	Switch I region; other site
529507016573	G2 box; other site
529507016574	G3 box; other site
529507016575	Switch II region; other site
529507016576	HMMPfam hit to PF03193, Protein of unknown function, DUF258, score 8.5e-149
529507016577	PS00017 ATP/GTP-binding site motif A (P-loop).
529507016578	DEDDh 3'-5' exonuclease domain of oligoribonuclease and similar proteins; Region: Orn; cd06135
529507016579	catalytic site [active]
529507016580	putative active site [active]
529507016581	putative substrate binding site [chemical binding]; other site
529507016582	dimer interface [polypeptide binding]; other site
529507016583	HMMPfam hit to PF00929, Exonuclease, score 1.4e-33
529507016584	Plasmid stabilisation system protein; Region: Plasmid_stabil; pfam05016
529507016585	HMMPfam hit to PF05016, Plasmid stabilisation system protein, score 2.7e-13
529507016586	Antitoxin Phd_YefM, type II toxin-antitoxin system; Region: PhdYeFM_antitox; pfam02604
529507016587	HMMPfam hit to PF02604, Phd_YefM, score 1.5e-15
529507016588	epoxyqueuosine reductase; Region: TIGR00276
529507016589	Domain of unknown function (DUF1730); Region: DUF1730; pfam08331
529507016590	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 0.0011
529507016591	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
529507016592	Uncharacterized P-loop hydrolase UPF0079; Region: UPF0079; cl00520
529507016593	HMMPfam hit to PF02367, Uncharacterised P-loop hydrolase UPF0079, score 5.1e-47
529507016594	PS00017 ATP/GTP-binding site motif A (P-loop).
529507016595	N-acetylmuramoyl-l-alanine amidase II; Provisional; Region: PRK10431
529507016596	AMIN domain; Region: AMIN; pfam11741
529507016597	N-acetylmuramoyl-L-alanine amidase or MurNAc-LAA (also known as peptidoglycan aminohydrolase, NAMLA amidase, NAMLAA, Amidase 3, and peptidoglycan amidase; EC 3.5.1.28) is an autolysin that hydrolyzes the amide bond between N-acetylmuramoyl and L-amino...; Region: MurNAc-LAA; cd02696
529507016598	active site
529507016599	metal binding site [ion binding]; metal-binding site
529507016600	HMMPfam hit to PF01520, N-acetylmuramoyl-L-alanine amidase, score 2.9e-65
529507016601	DNA mismatch repair protein; Reviewed; Region: mutL; PRK00095
529507016602	MutL_Trans_MutL: transducer domain, having a ribosomal S5 domain 2-like fold, found in proteins similar to Escherichia coli MutL.  EcMutL belongs to the DNA mismatch repair (MutL/MLH1/PMS2) family.  This transducer domain is homologous to the second...; Region: MutL_Trans_MutL; cd03482
529507016603	ATP binding site [chemical binding]; other site
529507016604	MutL C terminal dimerisation domain; Region: MutL_C; pfam08676
529507016605	HMMPfam hit to PF02518, Histidine kinase-, DNA gyrase B-, and, score 2.6e-10
529507016606	PS00058 DNA mismatch repair proteins mutL / hexB / PMS1 signature.
529507016607	HMMPfam hit to PF01119, DNA mismatch repair protein, C-termina, score 1.4e-36
529507016608	tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis]; Region: MiaA; COG0324
529507016609	tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed; Region: miaA; PRK00091
529507016610	PS00017 ATP/GTP-binding site motif A (P-loop).
529507016611	HMMPfam hit to PF01715, IPP transferase, score 7.8e-150
529507016612	bacterial Hfq-like; Region: Hfq; cd01716
529507016613	hexamer interface [polypeptide binding]; other site
529507016614	Sm1 motif; other site
529507016615	RNA binding site [nucleotide binding]; other site
529507016616	Sm2 motif; other site
529507016617	HMMPfam hit to PF01423, LSM domain, score 1.2e-11
529507016618	GTPase HflX; Provisional; Region: PRK11058
529507016619	GTP-binding GTPase N-terminal; Region: GTP-bdg_N; pfam13167
529507016620	HflX GTPase family; Region: HflX; cd01878
529507016621	G1 box; other site
529507016622	GTP/Mg2+ binding site [chemical binding]; other site
529507016623	Switch I region; other site
529507016624	G2 box; other site
529507016625	G3 box; other site
529507016626	Switch II region; other site
529507016627	G4 box; other site
529507016628	G5 box; other site
529507016629	HMMPfam hit to PF01926, GTPase of unknown function, score 3.7e-39
529507016630	PS00017 ATP/GTP-binding site motif A (P-loop).
529507016631	FtsH protease regulator HflK; Provisional; Region: PRK10930
529507016632	Band_7_HflK: The band 7 domain of flotillin (reggie) like proteins. This group includes proteins similar to prokaryotic HlfK (High frequency of lysogenization K). Although many members of the band 7 family are lipid raft associated, prokaryote plasma...; Region: Band_7_HflK; cd03404
529507016633	1 probable transmembrane helix predicted for PMI3367 by TMHMM2.0 at aa 80-102
529507016634	HMMPfam hit to PF01145, SPFH domain / Band, score 6.4e-43
529507016635	FtsH protease regulator HflC; Provisional; Region: PRK11029
529507016636	Band_7_HflC: The band 7 domain of flotillin (reggie) like proteins. This group includes proteins similar to prokaryotic HlfC (High frequency of lysogenization C). Although many members of the band 7 family are lipid raft associated, prokaryote plasma...; Region: Band_7_HflC; cd03405
529507016637	Signal peptide predicted for PMI3368 by SignalP 2.0 HMM (Signal peptide probability 0.997) with cleavage site probability 0.656 between residues 22 and 23
529507016638	1 probable transmembrane helix predicted for PMI3368 by TMHMM2.0 at aa 5-24
529507016639	HMMPfam hit to PF01145, SPFH domain / Band, score 5.1e-57
529507016640	Adenylosuccinate synthetase; Region: Adenylsucc_synt; smart00788
529507016641	Adenylosuccinate synthetase (AdSS) catalyzes the first step in the de novo biosynthesis of AMP. IMP and L-aspartate are conjugated in a two-step reaction accompanied by the hydrolysis of GTP to GDP in the presence of Mg2+. In the first step, the...; Region: AdSS; cd03108
529507016642	GDP-binding site [chemical binding]; other site
529507016643	ACT binding site; other site
529507016644	IMP binding site; other site
529507016645	HMMPfam hit to PF00709, Adenylosuccinate synthetase, score 0
529507016646	PS01266 Adenylosuccinate synthetase GTP-binding site.
529507016647	PS00513 Adenylosuccinate synthetase active site.
529507016648	Predicted transcriptional regulator [Transcription]; Region: COG1959
529507016649	transcriptional repressor NsrR; Provisional; Region: PRK11014
529507016650	HMMPfam hit to PF02082, Transcriptional regulator, score 2.8e-40
529507016651	exoribonuclease R; Provisional; Region: PRK11642
529507016652	Ribonuclease B OB domain; Region: OB_RNB; pfam08206
529507016653	RNB domain; Region: RNB; pfam00773
529507016654	S1_RNase_R: RNase R C-terminal S1 domain. RNase R is a processive 3' to 5' exoribonuclease, which is a homolog of RNase II. RNase R degrades RNA with secondary structure having a 3' overhang of at least 7 nucleotides. RNase R and PNPase...; Region: S1_RNase_R; cd04471
529507016655	RNA binding site [nucleotide binding]; other site
529507016656	HMMPfam hit to PF00773, RNB-like protein, score 1.9e-137
529507016657	PS01175 Ribonuclease II family signature.
529507016658	HMMPfam hit to PF00575, S1 RNA binding domain, score 7.4e-21
529507016659	23S rRNA (guanosine-2'-O-)-methyltransferase; Provisional; Region: PRK11181
529507016660	RNA 2'-O ribose methyltransferase substrate binding; Region: SpoU_sub_bind; pfam08032
529507016661	SpoU rRNA Methylase family; Region: SpoU_methylase; pfam00588
529507016662	HMMPfam hit to PF00588, SpoU rRNA Methylase family, score 1.7e-66
529507016663	30S ribosomal protein S6; Reviewed; Region: rpsF; PRK00453
529507016664	HMMPfam hit to PF01250, Ribosomal protein S6, score 3.8e-50
529507016665	PS01048 Ribosomal protein S6 signature.
529507016666	SSB_OBF: A subfamily of OB folds similar to the OB fold of ssDNA-binding protein (SSB). SSBs bind with high affinity to ssDNA. They bind to and protect ssDNA intermediates during DNA metabolic pathways. All bacterial and eukaryotic SSBs studied to date...; Region: SSB_OBF; cd04496
529507016667	dimer interface [polypeptide binding]; other site
529507016668	ssDNA binding site [nucleotide binding]; other site
529507016669	tetramer (dimer of dimers) interface [polypeptide binding]; other site
529507016670	HMMPfam hit to PF00436, Single-strand binding protein family, score 9.6e-18
529507016671	30S ribosomal protein S18; Reviewed; Region: rpsR; PRK00391
529507016672	HMMPfam hit to PF01084, Ribosomal protein S18, score 1.2e-32
529507016673	PS00057 Ribosomal protein S18 signature.
529507016674	50S ribosomal protein L9; Reviewed; Region: rplI; PRK00137
529507016675	Ribosomal protein L9, N-terminal domain; Region: Ribosomal_L9_N; pfam01281
529507016676	Ribosomal protein L9, C-terminal domain; Region: Ribosomal_L9_C; pfam03948
529507016677	HMMPfam hit to PF01281, Ribosomal protein L9, N-terminal domai, score 1.1e-28
529507016678	PS00651 Ribosomal protein L9 signature.
529507016679	HMMPfam hit to PF03948, Ribosomal protein L9, C-terminal domai, score 7.3e-40
529507016680	Opacity-associated protein A LysM-like domain; Region: OapA; pfam04225
529507016681	1 probable transmembrane helix predicted for PMI3378 by TMHMM2.0 at aa 39-56
529507016682	50S ribosomal protein L31 type B; Reviewed; Region: rpmE2; PRK01678
529507016683	HMMPfam hit to PF01197, Ribosomal protein L31, score 1.5e-11
529507016684	zinc/cadmium-binding protein; Provisional; Region: PRK10306
529507016685	Signal peptide predicted for PMI3380 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.773 between residues 23 and 24
529507016686	Transposase IS200 like; Region: Y1_Tnp; pfam01797
529507016687	HMMPfam hit to PF01797, Transposase IS200 like, score 4.4e-43
529507016688	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507016689	Helix-turn-helix domain; Region: HTH_OrfB_IS605; pfam12323
529507016690	Transposase and inactivated derivatives [DNA replication, recombination, and repair]; Region: COG0675
529507016691	Probable transposase; Region: OrfB_IS605; pfam01385
529507016692	transposase, IS605 OrfB family, central region; Region: tspaseT_teng_C; TIGR01766
529507016693	HMMPfam hit to PF01385, Probable transposase, score 3.7e-131
529507016694	HMMPfam hit to PF07282, transposase DNA-binding domai, score 3e-34
529507016695	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507016696	succinic semialdehyde dehydrogenase; Region: PLN02278
529507016697	Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like; Region: ALDH_F5_SSADH_GabD; cd07103
529507016698	tetramerization interface [polypeptide binding]; other site
529507016699	NAD(P) binding site [chemical binding]; other site
529507016700	catalytic residues [active]
529507016701	HMMPfam hit to PF00171, Aldehyde dehydrogenase family, score 1.7e-213
529507016702	PS00070 Aldehyde dehydrogenases cysteine active site.
529507016703	PS00687 Aldehyde dehydrogenases glutamic acid active site.
529507016704	peptidyl-prolyl cis-trans isomerase; Provisional; Region: PRK11570
529507016705	Domain amino terminal to FKBP-type peptidyl-prolyl isomerase; Region: FKBP_N; pfam01346
529507016706	FKBP-type peptidyl-prolyl cis-trans isomerase; Region: FKBP_C; pfam00254
529507016707	HMMPfam hit to PF01346, Domain amino terminal to FKBP-type peptidyl-, score 2.4e-06
529507016708	HMMPfam hit to PF00254, FKBP-type peptidyl-prolyl cis-trans isomeras, score 1.5e-44
529507016709	PS00453 FKBP-type peptidyl-prolyl cis-trans isomerase signature 1.
529507016710	CysQ, a 3'-Phosphoadenosine-5'-phosphosulfate (PAPS) 3'-phosphatase, is a bacterial member of the inositol monophosphatase family. It has been proposed that CysQ helps control intracellular levels of PAPS, which is an intermediate in...; Region: CysQ; cd01638
529507016711	Archaeal fructose-1,6-bisphosphatase and related enzymes of inositol monophosphatase family [Carbohydrate transport and metabolism]; Region: SuhB; COG0483
529507016712	active site
529507016713	HMMPfam hit to PF00459, Inositol monophosphatase family, score 2.3e-71
529507016714	PS00629 Inositol monophosphatase family signature 1.
529507016715	PS00630 Inositol monophosphatase family signature 2.
529507016716	Bacterial protein of unknown function (YtfJ_HI0045); Region: YtfJ_HI0045; pfam09695
529507016717	Signal peptide predicted for PMI3386 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.934 between residues 19 and 20
529507016718	Protein of unknown function (DUF1107); Region: DUF1107; pfam06526
529507016719	HMMPfam hit to PF06526, Protein of unknown function (DUF1107), score 4.1e-37
529507016720	Hemolysins and related proteins containing CBS domains [General function prediction only]; Region: TlyC; COG1253
529507016721	Domain of unknown function DUF21; Region: DUF21; pfam01595
529507016722	This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain. CorC_HlyC is a transporter associated domain. This small domain is found in Na+/H+ antiporters, in proteins involved in...; Region: CBS_pair_CorC_HlyC_assoc; cd04590
529507016723	Transporter associated domain; Region: CorC_HlyC; smart01091
529507016724	HMMPfam hit to PF03471, Transporter associated domain, score 7e-23
529507016725	HMMPfam hit to PF00571, CBS domain, score 0.0028
529507016726	HMMPfam hit to PF00571, CBS domain, score 1.1e-06
529507016727	HMMPfam hit to PF01595, Domain of unknown function DUF21, score 7.5e-65
529507016728	4 probable transmembrane helices predicted for PMI3388 by TMHMM2.0 at aa 5-27, 53-75, 95-117 and 144-161
529507016729	Signal peptide predicted for PMI3388 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.668 between residues 26 and 27
529507016730	methionine sulfoxide reductase A; Provisional; Region: PRK00058
529507016731	HMMPfam hit to PF01625, Peptide methionine sulfoxide reductase, score 7.8e-98
529507016732	Outer membrane protein [Cell envelope biogenesis, outer membrane]; Region: COG0729
529507016733	Surface antigen variable number repeat; Region: Surf_Ag_VNR; pfam07244
529507016734	Surface antigen; Region: Bac_surface_Ag; pfam01103
529507016735	Signal peptide predicted for PMI3390 by SignalP 2.0 HMM (Signal peptide probability 0.989) with cleavage site probability 0.710 between residues 21 and 22
529507016736	HMMPfam hit to PF01103, Surface antigen, score 6e-76
529507016737	PS00213 Lipocalin signature.
529507016738	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG2911
529507016739	Dicarboxylate transport; Region: DctA-YdbH; cl14674
529507016740	Family of unknown function (DUF490); Region: DUF490; pfam04357
529507016741	Signal peptide predicted for PMI3391 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.737 between residues 23 and 24
529507016742	HMMPfam hit to PF04357, Family of unknown function (DUF490), score 1.1e-151
529507016743	GGCT-like domains, also called AIG2-like family. Gamma-glutamyl cyclotransferase (GGCT) catalyzes the formation of pyroglutamic acid (5-oxoproline) from dipeptides containing gamma-glutamyl, and is a dimeric protein. In Homo sapiens, the protein is...; Region: GGCT_like; cd06661
529507016744	putative active site pocket [active]
529507016745	dimerization interface [polypeptide binding]; other site
529507016746	putative catalytic residue [active]
529507016747	HMMPfam hit to PF03674, Uncharacterised protein family (UPF0131), score 1.9e-29
529507016748	dTDP-4-dehydrorhamnose 3,5-epimerase; Region: dTDP_sugar_isom; cl17405
529507016749	dTDP-4-dehydrorhamnose 3,5-epimerase; Region: dTDP_sugar_isom; cl17405
529507016750	Major Facilitator Superfamily; Region: MFS_1; pfam07690
529507016751	Signal peptide predicted for PMI3395 by SignalP 2.0 HMM (Signal peptide probability 0.650) with cleavage site probability 0.207 between residues 29 and 30
529507016752	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 9.6e-19
529507016753	12 probable transmembrane helices predicted for PMI3395 by TMHMM2.0 at aa 5-27, 37-59, 66-88, 93-115, 136-155, 159-181, 202-221, 248-270, 277-296, 300-322, 334-356 and 366-388
529507016754	Inorganic pyrophosphatase. These enzymes hydrolyze inorganic pyrophosphate (PPi) to two molecules of orthophosphates (Pi). The reaction requires bivalent cations. The enzymes in general exist as homooligomers; Region: pyrophosphatase; cd00412
529507016755	dimer interface [polypeptide binding]; other site
529507016756	substrate binding site [chemical binding]; other site
529507016757	metal binding sites [ion binding]; metal-binding site
529507016758	HMMPfam hit to PF00719, Inorganic pyrophosphatase, score 3.2e-61
529507016759	PS00387 Inorganic pyrophosphatase signature.
529507016760	Fructose-1,6-bisphosphatase, an enzyme that catalyzes the hydrolysis of fructose-1,6-biphosphate  into fructose-6-phosphate and is critical in gluconeogenesis pathway. The alignment model also includes chloroplastic FBPases and sedoheptulose-1; Region: FBPase; cd00354
529507016761	AMP binding site [chemical binding]; other site
529507016762	metal binding site [ion binding]; metal-binding site
529507016763	active site
529507016764	HMMPfam hit to PF00316, Fructose-1-6-bisphosphatase, score 5.3e-200
529507016765	PS00124 Fructose-1-6-bisphosphatase active site.
529507016766	UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- meso-diaminopimelate ligase; Region: mpl; TIGR01081
529507016767	Mur ligase family, catalytic domain; Region: Mur_ligase; pfam01225
529507016768	Mur ligase middle domain; Region: Mur_ligase_M; pfam08245
529507016769	Mur ligase family, glutamate ligase domain; Region: Mur_ligase_C; pfam02875
529507016770	Signal peptide predicted for PMI3398 by SignalP 2.0 HMM (Signal peptide probability 0.756) with cleavage site probability 0.554 between residues 20 and 21
529507016771	HMMPfam hit to PF01225, Mur ligase family, catalytic domain, score 3.7e-57
529507016772	HMMPfam hit to PF02875, Mur ligase family, glutamate ligase doma, score 5.6e-19
529507016773	arginine repressor; Provisional; Region: PRK05066
529507016774	Arginine repressor, DNA binding domain; Region: Arg_repressor; pfam01316
529507016775	Arginine repressor, C-terminal domain; Region: Arg_repressor_C; pfam02863
529507016776	HMMPfam hit to PF02863, Arginine repressor, C-terminal domain, score 2.6e-23
529507016777	HMMPfam hit to PF01316, Arginine repressor, DNA binding domai, score 6.1e-31
529507016778	malate dehydrogenase; Provisional; Region: PRK05086
529507016779	Glyoxysomal and mitochondrial malate dehydrogenases; Region: MDH_glyoxysomal_mitochondrial; cd01337
529507016780	NAD binding site [chemical binding]; other site
529507016781	dimerization interface [polypeptide binding]; other site
529507016782	Substrate binding site [chemical binding]; other site
529507016783	HMMPfam hit to PF00056, lactate/malate dehydrogenase, NAD binding do, score 2e-71
529507016784	PS00068 Malate dehydrogenase active site signature.
529507016785	HMMPfam hit to PF02866, lactate/malate dehydrogenase, alpha/beta C-t, score 6.3e-63
529507016786	Winged helix-turn-helix DNA-binding; Region: HTH_35; pfam13693
529507016787	Mu DNA-binding domain; Region: HTH_Tnp_Mu_1; pfam02316
529507016788	Mu DNA-binding domain; Region: HTH_Tnp_Mu_1; pfam02316
529507016789	HMMPfam hit to PF02316, Mu DNA-binding domain, score 1.2e-05
529507016790	Geranylgeranyl pyrophosphate synthase [Coenzyme metabolism]; Region: IspA; COG0142
529507016791	Trans-Isoprenyl Diphosphate Synthases, head-to-tail; Region: Trans_IPPS_HT; cd00685
529507016792	substrate binding pocket [chemical binding]; other site
529507016793	chain length determination region; other site
529507016794	substrate-Mg2+ binding site; other site
529507016795	catalytic residues [active]
529507016796	aspartate-rich region 1; other site
529507016797	active site lid residues [active]
529507016798	aspartate-rich region 2; other site
529507016799	HMMPfam hit to PF00348, Polyprenyl synthetase, score 5.3e-114
529507016800	PS00444 Polyprenyl synthetases signature 2.
529507016801	PS00723 Polyprenyl synthetases signature 1.
529507016802	50S ribosomal protein L21/unknown domain fusion protein; Provisional; Region: PRK12278
529507016803	50S ribosomal protein L21; Validated; Region: rplU; PRK05573
529507016804	HMMPfam hit to PF00829, Ribosomal prokaryotic L21 protein, score 1.2e-58
529507016805	PS01169 Ribosomal protein L21 signature.
529507016806	50S ribosomal protein L27; Validated; Region: rpmA; PRK05435
529507016807	HMMPfam hit to PF01016, Ribosomal L27 protein, score 7.2e-59
529507016808	PS00831 Ribosomal protein L27 signature.
529507016809	GTPase CgtA; Reviewed; Region: obgE; PRK12298
529507016810	GTP1/OBG; Region: GTP1_OBG; pfam01018
529507016811	Obg GTPase; Region: Obg; cd01898
529507016812	G1 box; other site
529507016813	GTP/Mg2+ binding site [chemical binding]; other site
529507016814	Switch I region; other site
529507016815	G2 box; other site
529507016816	G3 box; other site
529507016817	Switch II region; other site
529507016818	G4 box; other site
529507016819	G5 box; other site
529507016820	HMMPfam hit to PF01018, GTP1/OBG, score 1.3e-92
529507016821	HMMPfam hit to PF01926, GTPase of unknown function, score 3.4e-37
529507016822	PS00017 ATP/GTP-binding site motif A (P-loop).
529507016823	PS00905 GTP1/OBG family signature.
529507016824	D-alanyl-D-alanine carboxypeptidase/endopeptidase; Provisional; Region: PRK11113
529507016825	D-alanyl-D-alanine carboxypeptidase, serine-type, PBP4 family; Region: PBP4; TIGR00666
529507016826	HMMPfam hit to PF02113, D-Ala-D-Ala carboxypeptidase 3 (S13) fa, score 1.6e-167
529507016827	Signal peptide predicted for PMI3408 by SignalP 2.0 HMM (Signal peptide probability 0.970) with cleavage site probability 0.964 between residues 23 and 24
529507016828	transcription elongation factor GreA; Reviewed; Region: greA; PRK00226
529507016829	Transcription elongation factor, N-terminal; Region: GreA_GreB_N; pfam03449
529507016830	Transcription elongation factor, GreA/GreB, C-term; Region: GreA_GreB; pfam01272
529507016831	HMMPfam hit to PF03449, Prokaryotic transcription elongation fact, score 2.1e-46
529507016832	PS00829 Prokaryotic transcription elongation factors signature 1.
529507016833	HMMPfam hit to PF01272, Prokaryotic transcription elongation fact, score 1.4e-44
529507016834	PS00830 Prokaryotic transcription elongation factors signature 2.
529507016835	CRS1 / YhbY (CRM) domain; Region: CRS1_YhbY; cl00663
529507016836	HMMPfam hit to PF01985, CRS1 / YhbY domain, score 2.7e-34
529507016837	23S rRNA methylase [Translation, ribosomal structure and biogenesis]; Region: FtsJ; COG0293
529507016838	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
529507016839	S-adenosylmethionine binding site [chemical binding]; other site
529507016840	HMMPfam hit to PF01728, FtsJ-like methyltransferase, score 2.3e-78
529507016841	ATP-dependent metalloprotease; Reviewed; Region: hflB; PRK10733
529507016842	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
529507016843	Walker A motif; other site
529507016844	ATP binding site [chemical binding]; other site
529507016845	Walker B motif; other site
529507016846	arginine finger; other site
529507016847	Peptidase family M41; Region: Peptidase_M41; pfam01434
529507016848	Signal peptide predicted for PMI3412 by SignalP 2.0 HMM (Signal peptide probability 0.943) with cleavage site probability 0.468 between residues 23 and 24
529507016849	2 probable transmembrane helices predicted for PMI3412 by TMHMM2.0 at aa 5-24 and 97-119
529507016850	HMMPfam hit to PF06480, FtsH Extracellular, score 7.8e-45
529507016851	PS00017 ATP/GTP-binding site motif A (P-loop).
529507016852	HMMPfam hit to PF00004, ATPase family associated with various c, score 4.6e-98
529507016853	PS00017 ATP/GTP-binding site motif A (P-loop).
529507016854	PS00674 AAA-protein family signature.
529507016855	HMMPfam hit to PF01434, Peptidase family M41, score 2.6e-127
529507016856	DHPS subgroup of Pterin binding enzymes. DHPS (dihydropteroate synthase), a functional homodimer, catalyzes the condensation of p-aminobenzoic acid (pABA) in the de novo biosynthesis of folate, which is an essential cofactor in both nucleic acid and...; Region: DHPS; cd00739
529507016857	dihydropteroate synthase; Region: DHPS; TIGR01496
529507016858	substrate binding pocket [chemical binding]; other site
529507016859	dimer interface [polypeptide binding]; other site
529507016860	inhibitor binding site; inhibition site
529507016861	PS00792 Dihydropteroate synthase signature 1.
529507016862	HMMPfam hit to PF00809, Pterin binding enzyme, score 8.8e-101
529507016863	PS00793 Dihydropteroate synthase signature 2.
529507016864	phosphoglucosamine mutase; Provisional; Region: glmM; PRK10887
529507016865	GlmM is a bacterial phosphoglucosamine mutase (PNGM) that belongs to the alpha-D-phosphohexomutase superfamily. It is required for the interconversion of glucosamine-6-phosphate and glucosamine-1-phosphate in the biosynthetic pathway of...; Region: GlmM; cd05802
529507016866	active site
529507016867	substrate binding site [chemical binding]; other site
529507016868	metal binding site [ion binding]; metal-binding site
529507016869	HMMPfam hit to PF02878, Phosphoglucomutase/phosphomannomutase, al, score 7.5e-60
529507016870	PS00710 Phosphoglucomutase and phosphomannomutase phosphoserine signature.
529507016871	HMMPfam hit to PF02879, Phosphoglucomutase/phosphomannomutase, al, score 1.9e-44
529507016872	HMMPfam hit to PF02880, Phosphoglucomutase/phosphomannomutase, al, score 1.6e-41
529507016873	HMMPfam hit to PF00408, Phosphoglucomutase/phosphomannomutase, C-, score 2.5e-12
529507016874	Preprotein translocase SecG subunit; Region: SecG; pfam03840
529507016875	HMMPfam hit to PF03840, Preprotein translocase SecG subunit, score 1.5e-32
529507016876	2 probable transmembrane helices predicted for PMI3415 by TMHMM2.0 at aa 5-22 and 51-73
529507016877	ribosome maturation protein RimP; Reviewed; Region: PRK00092
529507016878	Sm and related proteins; Region: Sm_like; cl00259
529507016879	Bacillus subtilis YxlS-like, C-terminal domain; Region: YlxS_C; cd01734
529507016880	putative oligomer interface [polypeptide binding]; other site
529507016881	putative RNA binding site [nucleotide binding]; other site
529507016882	HMMPfam hit to PF02576, Uncharacterised BCR, YhbC family COG0779, score 3.7e-66
529507016883	transcription elongation factor NusA; Validated; Region: nusA; PRK09202
529507016884	NusA N-terminal domain; Region: NusA_N; pfam08529
529507016885	S1_NusA: N-utilizing substance A protein (NusA), S1-like RNA-binding domain. S1-like RNA-binding domains are found in a wide variety of RNA-associated proteins. NusA is a transcription elongation factor containing an N-terminal catalytic domain and three...; Region: S1_NusA; cd04455
529507016886	RNA binding site [nucleotide binding]; other site
529507016887	homodimer interface [polypeptide binding]; other site
529507016888	NusA-like KH domain; Region: KH_5; pfam13184
529507016889	NusA_K homology RNA-binding domain (KH). NusA is an essential multifunctional transcription elongation factor that is universally conserved among prokaryotes and archaea. NusA anti-termination function plays an important role in the expression of...; Region: NusA_KH; cd02134
529507016890	G-X-X-G motif; other site
529507016891	transcription termination factor NusA, C-terminal duplication; Region: nusA_Cterm_rpt; TIGR01954
529507016892	transcription termination factor NusA, C-terminal duplication; Region: nusA_Cterm_rpt; TIGR01954
529507016893	HMMPfam hit to PF00575, S1 RNA binding domain, score 4.4e-13
529507016894	Translation initiation factor IF-2, N-terminal region; Region: IF2_N; pfam04760
529507016895	Bacterial translation initiation factor IF-2 associated region; Region: IF2_assoc; pfam08364
529507016896	translation initiation factor IF-2; Region: IF-2; TIGR00487
529507016897	Translation initiation factor IF-2, N-terminal region; Region: IF2_N; pfam04760
529507016898	Initiation Factor 2 (IF2)/ eukaryotic Initiation Factor 5B (eIF5B) family; Region: IF2_eIF5B; cd01887
529507016899	G1 box; other site
529507016900	putative GEF interaction site [polypeptide binding]; other site
529507016901	GTP/Mg2+ binding site [chemical binding]; other site
529507016902	Switch I region; other site
529507016903	G2 box; other site
529507016904	G3 box; other site
529507016905	Switch II region; other site
529507016906	G4 box; other site
529507016907	G5 box; other site
529507016908	This family represents the domain II of bacterial Initiation Factor 2 (IF2) and its eukaryotic mitochondrial homologue mtIF2. IF2, the largest initiation factor is an essential GTP binding protein. In E. coli three natural forms of IF2 exist in the cell; Region: IF2_mtIF2_II; cd03702
529507016909	Translation-initiation factor 2; Region: IF-2; pfam11987
529507016910	mtIF2_IVc: this family represents the C2 subdomain of domain IV of mitochondrial translation initiation factor 2 (mtIF2) which adopts a beta-barrel fold displaying a high degree of structural similarity with domain II of the translation elongation factor...; Region: mtIF2_IVc; cd03692
529507016911	HMMPfam hit to PF04760, Translation initiation factor IF-2, N-ter, score 1.7e-10
529507016912	HMMPfam hit to PF04760, Translation initiation factor IF-2, N-ter, score 1.3e-21
529507016913	HMMPfam hit to PF00009, Elongation factor Tu GTP binding domain, score 3.5e-54
529507016914	HMMPfam hit to PF01926, GTPase of unknown function, score 1.7e-07
529507016915	PS00017 ATP/GTP-binding site motif A (P-loop).
529507016916	HMMPfam hit to PF03144, Elongation factor Tu domain, score 3.2e-12
529507016917	HMMPfam hit to PF03144, Elongation factor Tu domain, score 2.1e-10
529507016918	PS01176 Initiation factor 2 signature.
529507016919	ribosome-binding factor A; Validated; Region: rbfA; PRK00521
529507016920	HMMPfam hit to PF02033, Ribosome-binding factor A, score 2.3e-54
529507016921	PS01319 Ribosome-binding factor A signature.
529507016922	tRNA pseudouridine synthase B; Provisional; Region: truB; PRK05033
529507016923	Pseudouridine synthase, Escherichia coli TruB like; Region: PseudoU_synth_EcTruB; cd02573
529507016924	RNA binding site [nucleotide binding]; other site
529507016925	active site
529507016926	Pseudouridine synthase II TruB, C-terminal; Region: TruB-C_2; pfam09157
529507016927	HMMPfam hit to PF01509, TruB family pseudouridylate synthase (N term, score 1.2e-89
529507016928	Ribosomal protein S15 (prokaryotic)_S13 (eukaryotic) binds the central domain of 16S rRNA and is required for assembly of the small ribosomal subunit and for intersubunit association, thus representing a key element in the assembly of the whole ribosome; Region: Ribosomal_S15p_S13e; cd00353
529507016929	16S/18S rRNA binding site [nucleotide binding]; other site
529507016930	S13e-L30e interaction site [polypeptide binding]; other site
529507016931	25S rRNA binding site [nucleotide binding]; other site
529507016932	HMMPfam hit to PF00312, Ribosomal protein S15, score 4.1e-43
529507016933	PS00362 Ribosomal protein S15 signature.
529507016934	polynucleotide phosphorylase/polyadenylase; Provisional; Region: PRK11824
529507016935	Polyribonucleotide nucleotidyltransferase, repeat 1; Region: RNase_PH_PNPase_1; cd11363
529507016936	RNase E interface [polypeptide binding]; other site
529507016937	trimer interface [polypeptide binding]; other site
529507016938	Polyribonucleotide nucleotidyltransferase, RNA binding domain; Region: PNPase; pfam03726
529507016939	Polyribonucleotide nucleotidyltransferase, repeat 2; Region: RNase_PH_PNPase_2; cd11364
529507016940	RNase E interface [polypeptide binding]; other site
529507016941	trimer interface [polypeptide binding]; other site
529507016942	active site
529507016943	Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH). PNPase is a polyribonucleotide nucleotidyl transferase that degrades mRNA in prokaryotes and plant chloroplasts. The C-terminal region of PNPase contains domains homologous to...; Region: PNPase_KH; cd02393
529507016944	putative nucleic acid binding region [nucleotide binding]; other site
529507016945	G-X-X-G motif; other site
529507016946	S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain. PNPase  is a polyribonucleotide nucleotidyl transferase that degrades mRNA. It is a trimeric multidomain protein. The C-terminus contains the S1 domain which binds ssRNA; Region: S1_PNPase; cd04472
529507016947	RNA binding site [nucleotide binding]; other site
529507016948	domain interface; other site
529507016949	HMMPfam hit to PF01138, 3' exoribonuclease family, domain, score 2e-42
529507016950	HMMPfam hit to PF03725, 3' exoribonuclease family, domain, score 1.7e-18
529507016951	HMMPfam hit to PF03726, Polyribonucleotide nucleotidyltransferase,, score 2.3e-33
529507016952	HMMPfam hit to PF01138, 3' exoribonuclease family, domain, score 1.7e-53
529507016953	HMMPfam hit to PF03725, 3' exoribonuclease family, domain, score 5.6e-21
529507016954	HMMPfam hit to PF00013, KH domain, score 2.4e-16
529507016955	HMMPfam hit to PF07650, KH domain, score 0.014
529507016956	HMMPfam hit to PF00575, S1 RNA binding domain, score 1.6e-27
529507016957	lipoprotein NlpI; Provisional; Region: PRK11189
529507016958	signal peptide predicted for PMI3423 by SignalP 2.0 HMM (Signal peptide probability 0.880) with cleavage site probability 0.421 between residues 21 and 22
529507016959	Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi; Region: TPR; cd00189
529507016960	binding surface
529507016961	TPR motif; other site
529507016962	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507016963	HMMPfam hit to PF07719, Tetratricopeptide repeat, score 0.24; HMMPfam hit to PF00515, Tetratricopeptide repeat, score 0.001
529507016964	HMMPfam hit to PF00515, Tetratricopeptide repeat, score 0.0004; HMMPfam hit to PF07719, Tetratricopeptide repeat, score 0.021
529507016965	HMMPfam hit to PF07719, Tetratricopeptide repeat, score 0.075; HMMPfam hit to PF00515, Tetratricopeptide repeat, score 0.24
529507016966	HMMPfam hit to PF00515, Tetratricopeptide repeat, score 0.37; HMMPfam hit to PF07719, Tetratricopeptide repeat, score 0.46
529507016967	ATP-dependent RNA helicase DeaD; Provisional; Region: PRK11634
529507016968	DEAD-box helicases. A diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker  B motif; Region: DEADc; cd00268
529507016969	ATP binding site [chemical binding]; other site
529507016970	Mg++ binding site [ion binding]; other site
529507016971	motif III; other site
529507016972	Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may...; Region: HELICc; cd00079
529507016973	nucleotide binding region [chemical binding]; other site
529507016974	ATP-binding site [chemical binding]; other site
529507016975	RNA recognition motif in Escherichia coli cold-shock DEAD box protein A (CsdA) and similar proteins; Region: RRM_EcCsdA_like; cd12499
529507016976	putative RNA binding site [nucleotide binding]; other site
529507016977	HMMPfam hit to PF00270, DEAD/DEAH box helicase, score 6.2e-73
529507016978	PS00017 ATP/GTP-binding site motif A (P-loop).
529507016979	PS00039 DEAD-box subfamily ATP-dependent helicases signature.
529507016980	HMMPfam hit to PF00271, Helicase conserved C-terminal domain, score 3.5e-34
529507016981	HMMPfam hit to PF03880, DbpA RNA binding domain, score 3.1e-38
529507016982	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG2964
529507016983	YheO-like PAS domain; Region: PAS_6; pfam08348
529507016984	HTH domain; Region: HTH_22; pfam13309
529507016985	Domain of unknown function (DUF3387); Region: DUF3387; pfam11867
529507016986	Xylose isomerase-like TIM barrel; Region: AP_endonuc_2; pfam01261
529507016987	HMMPfam hit to PF01261, Xylose isomerase-like TIM barrel, score 1.1e-30
529507016988	YjgF, YER057c, and UK114 belong to a large family of proteins present in bacteria, archaea, and eukaryotes with no definitive function. The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no...; Region: YjgF_YER057c_UK114_family; cd00448
529507016989	homotrimer interaction site [polypeptide binding]; other site
529507016990	putative active site [active]
529507016991	HMMPfam hit to PF01042, Endoribonuclease L-PSP, score 9.5e-53
529507016992	PS01094 Uncharacterized protein family UPF0076 signature.
529507016993	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507016994	putative substrate translocation pore; other site
529507016995	phosphoglycerate transporter family protein; Region: 2A0104; TIGR00881
529507016996	12 probable transmembrane helices predicted for PMI3428 by TMHMM2.0 at aa 9-31, 44-66, 73-90, 95-117, 137-159, 169-188, 219-241, 246-265, 285-307, 312-334, 347-369 and 384-403
529507016997	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 4.5e-22
529507016998	hypothetical protein; Provisional; Region: PRK10039
529507016999	putative two-component response-regulatory protein YehT; Provisional; Region: PRK11697
529507017000	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
529507017001	active site
529507017002	phosphorylation site [posttranslational modification]
529507017003	intermolecular recognition site; other site
529507017004	dimerization interface [polypeptide binding]; other site
529507017005	LytTr DNA-binding domain; Region: LytTR; pfam04397
529507017006	HMMPfam hit to PF04397, LytTr DNA-binding domain, score 1.2e-23
529507017007	HMMPfam hit to PF00072, Response regulator receiver domain, score 2.2e-37
529507017008	Putative regulator of cell autolysis [Signal transduction mechanisms]; Region: LytS; COG3275
529507017009	5TMR of 5TMR-LYT; Region: 5TM-5TMR_LYT; pfam07694
529507017010	GAF domain; Region: GAF; pfam01590
529507017011	Histidine kinase; Region: His_kinase; pfam06580
529507017012	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
529507017013	ATP binding site [chemical binding]; other site
529507017014	Mg2+ binding site [ion binding]; other site
529507017015	G-X-G motif; other site
529507017016	HMMPfam hit to PF02518, Histidine kinase-, DNA gyrase B-, and HS, score 4e-08
529507017017	HMMPfam hit to PF06580, Histidine kinase, score 8.2e-39
529507017018	HMMPfam hit to PF01590, GAF domain, score 1.4e-05
529507017019	6 probable transmembrane helices predicted for PMI3431 by TMHMM2.0 at aa 7-24, 44-63, 75-97, 102-124, 137-159 and 174-194
529507017020	HMMPfam hit to PF07694, 5TMR of 5TMR-LYT, score 2.6e-41
529507017021	Biotin-lipoyl like; Region: Biotin_lipoyl_2; pfam13533
529507017022	RND family efflux transporter, MFP subunit; Region: RND_mfp; TIGR01730
529507017023	HlyD family secretion protein; Region: HlyD_3; pfam13437
529507017024	Signal peptide predicted for PMI3432 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.461 between residues 19 and 20
529507017025	1 probable transmembrane helix predicted for PMI3432 by TMHMM2.0 at aa 5-22
529507017026	HMMPfam hit to PF00529, HlyD family secretion protein, score 0.00014
529507017027	ABC-type multidrug transport system, permease component [Defense mechanisms]; Region: COG0842
529507017028	ABC-2 type transporter; Region: ABC2_membrane; pfam01061
529507017029	6 probable transmembrane helices predicted for PMI3433 by TMHMM2.0 at aa 21-43, 189-211, 224-246, 261-283, 288-310 and 344-366
529507017030	YhgE/Pip N-terminal domain; Region: pip_yhgE_Nterm; TIGR03061
529507017031	ABC-2 type transporter; Region: ABC2_membrane; pfam01061
529507017032	ABC-type multidrug transport system, permease component [Defense mechanisms]; Region: COG0842
529507017033	Signal peptide predicted for PMI3434 by SignalP 2.0 HMM (Signal peptide probability 0.990) with cleavage site probability 0.989 between residues 37 and 38
529507017034	6 probable transmembrane helices predicted for PMI3434 by TMHMM2.0 at aa 20-42, 181-203, 216-238, 253-270, 283-305 and 341-363
529507017035	HMMPfam hit to PF01061, ABC-2 type transporter, score 7.5e-05
529507017036	Fimbrial protein; Region: Fimbrial; cl01416
529507017037	Signal peptide predicted for PMI3435 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.544 between residues 24 and 25
529507017038	HMMPfam hit to PF00419, Fimbrial protein, score 5.9e-51
529507017039	fimbrial operon 17
529507017040	fimbrial chaperone protein FimC; Provisional; Region: PRK15195
529507017041	Gram-negative pili assembly chaperone, N-terminal domain; Region: Pili_assembly_N; pfam00345
529507017042	Gram-negative pili assembly chaperone, C-terminal domain; Region: Pili_assembly_C; pfam02753
529507017043	Signal peptide predicted for PMI3436 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.990 between residues 28 and 29
529507017044	1 probable transmembrane helix predicted for PMI3436 by TMHMM2.0 at aa 12-34
529507017045	HMMPfam hit to PF00345, Gram-negative pili assembly chaperone, score 2.7e-52
529507017046	HMMPfam hit to PF02753, Gram-negative pili assembly chaperone, score 6.6e-21
529507017047	P pilus assembly protein, porin PapC [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimD; COG3188
529507017048	PapC N-terminal domain; Region: PapC_N; pfam13954
529507017049	Type VII secretion system (T7SS), usher protein; Region: Usher; pfam00577
529507017050	PapC C-terminal domain; Region: PapC_C; pfam13953
529507017051	Signal peptide predicted for PMI3437 by SignalP 2.0 HMM (Signal peptide probability 0.608) with cleavage site probability 0.306 between residues 35 and 36
529507017052	HMMPfam hit to PF00577, Fimbrial Usher protein, score 0
529507017053	P pilus assembly protein, pilin FimA [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimA; COG3539
529507017054	Signal peptide predicted for PMI3438 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.978 between residues 26 and 27
529507017055	HMMPfam hit to PF00419, Fimbrial protein, score 2.7e-22
529507017056	P pilus assembly protein, pilin FimA [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FimA; COG3539
529507017057	Signal peptide predicted for PMI3439 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.998 between residues 25 and 26
529507017058	HMMPfam hit to PF00419, Fimbrial protein, score 1.9e-06
529507017059	Mannose binding  domain of FimH and related proteins; Region: FimH_man-bind; cd10466
529507017060	mannosyl binding site [chemical binding]; other site
529507017061	Fimbrial protein; Region: Fimbrial; pfam00419
529507017062	Signal peptide predicted for PMI3440 by SignalP 2.0 HMM (Signal peptide probability 0.979) with cleavage site probability 0.602 between residues 25 and 26
529507017063	HMMPfam hit to PF00419, Fimbrial protein, score 3.2e-05
529507017064	putative protease; Provisional; Region: PRK15447
529507017065	Collagenase and related proteases [Posttranslational modification, protein turnover, chaperones]; Region: COG0826
529507017066	HMMPfam hit to PF01136, Peptidase family U32, score 3.4e-07
529507017067	Collagenase and related proteases [Posttranslational modification, protein turnover, chaperones]; Region: COG0826
529507017068	Peptidase family U32; Region: Peptidase_U32; pfam01136
529507017069	HMMPfam hit to PF01136, Peptidase family U32, score 1.3e-118
529507017070	PS01276 Peptidase family U32 signature.
529507017071	Putative lipid carrier protein [Lipid metabolism]; Region: COG3154
529507017072	HMMPfam hit to PF02036, SCP-2 sterol transfer family, score 2.7e-14
529507017073	Acetyltransferases [General function prediction only]; Region: RimI; COG0456
529507017074	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cd04301
529507017075	Coenzyme A binding pocket [chemical binding]; other site
529507017076	HMMPfam hit to PF00583, Acetyltransferase (GNAT) family, score 7.9e-15
529507017077	The GIY-YIG domain of uncharacterized protein family UPF0213 related to structure-specific endonuclease SLX1; Region: GIY-YIG_UPF0213; cd10456
529507017078	GIY-YIG motif/motif A; other site
529507017079	putative active site [active]
529507017080	putative metal binding site [ion binding]; other site
529507017081	HMMPfam hit to PF01541, GIY-YIG catalytic domain, score 1.8e-16
529507017082	Protein of unknown function (DUF1471); Region: DUF1471; cl11507
529507017083	HMMPfam hit to PF07338, Protein of unknown function (DUF1471), score 1.3e-06
529507017084	Signal peptide predicted for PMI3446 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.964 between residues 22 and 23
529507017085	hypothetical protein; Provisional; Region: PRK03467
529507017086	Signal peptide predicted for PMI3448 by SignalP 2.0 HMM (Signal peptide probability 0.673) with cleavage site probability 0.433 between residues 19 and 20
529507017087	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507017088	4Fe-4S single cluster domain; Region: Fer4_12; pfam13353
529507017089	Radical SAM superfamily. Enzymes of this family generate radicals by combining a 4Fe-4S cluster and S-adenosylmethionine (SAM) in close proximity. They are characterized by a conserved CxxxCxxC motif, which coordinates the conserved iron-sulfur cluster; Region: Radical_SAM; cd01335
529507017090	FeS/SAM binding site; other site
529507017091	PS01087 Radical activating enzymes signature.
529507017092	anaerobic ribonucleoside triphosphate reductase; Provisional; Region: PRK09263
529507017093	ATP cone domain; Region: ATP-cone; pfam03477
529507017094	Class III ribonucleotide reductase; Region: RNR_III; cd01675
529507017095	effector binding site; other site
529507017096	active site
529507017097	Zn binding site [ion binding]; other site
529507017098	glycine loop; other site
529507017099	HMMPfam hit to PF01228, Glycine radical, score 8.1e-49
529507017100	PS00850 Glycine radical signature.
529507017101	HMMPfam hit to PF03477, ATP cone domain, score 9.6e-26
529507017102	YjgF, YER057c, and UK114 belong to a large family of proteins present in bacteria, archaea, and eukaryotes with no definitive function. The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no...; Region: YjgF_YER057c_UK114_family; cd00448
529507017103	homotrimer interaction site [polypeptide binding]; other site
529507017104	putative active site [active]
529507017105	HMMPfam hit to PF01042, Endoribonuclease L-PSP, score 2.4e-64
529507017106	PS01094 Uncharacterized protein family UPF0076 signature.
529507017107	aspartate carbamoyltransferase regulatory subunit; Reviewed; Region: PRK00893
529507017108	Aspartate carbamoyltransferase regulatory chain, allosteric domain; Region: PyrI; pfam01948
529507017109	Aspartate carbamoyltransferase regulatory chain, metal binding domain; Region: PyrI_C; pfam02748
529507017110	HMMPfam hit to PF02748, Aspartate carbamoyltransferase regulatory ch, score 1.6e-15
529507017111	HMMPfam hit to PF01948, Aspartate carbamoyltransferase regulatory ch, score 1.4e-55
529507017112	Aspartate carbamoyltransferase, catalytic chain [Nucleotide transport and metabolism]; Region: PyrB; COG0540
529507017113	Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain; Region: OTCace_N; pfam02729
529507017114	Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain; Region: OTCace; pfam00185
529507017115	HMMPfam hit to PF00185, Aspartate/ornithine carbamoyltransferase, As, score 1.8e-57
529507017116	HMMPfam hit to PF02729, Aspartate/ornithine carbamoyltransferase, ca, score 1.2e-68
529507017117	PS00097 Aspartate and ornithine carbamoyltransferases signature.
529507017118	ornithine carbamoyltransferase subunit I; Provisional; Region: PRK03515
529507017119	Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain; Region: OTCace_N; pfam02729
529507017120	Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain; Region: OTCace; pfam00185
529507017121	HMMPfam hit to PF00185, Aspartate/ornithine carbamoyltransferase, As, score 4.6e-91
529507017122	HMMPfam hit to PF02729, Aspartate/ornithine carbamoyltransferase, ca, score 7.6e-74
529507017123	PS00097 Aspartate and ornithine carbamoyltransferases signature.
529507017124	RNase E inhibitor protein; Provisional; Region: PRK11191
529507017125	HMMPfam hit to PF06877, Protein of unknown function (DUF1260), score 5.9e-76
529507017126	Pirin-related protein [General function prediction only]; Region: COG1741
529507017127	Pirin; Region: Pirin; pfam02678
529507017128	Pirin C-terminal cupin domain; Region: Pirin_C; pfam05726
529507017129	HMMPfam hit to PF05726, Pirin C-terminal region, score 6.1e-37
529507017130	HMMPfam hit to PF02678, Pirin, score 4.4e-44
529507017131	Protein of unknown function (DUF4223); Region: DUF4223; pfam13978
529507017132	Signal peptide predicted for PMI3460 by SignalP 2.0 HMM (Signal peptide probability 0.997) with cleavage site probability 0.960 between residues 26 and 27
529507017133	1 probable transmembrane helix predicted for PMI3460 by TMHMM2.0 at aa 7-25
529507017134	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507017135	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cd04301
529507017136	Coenzyme A binding pocket [chemical binding]; other site
529507017137	HMMPfam hit to PF00583, Acetyltransferase (GNAT) family, score 3.9e-20
529507017138	valyl-tRNA synthetase; Reviewed; Region: valS; PRK05729
529507017139	catalytic core domain of valyl-tRNA synthetases; Region: ValRS_core; cd00817
529507017140	HIGH motif; other site
529507017141	Leucyl-tRNA synthetase, Domain 2; Region: tRNA-synt_1_2; pfam13603
529507017142	catalytic core domain of valyl-tRNA synthetases; Region: ValRS_core; cd00817
529507017143	active site
529507017144	KMSKS motif; other site
529507017145	Anticodon-binding domain of valyl tRNA synthetases; Region: Anticodon_Ia_Val; cd07962
529507017146	tRNA binding surface [nucleotide binding]; other site
529507017147	anticodon binding site; other site
529507017148	Valyl tRNA synthetase tRNA binding arm; Region: Val_tRNA-synt_C; pfam10458
529507017149	HMMPfam hit to PF00133, tRNA synthetases class I (I, L, M and V), score 0
529507017150	PS00178 Aminoacyl-transfer RNA synthetases class-I signature.
529507017151	DNA polymerase III subunit chi; Validated; Region: PRK05728
529507017152	HMMPfam hit to PF04364, DNA polymerase III chi subunit, HolC, score 1.6e-65
529507017153	multifunctional aminopeptidase A; Provisional; Region: PRK00913
529507017154	Cytosol aminopeptidase family, N-terminal and catalytic domains.  Family M17 contains zinc- and manganese-dependent exopeptidases ( EC  3.4.11.1), including leucine aminopeptidase. They catalyze removal of amino acids from the N-terminus of a protein and...; Region: Peptidase_M17; cd00433
529507017155	interface (dimer of trimers) [polypeptide binding]; other site
529507017156	Substrate-binding/catalytic site; other site
529507017157	Zn-binding sites [ion binding]; other site
529507017158	HMMPfam hit to PF00883, Cytosol aminopeptidase family, cataly, score 1.3e-196
529507017159	PS00631 Cytosol aminopeptidase signature.
529507017160	HMMPfam hit to PF02789, Cytosol aminopeptidase family, N-term, score 8.8e-51
529507017161	lipopolysaccharide ABC transporter permease LptF; Provisional; Region: PRK15120
529507017162	Predicted permease YjgP/YjgQ family; Region: YjgP_YjgQ; pfam03739
529507017163	HMMPfam hit to PF03739, Predicted permease YjgP/YjgQ family, score 1.9e-70
529507017164	6 probable transmembrane helices predicted for PMI3465 by TMHMM2.0 at aa 17-39, 59-81, 101-123, 267-289, 296-313 and 328-347
529507017165	lipopolysaccharide ABC transporter permease; Provisional; Region: PRK15071
529507017166	Predicted permease YjgP/YjgQ family; Region: YjgP_YjgQ; pfam03739
529507017167	HMMPfam hit to PF03739, Predicted permease YjgP/YjgQ family, score 3.2e-94
529507017168	6 probable transmembrane helices predicted for PMI3466 by TMHMM2.0 at aa 12-34, 62-81, 102-124, 277-296, 303-320 and 330-352
529507017169	Beta-lactamase class C and other penicillin binding proteins [Defense mechanisms]; Region: AmpC; COG1680
529507017170	beta-lactam binding protein AmpH; Provisional; Region: PRK10662
529507017171	HMMPfam hit to PF00144, Beta-lactamase, score 7.3e-54
529507017172	prophage/mobile element
529507017173	integrase; Provisional; Region: PRK09692
529507017174	Bacteriophage P4 integrase. P4-like integrases are found in temperate bacteriophages, integrative plasmids, pathogenicity and symbiosis islands, and other mobile genetic elements.  They share the same fold in their catalytic domain and the overall...; Region: INT_P4; cd00801
529507017175	active site
529507017176	Int/Topo IB signature motif; other site
529507017177	HMMPfam hit to PF00589, Phage integrase family, score 1.5e-39
529507017178	phage integrase (fragment)
529507017179	3 probable transmembrane helices predicted for PMI3471 by TMHMM2.0 at aa 163-180, 193-215 and 220-239
529507017180	1 probable transmembrane helix predicted for PMI3472 by TMHMM2.0 at aa 4-26
529507017181	1 probable transmembrane helix predicted for PMI3473 by TMHMM2.0 at aa 10-29
529507017182	37-kD nucleoid-associated bacterial protein; Region: NA37; pfam04245
529507017183	2 probable transmembrane helices predicted for PMI3475 by TMHMM2.0 at aa 288-310 and 374-393
529507017184	2 probable transmembrane helices predicted for PMI3476 by TMHMM2.0 at aa 12-31 and 79-101
529507017185	conserved hypothetical protein (fragment)
529507017186	Predicted transcriptional regulator [Transcription]; Region: AlpA; COG3311
529507017187	HMMPfam hit to PF05930, Prophage CP4-57 regulatory protein (AlpA), score 1e-20
529507017188	Protein of unknown function (DUF3296); Region: DUF3296; pfam11726
529507017189	Predicted GTPase [General function prediction only]; Region: COG3596
529507017190	YfjP GTPase; Region: YfjP; cd11383
529507017191	G1 box; other site
529507017192	GTP/Mg2+ binding site [chemical binding]; other site
529507017193	Switch I region; other site
529507017194	G2 box; other site
529507017195	Switch II region; other site
529507017196	G3 box; other site
529507017197	G4 box; other site
529507017198	G5 box; other site
529507017199	HMMPfam hit to PF01926, GTPase of unknown function, score 1.1e-23
529507017200	PS00017 ATP/GTP-binding site motif A (P-loop).
529507017201	Antirestriction protein; Region: Antirestrict; pfam03230
529507017202	HMMPfam hit to PF03230, Antirestriction protein, score 1.5e-36
529507017203	Domain of unknown function (DUF932); Region: DUF932; pfam06067
529507017204	HMMPfam hit to PF06067, Domain of unknown function (DUF932), score 6.8e-202
529507017205	HTH domain; Region: HTH_11; cl17392
529507017206	WYL domain; Region: WYL; pfam13280
529507017207	Signal peptide predicted for PMI3484 by SignalP 2.0 HMM (Signal peptide probability 0.927) with cleavage site probability 0.851 between residues 34 and 35
529507017208	Uncharacterized Zn-ribbon-containing protein involved in phosphonate metabolism [Inorganic ion transport and metabolism]; Region: PhnA; COG2824
529507017209	4 probable transmembrane helices predicted for PMI3486 by TMHMM2.0 at aa 16-38, 53-75, 88-110 and 120-139
529507017210	Signal peptide predicted for PMI3487 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.936 between residues 22 and 23
529507017211	Signal peptide predicted for PMI3490 by SignalP 2.0 HMM (Signal peptide probability 0.977) with cleavage site probability 0.630 between residues 21 and 22
529507017212	Uncharacterized protein conserved in bacteria (DUF2136); Region: DUF2136; cl01912
529507017213	Predicted transcription regulator containing HTH domain [Transcription]; Region: COG5499
529507017214	Domain of unknown function (DUF955); Region: DUF955; pfam06114
529507017215	HMMPfam hit to PF06114, Domain of unknown function (DUF955), score 7.7e-08
529507017216	PS00142 Neutral zinc metallopeptidases, zinc-binding region signature.
529507017217	Beta protein; Region: Beta_protein; pfam14350
529507017218	conserved hypothetical protein (pseudogene)
529507017219	deoxyguanosinetriphosphate triphosphohydrolase-like protein; Provisional; Region: PRK01096
529507017220	Phosphohydrolase-associated domain; Region: HD_assoc; pfam13286
529507017221	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507017222	Predicted restriction endonuclease [Defense mechanisms]; Region: COG3440
529507017223	HNH nucleases; HNH endonuclease signature which is found in viral, prokaryotic, and eukaryotic proteins. The alignment includes members of the large group of homing endonucleases, yeast intron 1 protein, MutS, as well as bacterial colicins, pyocins, and...; Region: HNHc; cd00085
529507017224	active site
529507017225	Transposase IS200 like; Region: Y1_Tnp; pfam01797
529507017226	HMMPfam hit to PF01797, Transposase IS200 like, score 3.5e-42
529507017227	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507017228	Helix-turn-helix domain; Region: HTH_OrfB_IS605; pfam12323
529507017229	Transposase and inactivated derivatives [DNA replication, recombination, and repair]; Region: COG0675
529507017230	Probable transposase; Region: OrfB_IS605; pfam01385
529507017231	transposase, IS605 OrfB family, central region; Region: tspaseT_teng_C; TIGR01766
529507017232	HMMPfam hit to PF01385, Probable transposase, score 4.1e-125
529507017233	HMMPfam hit to PF07282, transposase DNA-binding domai, score 3e-34
529507017234	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507017235	Predicted transcriptional regulators [Transcription]; Region: HipB; COG1396
529507017236	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
529507017237	non-specific DNA binding site [nucleotide binding]; other site
529507017238	salt bridge; other site
529507017239	sequence-specific DNA binding site [nucleotide binding]; other site
529507017240	HMMPfam hit to PF01381, Helix-turn-helix, score 1.3e-09
529507017241	peptide chain release factor-like protein; Reviewed; Region: prfH; PRK08179
529507017242	Protein chain release factor B [Translation, ribosomal structure and biogenesis]; Region: PrfB; COG1186
529507017243	HMMPfam hit to PF00472, Peptidyl-tRNA hydrolase domain, score 8.6e-18
529507017244	PS00745 Prokaryotic-type class I peptide chain release factors signature.
529507017245	hypothetical protein; Reviewed; Region: PRK09588
529507017246	Uncharacterized protein family UPF0027; Region: UPF0027; cl17455
529507017247	HMMPfam hit to PF01139, Uncharacterized protein family UPF0027, score 1.8e-93
529507017248	DNA-binding transcriptional repressor DeoR; Provisional; Region: PRK10681
529507017249	DeoR-like helix-turn-helix domain; Region: HTH_DeoR; cl17531
529507017250	DeoR C terminal sensor domain; Region: DeoRC; pfam00455
529507017251	HMMPfam hit to PF00455, Bacterial regulatory proteins, deoR family, score 2.3e-36
529507017252	PS00894 Bacterial regulatory proteins, deoR family signature.
529507017253	2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family; Region: DeoC; cd00959
529507017254	intersubunit interface [polypeptide binding]; other site
529507017255	active site
529507017256	catalytic residue [active]
529507017257	HMMPfam hit to PF01791, Deoxyribose-phosphate aldolase, score 6e-86
529507017258	Sugar kinases, ribokinase family [Carbohydrate transport and metabolism]; Region: RbsK; COG0524
529507017259	Ribokinase catalyses the phosphorylation of ribose to ribose-5-phosphate using ATP. This reaction is the first step in the ribose metabolism. It traps ribose within the cell after uptake and also prepares the sugar for use in the synthesis of nucleotides...; Region: ribokinase; cd01174
529507017260	substrate binding site [chemical binding]; other site
529507017261	dimer interface [polypeptide binding]; other site
529507017262	ATP binding site [chemical binding]; other site
529507017263	HMMPfam hit to PF00294, pfkB family carbohydrate kinase, score 6e-67
529507017264	N-acetylmuramic acid-6-phosphate etherase; Reviewed; Region: murQ; PRK05441
529507017265	N-acetylmuramic acid 6-phosphate etherase. Members of this family contain the SIS (Sugar ISomerase) domain. The SIS domain is found in many phosphosugar isomerases and phosphosugar binding proteins. The bacterial cell wall sugar N-acetylmuramic acid...; Region: SIS_Etherase; cd05007
529507017266	putative active site [active]
529507017267	HMMPfam hit to PF01380, SIS domain, score 0.0023
529507017268	PS01272 Glucokinase regulatory protein family signature.
529507017269	PTS_IIB, PTS system, glucose/sucrose specific IIB subunit. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. This family...; Region: PTS_IIB_glc; cd00212
529507017270	PTS system, sucrose-specific IIBC component; Region: PTS-II-BC-sucr; TIGR01996
529507017271	active site turn [active]
529507017272	phosphorylation site [posttranslational modification]
529507017273	Phosphotransferase system IIC components, glucose/maltose/N-acetylglucosamine-specific [Carbohydrate transport and metabolism]; Region: PtsG; COG1263
529507017274	HMMPfam hit to PF00367, phosphotransferase system, EIIB, score 2.9e-07
529507017275	PS01035 PTS EIIB domains cysteine phosphorylation site signature.
529507017276	HMMPfam hit to PF02378, Phosphotransferase system, EIIC, score 5.4e-30
529507017277	10 probable transmembrane helices predicted for PMI3515 by TMHMM2.0 at aa 117-139, 159-176, 183-205, 215-237, 244-266, 281-303, 323-345, 360-382, 389-411 and 426-448
529507017278	Helix-turn-helix domain, rpiR family; Region: HTH_6; pfam01418
529507017279	Transcriptional regulators [Transcription]; Region: RpiR; COG1737
529507017280	RpiR-like protein. RpiR contains a SIS (Sugar ISomerase) domain, which is found in many phosphosugar isomerases and phosphosugar binding proteins. In E. coli, rpiR negatively regulates the expression of rpiB gene. Both rpiB and rpiA are ribose phosphate...; Region: SIS_RpiR; cd05013
529507017281	putative active site [active]
529507017282	HMMPfam hit to PF01418, Helix-turn-helix domain, rpiR family, score 6.5e-34
529507017283	HMMPfam hit to PF01380, SIS domain, score 1.3e-26
529507017284	Sulfite exporter TauE/SafE; Region: TauE; pfam01925
529507017285	Signal peptide predicted for PMI3517 by SignalP 2.0 HMM (Signal peptide probability 0.986) with cleavage site probability 0.323 between residues 45 and 46
529507017286	8 probable transmembrane helices predicted for PMI3517 by TMHMM2.0 at aa 4-26, 31-53, 73-95, 107-129, 154-176, 181-203, 213-235 and 242-259
529507017287	HMMPfam hit to PF01925, Domain of unknown function DUF81, score 3.7e-23
529507017288	1 probable transmembrane helix predicted for PMI3518 by TMHMM2.0 at aa 7-29
529507017289	acetolactate synthase catalytic subunit; Validated; Region: PRK08155
529507017290	Pyrimidine (PYR) binding domain of POX and related proteins; Region: TPP_PYR_POX_like; cd07035
529507017291	PYR/PP interface [polypeptide binding]; other site
529507017292	dimer interface [polypeptide binding]; other site
529507017293	TPP binding site [chemical binding]; other site
529507017294	Thiamine pyrophosphate enzyme, central domain; Region: TPP_enzyme_M; pfam00205
529507017295	Thiamine pyrophosphate (TPP) family, Acetohydroxyacid synthase (AHAS) subfamily, TPP-binding module; composed of proteins similar to the large catalytic subunit of AHAS. AHAS catalyzes the condensation of two molecules of pyruvate to give the...; Region: TPP_AHAS; cd02015
529507017296	TPP-binding site [chemical binding]; other site
529507017297	dimer interface [polypeptide binding]; other site
529507017298	HMMPfam hit to PF02776, Thiamine pyrophosphate enzyme, N-termina, score 2.8e-97
529507017299	HMMPfam hit to PF00205, Thiamine pyrophosphate enzyme, central d, score 1.7e-61
529507017300	PS00187 Thiamine pyrophosphate enzymes signature.
529507017301	Acetolactate synthase, small (regulatory) subunit [Amino acid transport and metabolism]; Region: IlvH; COG0440
529507017302	N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS); Region: ACT_AHAS; cd04878
529507017303	putative valine binding site [chemical binding]; other site
529507017304	dimer interface [polypeptide binding]; other site
529507017305	HMMPfam hit to PF01842, ACT domain, score 4.2e-07
529507017306	Co/Zn/Cd efflux system component [Inorganic ion transport and metabolism]; Region: CzcD; COG1230
529507017307	HMMPfam hit to PF01545, Cation efflux family, score 3.3e-95
529507017308	6 probable transmembrane helices predicted for PMI3521 by TMHMM2.0 at aa 23-45, 55-74, 87-109, 124-141, 162-184 and 189-206
529507017309	Predicted transcriptional regulators [Transcription]; Region: HipB; COG1396
529507017310	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
529507017311	non-specific DNA binding site [nucleotide binding]; other site
529507017312	salt bridge; other site
529507017313	sequence-specific DNA binding site [nucleotide binding]; other site
529507017314	Cupin domain; Region: Cupin_2; cl17218
529507017315	HMMPfam hit to PF07883, Cupin domain, score 0.00036
529507017316	HMMPfam hit to PF01381, Helix-turn-helix, score 4.9e-17
529507017317	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507017318	Major Facilitator Superfamily; Region: MFS_1; pfam07690
529507017319	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507017320	12 probable transmembrane helices predicted for PMI3523 by TMHMM2.0 at aa 12-34, 49-71, 78-100, 104-126, 138-160, 165-182, 201-223, 233-255, 275-294, 298-320, 333-355 and 359-378
529507017321	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 2.5e-32
529507017322	Xanthine/uracil/vitamin C permease [Nucleotide transport and    metabolism]; Region: COG2252
529507017323	HMMPfam hit to PF00860, Permease family, score 9.6e-81
529507017324	13 probable transmembrane helices predicted for PMI3524 by TMHMM2.0 at aa 5-27, 31-53, 55-74, 79-101, 108-130, 145-167, 174-196, 228-250, 270-292, 297-319, 324-346, 366-388 and 401-418
529507017325	PS00017 ATP/GTP-binding site motif A (P-loop).
529507017326	putative acetyltransferase YhhY; Provisional; Region: PRK10140
529507017327	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cd04301
529507017328	Coenzyme A binding pocket [chemical binding]; other site
529507017329	HMMPfam hit to PF00583, Acetyltransferase (GNAT) family, score 1.7e-20
529507017330	Na+/H+ antiporter, bacterial form; Region: a_cpa1; TIGR00831
529507017331	Kef-type K+ transport systems, membrane components [Inorganic ion transport and metabolism]; Region: KefB; cl10482
529507017332	HMMPfam hit to PF00999, Sodium/hydrogen exchanger family, score 7.6e-107
529507017333	11 probable transmembrane helices predicted for PMI3526 by TMHMM2.0 at aa 4-26, 86-108, 113-135, 161-183, 188-207, 219-236, 241-260, 281-303, 313-335, 361-383 and 398-420
529507017334	Carboxylate/Amino Acid/Amine Transporter; Region: 2A78; TIGR00950
529507017335	Signal peptide predicted for PMI3527 by SignalP 2.0 HMM (Signal peptide probability 0.739) with cleavage site probability 0.472 between residues 23 and 24
529507017336	10 probable transmembrane helices predicted for PMI3527 by TMHMM2.0 at aa 2-24, 28-47, 56-78, 83-105, 112-129, 139-158, 170-192, 202-224, 231-253 and 258-275
529507017337	HMMPfam hit to PF00892, Integral membrane protein DUF6, score 1.5e-06
529507017338	DNA-binding transcriptional regulator MetR; Provisional; Region: PRK15421
529507017339	Bacterial regulatory helix-turn-helix protein, lysR family; Region: HTH_1; pfam00126
529507017340	The C-terminal substrate binding domain of LysR-type transcriptional regulator metR, which regulates the expression of methionine biosynthetic genes, contains type 2 periplasmic binding fold; Region: PBP2_MetR; cd08441
529507017341	putative dimerization interface [polypeptide binding]; other site
529507017342	HMMPfam hit to PF03466, LysR substrate binding domain, score 8.2e-46
529507017343	PS01047 Heavy-metal-associated domain.
529507017344	HMMPfam hit to PF00126, Bacterial regulatory helix-turn-helix, score 1.7e-14
529507017345	PS00044 Bacterial regulatory proteins, lysR family signature.
529507017346	5-methyltetrahydropteroyltriglutamate--homocysteine S-methyltransferase; Provisional; Region: PRK05222
529507017347	CIMS - Cobalamine-independent methonine synthase, or MetE, N-terminal domain_like. Many members have been characterized as 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferases, EC:2.1.1.14, mostly from bacteria and plants. This enzyme...; Region: CIMS_N_terminal_like; cd03312
529507017348	THF binding site; other site
529507017349	CIMS - Cobalamine-independent methonine synthase, or MetE, C-terminal domain_like. Many members have been characterized as 5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferases, EC:2.1.1.14, mostly from bacteria and plants. This enzyme...; Region: CIMS_C_terminal_like; cd03311
529507017350	substrate binding site [chemical binding]; other site
529507017351	THF binding site; other site
529507017352	zinc-binding site [ion binding]; other site
529507017353	HMMPfam hit to PF01717, Methionine synthase, vitamin-B12 inde, score 3.1e-221
529507017354	2 probable transmembrane helices predicted for PMI3530 by TMHMM2.0 at aa 40-62 and 139-161
529507017355	Bacterial protein of unknown function (DUF937); Region: DUF937; cl01528
529507017356	HMMPfam hit to PF06078, Bacterial protein of unknown function (DUF93, score 7.4e-23
529507017357	uridine phosphorylase; Provisional; Region: PRK11178
529507017358	Phosphorylase superfamily; Region: PNP_UDP_1; cl00303
529507017359	HMMPfam hit to PF01048, Phosphorylase family, score 1.1e-102
529507017360	PS01232 Purine and other phosphorylases family 1 signature.
529507017361	Tyrosine phosphatase family; Region: Y_phosphatase3; pfam13350
529507017362	Tyrosine phosphatase family C-terminal region; Region: Y_phosphatase3C; pfam13348
529507017363	PS00343 Gram-positive cocci surface proteins 'anchoring' hexapeptide.
529507017364	Uncharacterized membrane-associated protein [Function unknown]; Region: DedA; COG0586
529507017365	SNARE associated Golgi protein; Region: SNARE_assoc; pfam09335
529507017366	4 probable transmembrane helices predicted for PMI3534 by TMHMM2.0 at aa 19-41, 61-83, 113-135 and 150-172
529507017367	HMMPfam hit to PF00597, DedA family, score 9.2e-20
529507017368	Predicted nuclease of restriction endonuclease-like fold, RmuC family [General function prediction only]; Region: COG1322
529507017369	RmuC family; Region: RmuC; pfam02646
529507017370	1 probable transmembrane helix predicted for PMI3535 by TMHMM2.0 at aa 5-27
529507017371	HMMPfam hit to PF02646, RmuC family, score 9.9e-138
529507017372	ubiE/COQ5 methyltransferase family; Region: Ubie_methyltran; pfam01209
529507017373	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
529507017374	S-adenosylmethionine binding site [chemical binding]; other site
529507017375	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG4627
529507017376	HMMPfam hit to PF01209, ubiE/COQ5 methyltransferase family, score 7.2e-153
529507017377	PS01183 ubiE/COQ5 methyltransferase family signature 1.
529507017378	PS01184 ubiE/COQ5 methyltransferase family signature 2.
529507017379	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG3165
529507017380	SCP-2 sterol transfer family; Region: SCP2; pfam02036
529507017381	HMMPfam hit to PF06843, Protein of unknown function (DUF1243), score 1.5e-59
529507017382	putative ubiquinone biosynthesis protein UbiB; Reviewed; Region: ubiB; PRK04750
529507017383	2-polyprenylphenol 6-hydroxylase; Region: UbiB; TIGR01982
529507017384	HMMPfam hit to PF03109, ABC1 family, score 5.6e-57
529507017385	2 probable transmembrane helices predicted for PMI3538 by TMHMM2.0 at aa 497-519 and 521-538
529507017386	twin arginine translocase protein A; Provisional; Region: tatA; PRK04598
529507017387	HMMPfam hit to PF02416, mttA/Hcf106 family, score 3.4e-09
529507017388	1 probable transmembrane helix predicted for PMI3539 by TMHMM2.0 at aa 4-21
529507017389	sec-independent translocase; Provisional; Region: PRK01770
529507017390	1 probable transmembrane helix predicted for PMI3540 by TMHMM2.0 at aa 4-21
529507017391	twin-arginine protein translocation system subunit TatC; Provisional; Region: PRK10921
529507017392	HMMPfam hit to PF00902, Sec-independent protein translocase protein, score 9.6e-96
529507017393	6 probable transmembrane helices predicted for PMI3541 by TMHMM2.0 at aa 20-42, 74-96, 116-138, 158-180, 193-210 and 215-237
529507017394	PS01218 Uncharacterized protein family UPF0032 signature.
529507017395	transcriptional activator RfaH; Provisional; Region: rfaH; PRK09014
529507017396	N-Utilization Substance G (NusG) N-terminal domain in the NusG Specialized Paralog (SP), RfaH; Region: NGN_SP_RfaH; cd09892
529507017397	Helix-turn-helix domain; Region: HTH_OrfB_IS605; pfam12323
529507017398	Transposase and inactivated derivatives [DNA replication, recombination, and repair]; Region: COG0675
529507017399	Probable transposase; Region: OrfB_IS605; pfam01385
529507017400	transposase, IS605 OrfB family, central region; Region: tspaseT_teng_C; TIGR01766
529507017401	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507017402	HMMPfam hit to PF07282, transposase DNA-binding domai, score 3e-34
529507017403	HMMPfam hit to PF01385, Probable transposase, score 1.9e-132
529507017404	Transposase IS200 like; Region: Y1_Tnp; pfam01797
529507017405	HMMPfam hit to PF01797, Transposase IS200 like, score 8.2e-43
529507017406	Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E; Region: GAT1_Peptidase_E; cd03146
529507017407	active site pocket [active]
529507017408	oxyanion hole [active]
529507017409	catalytic triad [active]
529507017410	active site nucleophile [active]
529507017411	PS00063 Aldo/keto reductase family active site signature.
529507017412	HMMPfam hit to PF03575, Peptidase family S51, score 8.5e-56
529507017413	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507017414	PS00120 Lipases, serine active site.
529507017415	3-octaprenyl-4-hydroxybenzoate decarboxylase; Provisional; Region: PRK10922
529507017416	HMMPfam hit to PF01977, 3-octaprenyl-4-hydroxybenzoate carboxy-lyase, score 6.1e-238
529507017417	FMN reductase; Validated; Region: fre; PRK08051
529507017418	NAD(P)H dependent flavin oxidoreductases use flavin as a substrate in mediating electron transfer from iron complexes or iron proteins. Structurally similar to ferredoxin reductases, but with only 15% sequence identity, flavin reductases reduce FAD, FMN; Region: flavin_oxioreductase; cd06189
529507017419	FAD binding pocket [chemical binding]; other site
529507017420	FAD binding motif [chemical binding]; other site
529507017421	phosphate binding motif [ion binding]; other site
529507017422	beta-alpha-beta structure motif; other site
529507017423	NAD binding pocket [chemical binding]; other site
529507017424	HMMPfam hit to PF00175, Oxidoreductase NAD-binding domain, score 1.5e-34
529507017425	3-ketoacyl-CoA thiolase; Reviewed; Region: fadA; PRK08947
529507017426	Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine. They are found in prokaryotes and...; Region: thiolase; cd00751
529507017427	dimer interface [polypeptide binding]; other site
529507017428	active site
529507017429	HMMPfam hit to PF02803, Thiolase, C-terminal domain, score 2.6e-75
529507017430	PS00099 Thiolases active site.
529507017431	PS00737 Thiolases signature 2.
529507017432	HMMPfam hit to PF00108, Thiolase, N-terminal domain, score 3.6e-113
529507017433	PS00178 Aminoacyl-transfer RNA synthetases class-I signature.
529507017434	PS00098 Thiolases acyl-enzyme intermediate signature.
529507017435	multifunctional fatty acid oxidation complex subunit alpha; Reviewed; Region: fadB; PRK11730
529507017436	Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily. This superfamily contains a diverse set of enzymes including enoyl-CoA hydratase, napthoate synthase, methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA dehydratase, and dienoyl-CoA isomerase; Region: crotonase-like; cd06558
529507017437	substrate binding site [chemical binding]; other site
529507017438	oxyanion hole (OAH) forming residues; other site
529507017439	trimer interface [polypeptide binding]; other site
529507017440	3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; Region: 3HCDH_N; pfam02737
529507017441	3-hydroxyacyl-CoA dehydrogenase, C-terminal domain; Region: 3HCDH; pfam00725
529507017442	3-hydroxyacyl-CoA dehydrogenase, C-terminal domain; Region: 3HCDH; pfam00725
529507017443	HMMPfam hit to PF00725, 3-hydroxyacyl-CoA dehydrogenase, C-terminal, score 8.9e-05
529507017444	HMMPfam hit to PF00725, 3-hydroxyacyl-CoA dehydrogenase, C-terminal, score 4.5e-30
529507017445	PS00067 3-hydroxyacyl-CoA dehydrogenase signature.
529507017446	HMMPfam hit to PF02737, 3-hydroxyacyl-CoA dehydrogenase, NAD binding, score 5.8e-97
529507017447	HMMPfam hit to PF00378, Enoyl-CoA hydratase/isomerase family, score 3.3e-80
529507017448	PS00166 Enoyl-CoA hydratase/isomerase signature.
529507017449	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507017450	proline dipeptidase; Provisional; Region: PRK13607
529507017451	Prolidase. E.C. 3.4.13.9. Also known as Xaa-Pro dipeptidase, X-Pro dipeptidase, proline dipeptidase., imidodipeptidase, peptidase D, gamma-peptidase. Catalyses hydrolysis of Xaa-Pro dipeptides; also acts on aminoacyl-hydroxyproline analogs. No action on...; Region: Prolidase; cd01087
529507017452	active site
529507017453	HMMPfam hit to PF00557, metallopeptidase family M24, score 3e-81
529507017454	PS00491 Aminopeptidase P and proline dipeptidase signature.
529507017455	hypothetical protein; Provisional; Region: PRK11568
529507017456	Uncharacterized protein family UPF0029; Region: UPF0029; pfam01205
529507017457	Domain of unknown function (DUF1949); Region: DUF1949; pfam09186
529507017458	HMMPfam hit to PF01205, Uncharacterized protein family UPF0029, score 1e-59
529507017459	PS00910 Uncharacterized protein family UPF0029 signature.
529507017460	potassium transporter; Provisional; Region: PRK10750
529507017461	potassium uptake protein, TrkH family; Region: 2a38; TIGR00933
529507017462	Signal peptide predicted for PMI3553 by SignalP 2.0 HMM (Signal peptide probability 0.903) with cleavage site probability 0.532 between residues 40 and 41
529507017463	11 probable transmembrane helices predicted for PMI3553 by TMHMM2.0 at aa 9-31, 35-57, 69-91, 133-155, 183-205, 238-260, 273-295, 332-354, 396-418, 422-444 and 456-478
529507017464	HMMPfam hit to PF02386, Cation transport protein, score 3.7e-109
529507017465	protoporphyrinogen oxidase; Provisional; Region: hemG; PRK11104
529507017466	Transcriptional regulators [Transcription]; Region: GntR; COG1802
529507017467	Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators; Region: WHTH_GntR; cd07377
529507017468	DNA-binding site [nucleotide binding]; DNA binding site
529507017469	FCD domain; Region: FCD; pfam07729
529507017470	HMMPfam hit to PF07729, FCD domain, score 0.00012
529507017471	HMMPfam hit to PF00392, Bacterial regulatory proteins, gntR family, score 8.5e-20
529507017472	PS00043 Bacterial regulatory proteins, gntR family signature.
529507017473	Mn2+ and Fe2+ transporters of the NRAMP family [Inorganic ion transport and metabolism]; Region: MntH; COG1914
529507017474	Signal peptide predicted for PMI3556 by SignalP 2.0 HMM (Signal peptide probability 0.996) with cleavage site probability 0.593 between residues 48 and 49
529507017475	11 probable transmembrane helices predicted for PMI3556 by TMHMM2.0 at aa 21-40, 50-72, 93-115, 130-144, 156-175, 190-212, 238-260, 291-313, 325-344, 348-370 and 391-413
529507017476	LamB/YcsF family of  lactam utilization protein; Region: LamB_YcsF_like; cd10787
529507017477	putative active site [active]
529507017478	HMMPfam hit to PF03746, LamB/YcsF family, score 7.2e-145
529507017479	Allophanate hydrolase subunit 1; Region: AHS1; smart00796
529507017480	Allophanate hydrolase subunit 1 [Amino acid transport and metabolism]; Region: DUR1; COG2049
529507017481	Allophanate hydrolase subunit 2; Region: AHS2; smart00797
529507017482	HMMPfam hit to PF02682, Allophanate hydrolase subunit, score 8.3e-41
529507017483	HMMPfam hit to PF02626, Allophanate hydrolase subunit, score 5e-72
529507017484	Carbamoyl-phosphate synthase L chain, N-terminal domain; Region: CPSase_L_chain; pfam00289
529507017485	acetyl-CoA carboxylase biotin carboxylase subunit; Validated; Region: PRK08591
529507017486	Carbamoyl-phosphate synthase L chain, ATP binding domain; Region: CPSase_L_D2; pfam02786
529507017487	Biotin carboxylase C-terminal domain; Region: Biotin_carb_C; pfam02785
529507017488	Biotin carboxyl carrier protein [Lipid metabolism]; Region: AccB; COG0511
529507017489	The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase; Region: biotinyl_domain; cd06850
529507017490	carboxyltransferase (CT) interaction site; other site
529507017491	biotinylation site [posttranslational modification]; other site
529507017492	HMMPfam hit to PF00289, Carbamoyl-phosphate synthase L chain,, score 4.2e-41
529507017493	HMMPfam hit to PF02786, Carbamoyl-phosphate synthase L chain,, score 1.7e-98
529507017494	PS00867 Carbamoyl-phosphate synthase subdomain signature 2.
529507017495	HMMPfam hit to PF02785, Biotin carboxylase C-terminal domain, score 3.4e-57
529507017496	HMMPfam hit to PF00364, Biotin-requiring enzyme, score 1.4e-12
529507017497	PS00188 Biotin-requiring enzymes attachment site.
529507017498	Signal peptide predicted for PMI3560 by SignalP 2.0 HMM (Signal peptide probability 0.866) with cleavage site probability 0.687 between residues 42 and 43
529507017499	HMMPfam hit to PF01925, Domain of unknown function DUF81, score 7.3e-24
529507017500	7 probable transmembrane helices predicted for PMI3560 by TMHMM2.0 at aa 7-29, 72-94, 106-128, 155-177, 189-211, 215-237 and 244-261
529507017501	His-Xaa-Ser system protein HsxD; Region: chp_LLNDYxLRE; TIGR03976
529507017502	His-Xaa-Ser system radical SAM maturase HxsB; Region: rSAM_paired_1; TIGR03978
529507017503	Radical SAM superfamily. Enzymes of this family generate radicals by combining a 4Fe-4S cluster and S-adenosylmethionine (SAM) in close proximity. They are characterized by a conserved CxxxCxxC motif, which coordinates the conserved iron-sulfur cluster; Region: Radical_SAM; cd01335
529507017504	FeS/SAM binding site; other site
529507017505	HMMPfam hit to PF04055, Radical SAM superfamily, score 3.3e-10
529507017506	His-Xaa-Ser system radical SAM maturase HxsC; Region: rSAM_pair_HxsC; TIGR03977
529507017507	Radical SAM superfamily. Enzymes of this family generate radicals by combining a 4Fe-4S cluster and S-adenosylmethionine (SAM) in close proximity. They are characterized by a conserved CxxxCxxC motif, which coordinates the conserved iron-sulfur cluster; Region: Radical_SAM; cd01335
529507017508	FeS/SAM binding site; other site
529507017509	HMMPfam hit to PF04055, Radical SAM superfamily, score 4.3e-19
529507017510	His-Xaa-Ser repeat protein HxsA; Region: His_Ser_Rich; TIGR03979
529507017511	His-Xaa-Ser repeat protein HxsA; Region: His_Ser_Rich; TIGR03979
529507017512	Signal peptide predicted for PMI3564 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.758 between residues 22 and 23
529507017513	PS00225 Crystallins beta and gamma 'Greek key' motif signature.
529507017514	Predicted membrane protein [Function unknown]; Region: COG4125
529507017515	Bacterial Transmembrane Pair family; Region: BTP; pfam05232
529507017516	Bacterial Transmembrane Pair family; Region: BTP; pfam05232
529507017517	HMMPfam hit to PF05232, Bacterial Transmembrane Pair family, score 5.6e-30
529507017518	4 probable transmembrane helices predicted for PMI3566 by TMHMM2.0 at aa 7-29, 39-58, 79-101 and 106-128
529507017519	HMMPfam hit to PF05232, Bacterial Transmembrane Pair family, score 1.1e-25
529507017520	Transcriptional regulator [Transcription]; Region: LysR; COG0583
529507017521	Bacterial regulatory helix-turn-helix protein, lysR family; Region: HTH_1; pfam00126
529507017522	The substrate binding domain of LysR-type transcriptional regulators (LTTRs), a member of the type 2 periplasmic binding fold protein superfamily; Region: PBP2_LTTR_substrate; cd05466
529507017523	dimerization interface [polypeptide binding]; other site
529507017524	HMMPfam hit to PF00126, Bacterial regulatory helix-turn-helix, score 6.5e-18
529507017525	PS00044 Bacterial regulatory proteins, lysR family signature.
529507017526	HMMPfam hit to PF03466, LysR substrate binding domain, score 4e-19
529507017527	transcriptional regulator NarL; Provisional; Region: PRK10651
529507017528	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
529507017529	active site
529507017530	phosphorylation site [posttranslational modification]
529507017531	intermolecular recognition site; other site
529507017532	dimerization interface [polypeptide binding]; other site
529507017533	C-terminal DNA-binding domain of LuxR-like proteins. This domain contains a helix-turn-helix motif and binds DNA. Proteins belonging to this group are response regulators; some act as transcriptional activators, others as transcriptional repressors. Many...; Region: LuxR_C_like; cd06170
529507017534	DNA binding residues [nucleotide binding]
529507017535	dimerization interface [polypeptide binding]; other site
529507017536	HMMPfam hit to PF00196, Bacterial regulatory proteins, luxR fami, score 3.5e-24
529507017537	HMMPfam hit to PF00072, Response regulator receiver domain, score 1.1e-39
529507017538	nitrate/nitrite sensor protein NarX; Provisional; Region: PRK10600
529507017539	Type IV pili methyl-accepting chemotaxis transducer N-term; Region: PilJ; pfam13675
529507017540	Histidine kinase, Adenylyl cyclase, Methyl-accepting protein, and Phosphatase (HAMP) domain. HAMP is a signaling domain which occurs in a wide variety of signaling proteins, many of which are bacterial. The HAMP domain consists of two alpha helices...; Region: HAMP; cd06225
529507017541	dimerization interface [polypeptide binding]; other site
529507017542	Histidine kinase; Region: HisKA_3; pfam07730
529507017543	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
529507017544	ATP binding site [chemical binding]; other site
529507017545	Mg2+ binding site [ion binding]; other site
529507017546	G-X-G motif; other site
529507017547	HMMPfam hit to PF02518, Histidine kinase-, DNA gyrase B-, and HSP90, score 4.6e-17
529507017548	HMMPfam hit to PF07730, Histidine kinase, score 2.3e-18
529507017549	HMMPfam hit to PF00672, HAMP domain, score 3.4e-13
529507017550	2 probable transmembrane helices predicted for PMI3569 by TMHMM2.0 at aa 20-42 and 154-176
529507017551	Signal peptide predicted for PMI3569 by SignalP 2.0 HMM (Signal peptide probability 0.992) with cleavage site probability 0.498 between residues 49 and 50
529507017552	nitrate/nitrite transport protein NarU; Provisional; Region: PRK15034
529507017553	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cl17904
529507017554	putative substrate translocation pore; other site
529507017555	12 probable transmembrane helices predicted for PMI3570 by TMHMM2.0 at aa 38-60, 75-97, 104-123, 133-155, 176-198, 213-235, 256-278, 288-307, 320-339, 354-376, 404-421 and 436-458
529507017556	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 5e-17
529507017557	Nitrate reductase alpha subunit [Energy production and conversion]; Region: NarG; COG5013
529507017558	Respiratory nitrate reductase A (NarGHI), alpha chain (NarG) and related proteins. Under anaerobic conditions in the presence of nitrate, E. coli synthesizes the cytoplasmic membrane-bound quinol-nitrate oxidoreductase (NarGHI), which reduces nitrate to...; Region: MopB_Nitrate-R-NarG-like; cd02750
529507017559	[4Fe-4S] binding site [ion binding]; other site
529507017560	Molybdopterin-Binding (MopB) domain of the MopB superfamily of proteins, a  large, diverse, heterogeneous superfamily of enzymes that, in general, bind molybdopterin as a cofactor. The MopB domain is found in a wide variety of molybdenum- and...; Region: Molybdopterin-Binding; cl09928
529507017561	Molybdopterin-Binding (MopB) domain of the MopB superfamily of proteins, a  large, diverse, heterogeneous superfamily of enzymes that, in general, bind molybdopterin as a cofactor. The MopB domain is found in a wide variety of molybdenum- and...; Region: Molybdopterin-Binding; cl09928
529507017562	Molybdopterin-Binding (MopB) domain of the MopB superfamily of proteins, a  large, diverse, heterogeneous superfamily of enzymes that, in general, bind molybdopterin as a cofactor. The MopB domain is found in a wide variety of molybdenum- and...; Region: Molybdopterin-Binding; cl09928
529507017563	Respiratory nitrate reductase A (NarGHI), alpha chain (NarG) and related proteins. Under anaerobic conditions in the presence of nitrate, E. coli synthesizes the cytoplasmic membrane-bound quinol-nitrate oxidoreductase (NarGHI), which reduces nitrate to...; Region: MopB_CT_Nitrate-R-NarG-like; cd02776
529507017564	molybdopterin cofactor binding site; other site
529507017565	PS00551 Prokaryotic molybdopterin oxidoreductases signature 1.
529507017566	HMMPfam hit to PF00384, Molybdopterin oxidoreductase, score 2.6e-146
529507017567	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507017568	PS00490 Prokaryotic molybdopterin oxidoreductases signature 2.
529507017569	PS00037 Myb DNA-binding domain repeat signature 1.
529507017570	HMMPfam hit to PF01568, Molydopterin dinucleotide binding dom, score 2.8e-39
529507017571	Nitrate reductase beta subunit [Energy production and conversion]; Region: NarY; COG1140
529507017572	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 0.01
529507017573	PS00190 Cytochrome c family heme-binding site signature.
529507017574	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 0.011
529507017575	PS00343 Gram-positive cocci surface proteins 'anchoring' hexapeptide.
529507017576	PS00017 ATP/GTP-binding site motif A (P-loop).
529507017577	Nitrate reductase delta subunit; Region: Nitrate_red_del; cl00958
529507017578	HMMPfam hit to PF02613, Nitrate reductase delta subunit, score 3.1e-67
529507017579	respiratory nitrate reductase, gamma subunit; Region: narI; TIGR00351
529507017580	HMMPfam hit to PF02665, Nitrate reductase gamma subunit, score 3.5e-107
529507017581	5 probable transmembrane helices predicted for PMI3574 by TMHMM2.0 at aa 4-26, 50-72, 87-109, 122-144 and 187-209
529507017582	PS00163 Fumarate lyases signature.
529507017583	PS00225 Crystallins beta and gamma 'Greek key' motif signature.
529507017584	L-Lactate oxidase (LOX) FMN-binding domain. LOX is a member of the family of FMN-containing alpha-hydroxyacid oxidases and catalyzes the oxidation of l-lactate using molecular oxygen to generate pyruvate and H2O2.  This family occurs in both prokaryotes...; Region: LOX_like_FMN; cd04737
529507017585	teramer interface [polypeptide binding]; other site
529507017586	FMN-dependent dehydrogenase; Region: FMN_dh; pfam01070
529507017587	active site
529507017588	FMN binding site [chemical binding]; other site
529507017589	catalytic residues [active]
529507017590	Signal peptide predicted for PMI3575 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.964 between residues 22 and 23
529507017591	HMMPfam hit to PF01070, FMN-dependent dehydrogenase, score 5.8e-128
529507017592	PS00557 FMN-dependent alpha-hydroxy acid dehydrogenases active site.
529507017593	phosphoethanolamine transferase; Provisional; Region: PRK11560
529507017594	Domain of unknown function (DUF1705); Region: DUF1705; pfam08019
529507017595	Sulfatase; Region: Sulfatase; pfam00884
529507017596	HMMPfam hit to PF00884, Sulfatase, score 1.7e-71
529507017597	5 probable transmembrane helices predicted for PMI3576 by TMHMM2.0 at aa 13-35, 48-70, 83-105, 120-142 and 158-177
529507017598	Formate dehydrogenase H (Formate-Dh-H) catalyzes the reversible oxidation of formate to CO2 with the release of a proton and two electrons. It is a component of the anaerobic formate hydrogen lyase complex. The E. coli formate dehydrogenase H (Fdh-H) is...; Region: MopB_Formate-Dh-H; cd02753
529507017599	formate dehydrogenase, alpha subunit, archaeal-type; Region: Fdh-alpha; TIGR01591
529507017600	[4Fe-4S] binding site [ion binding]; other site
529507017601	molybdopterin cofactor binding site; other site
529507017602	Formate dehydrogenase H (Formate-Dh-H) catalyzes the reversible oxidation of formate to CO2 with the release of a proton and two electrons. It is a component of the anaerobic formate hydrogen lyase complex. The E. coli formate dehydrogenase H (Fdh-H) is...; Region: MopB_CT_Formate-Dh_H; cd02790
529507017603	molybdopterin cofactor binding site; other site
529507017604	HMMPfam hit to PF04879, Molybdopterin oxidoreductase Fe4S4 dom, score 2.6e-18
529507017605	PS00551 Prokaryotic molybdopterin oxidoreductases signature 1.
529507017606	HMMPfam hit to PF00384, Molybdopterin oxidoreductase, score 4.9e-81
529507017607	HMMPfam hit to PF01568, Molydopterin dinucleotide binding dom, score 5e-32
529507017608	PS00932 Prokaryotic molybdopterin oxidoreductases signature 3.
529507017609	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507017610	Biofilm formation and stress response factor; Region: BsmA; cl01794
529507017611	Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms]; Region: FhlA; COG3604
529507017612	Domain present in phytochromes and cGMP-specific phosphodiesterases; Region: GAF; smart00065
529507017613	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
529507017614	Walker A motif; other site
529507017615	ATP binding site [chemical binding]; other site
529507017616	Walker B motif; other site
529507017617	arginine finger; other site
529507017618	HMMPfam hit to PF02954, Bacterial regulatory protein, Fis fam, score 2e-09
529507017619	PS00688 Sigma-54 interaction domain C-terminal part signature.
529507017620	HMMPfam hit to PF00158, Sigma-54 interaction domain, score 1.3e-148
529507017621	PS00133 Zinc carboxypeptidases, zinc-binding region 2 signature.
529507017622	PS00675 Sigma-54 interaction domain ATP-binding region A signature.
529507017623	HMMPfam hit to PF01590, GAF domain, score 2.4e-12
529507017624	formate dehydrogenase-H ferredoxin subunit; Provisional; Region: PRK10330
529507017625	4Fe-4S binding domain; Region: Fer4; cl02805
529507017626	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 0.015
529507017627	PS00190 Cytochrome c family heme-binding site signature.
529507017628	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 1.6e-08
529507017629	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
529507017630	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 0.013
529507017631	PS00190 Cytochrome c family heme-binding site signature.
529507017632	Hydrogenase expression/synthesis hypA family; Region: HypA; cl17671
529507017633	hydrogenase nickel incorporation protein; Validated; Region: hypA; PRK03681
529507017634	HMMPfam hit to PF01155, Hydrogenase expression/synthesis hypA family, score 2.6e-63
529507017635	PS01249 Hydrogenases expression/synthesis hypA family signature.
529507017636	hydrogenase 2 accessory protein HypG; Provisional; Region: PRK10413
529507017637	HMMPfam hit to PF01455, HupF/HypC family, score 9.3e-45
529507017638	PS01097 Hydrogenases expression/synthesis hupF/hypC family signature.
529507017639	multidrug efflux system protein; Provisional; Region: PRK11431
529507017640	HMMPfam hit to PF00893, Small Multidrug Resistance protein, score 5.4e-48
529507017641	4 probable transmembrane helices predicted for PMI3584 by TMHMM2.0 at aa 4-26, 33-50, 55-77 and 84-103
529507017642	Quinol:fumarate reductase (QFR) Type D subfamily, 13kD hydrophobic subunit D; QFR couples the reduction of fumarate to succinate to the oxidation of quinol to quinone, the opposite reaction to that catalyzed by the related protein, succinate:quinine...; Region: QFR_TypeD_subunitD; cd00547
529507017643	Iron-sulfur protein interface; other site
529507017644	proximal quinone binding site [chemical binding]; other site
529507017645	C-subunit interface; other site
529507017646	distal quinone binding site; other site
529507017647	HMMPfam hit to PF02313, Fumarate reductase subunit D, score 7.8e-86
529507017648	3 probable transmembrane helices predicted for PMI3585 by TMHMM2.0 at aa 13-46, 61-83 and 96-118
529507017649	Quinol:fumarate reductase (QFR) Type D subfamily, 15kD hydrophobic subunit C;  QFR couples the reduction of fumarate to succinate to the oxidation of quinol to quinone, the opposite reaction to that catalyzed by the related protein, succinate:quinine...; Region: QFR_TypeD_subunitC; cd00546
529507017650	D-subunit interface [polypeptide binding]; other site
529507017651	Iron-sulfur protein interface; other site
529507017652	proximal quinone binding site [chemical binding]; other site
529507017653	HMMPfam hit to PF02300, Fumarate reductase subunit C, score 8.5e-102
529507017654	3 probable transmembrane helices predicted for PMI3586 by TMHMM2.0 at aa 33-50, 65-87 and 108-130
529507017655	fumarate reductase iron-sulfur subunit; Provisional; Region: PRK12385
529507017656	2Fe-2S iron-sulfur cluster binding domain; Region: Fer2_3; pfam13085
529507017657	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 0.00077
529507017658	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
529507017659	HMMPfam hit to PF00111, 2Fe-2S iron-sulfur cluster binding domain, score 0.0052
529507017660	PS00197 2Fe-2S ferredoxins, iron-sulfur binding region signature.
529507017661	fumarate reductase flavoprotein subunit; Validated; Region: PRK09231
529507017662	L-aspartate oxidase; Provisional; Region: PRK06175
529507017663	Fumarate reductase flavoprotein C-term; Region: Succ_DH_flav_C; pfam02910
529507017664	HMMPfam hit to PF02910, Fumarate reductase/succinate dehydroge, score 7.8e-65
529507017665	HMMPfam hit to PF00890, FAD binding domain, score 2.2e-201
529507017666	PS00037 Myb DNA-binding domain repeat signature 1.
529507017667	PS00504 Fumarate reductase / succinate dehydrogenase FAD-binding site.
529507017668	Signal peptide predicted for PMI3588 by SignalP 2.0 HMM (Signal peptide probability 0.905) with cleavage site probability 0.479 between residues 25 and 26
529507017669	poxB regulator PoxA; Provisional; Region: PRK09350
529507017670	Class II tRNA amino-acyl synthetase-like catalytic core domain. Class II amino acyl-tRNA synthetases (aaRS) share a common fold and generally attach an amino acid to the 3' OH of ribose of the appropriate tRNA.   PheRS is an exception in that it...; Region: class_II_aaRS-like_core; cl00268
529507017671	motif 1; other site
529507017672	dimer interface [polypeptide binding]; other site
529507017673	active site
529507017674	motif 2; other site
529507017675	motif 3; other site
529507017676	HMMPfam hit to PF00152, tRNA synthetases class II (D, K and N), score 8.3e-126
529507017677	PS00179 Aminoacyl-transfer RNA synthetases class-II signature 1.
529507017678	PS00339 Aminoacyl-transfer RNA synthetases class-II signature 2.
529507017679	glycerophosphodiester phosphodiesterase; Provisional; Region: glpQ; PRK11143
529507017680	Glycerophosphodiester phosphodiesterase domain of Escherichia coli (GlpQ) and similar proteins; Region: GDPD_EcGlpQ_like; cd08600
529507017681	active site
529507017682	catalytic site [active]
529507017683	metal binding site [ion binding]; metal-binding site
529507017684	HMMPfam hit to PF03009, Glycerophosphoryl diester phosphodiesterase, score 2.3e-98
529507017685	Signal peptide predicted for PMI3590 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.974 between residues 26 and 27
529507017686	sn-glycerol-3-phosphate transporter; Provisional; Region: glpT; PRK11273
529507017687	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507017688	putative substrate translocation pore; other site
529507017689	12 probable transmembrane helices predicted for PMI3591 by TMHMM2.0 at aa 26-45, 65-87, 94-116, 120-142, 161-183, 188-207, 254-273, 293-312, 319-341, 351-373, 385-407 and 417-436
529507017690	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 2.6e-49
529507017691	PS00942 glpT family of transporters signature.
529507017692	sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional; Region: glpA; PRK11101
529507017693	hydroxyglutarate oxidase; Provisional; Region: PRK11728
529507017694	BFD-like [2Fe-2S] binding domain; Region: Fer2_BFD; pfam04324
529507017695	HMMPfam hit to PF01266, FAD dependent oxidoreductase, score 4.4e-67
529507017696	PS00977 FAD-dependent glycerol-3-phosphate dehydrogenase signature 1.
529507017697	PS00978 FAD-dependent glycerol-3-phosphate dehydrogenase signature 2.
529507017698	HMMPfam hit to PF04324, BFD-like [2Fe-2S] binding domain, score 4.8e-16
529507017699	anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated; Region: PRK05329
529507017700	Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism]; Region: GlpB; cl17730
529507017701	Signal peptide predicted for PMI3593 by SignalP 2.0 HMM (Signal peptide probability 0.938) with cleavage site probability 0.915 between residues 22 and 23
529507017702	HMMPfam hit to PF06982, Anaerobic glycerol-3-phosphate dehydrogenase, score 1.8e-186
529507017703	PS00501 Signal peptidases I serine active site.
529507017704	glycerol-3-phosphate dehydrogenase, anaerobic, C subunit; Region: glycerol3P_GlpC; TIGR03379
529507017705	The HCP family of iron-sulfur proteins includes hybrid cluster protein (HCP), acetyl-CoA synthase (ACS), and carbon monoxide dehydrogenase (CODH), all of which contain [Fe4-S4] metal clusters at their active sites. These proteins have a conserved...; Region: HCP_like; cl14655
529507017706	Cysteine-rich domain; Region: CCG; pfam02754
529507017707	Cysteine-rich domain; Region: CCG; pfam02754
529507017708	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
529507017709	HMMPfam hit to PF00037, 4Fe-4S binding domain, score 0.0025
529507017710	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
529507017711	HMMPfam hit to PF02754, Cysteine-rich domain, score 2.8e-05
529507017712	HMMPfam hit to PF02754, Cysteine-rich domain, score 5.7e-14
529507017713	Glycerol dehydrogenase and related enzymes [Energy production and conversion]; Region: GldA; COG0371
529507017714	Glycerol dehydrogenases (GlyDH) catalyzes oxidation of glycerol to dihydroxyacetone in glycerol dissmilation; Region: GlyDH; cd08170
529507017715	dimer interface [polypeptide binding]; other site
529507017716	active site
529507017717	metal binding site [ion binding]; metal-binding site
529507017718	HMMPfam hit to PF00465, Iron-containing alcohol dehydrogenase, score 1.9e-82
529507017719	PS00913 Iron-containing alcohol dehydrogenases signature 1.
529507017720	hypothetical protein; Provisional; Region: PRK11212
529507017721	6 probable transmembrane helices predicted for PMI3596 by TMHMM2.0 at aa 13-35, 45-64, 71-93, 108-130, 142-164 and 184-206
529507017722	HMMPfam hit to PF02592, Uncharacterized ACR, YhhQ family COG1738, score 7.1e-66
529507017723	Signal peptide predicted for PMI3596 by SignalP 2.0 HMM (Signal peptide probability 0.968) with cleavage site probability 0.667 between residues 55 and 56
529507017724	SirA (also known as UvrY,  and YhhP) belongs to a family of two-component response regulators that controls secondary metabolism and virulence. The other member of this two-component system is a sensor kinase called BarA which phosphorylates SirA.  A...; Region: SirA; cd03423
529507017725	CPxP  motif; other site
529507017726	HMMPfam hit to PF01206, SirA-like protein, score 1.2e-37
529507017727	PS01148 Uncharacterized protein family UPF0033 signature.
529507017728	multidrug efflux system transporter AcrA; Provisional; Region: PRK15030
529507017729	Biotin-lipoyl like; Region: Biotin_lipoyl_2; pfam13533
529507017730	HlyD family secretion protein; Region: HlyD_3; pfam13437
529507017731	Signal peptide predicted for PMI3598 by SignalP 2.0 HMM (Signal peptide probability 0.970) with cleavage site probability 0.559 between residues 29 and 30
529507017732	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507017733	HMMPfam hit to PF00529, HlyD family secretion protein, score 7.3e-53
529507017734	The (Largely Gram-negative Bacterial) Hydrophobe/Amphiphile Efflux-1 (HAE1) Family; Region: 2A0602; TIGR00915
529507017735	Protein export membrane protein; Region: SecD_SecF; cl14618
529507017736	Solute carrier families 5 and 6-like; solute binding domain; Region: SLC5-6-like_sbd; cl00456
529507017737	HMMPfam hit to PF00873, AcrB/AcrD/AcrF family, score 0
529507017738	Signal peptide predicted for PMI3599 by SignalP 2.0 HMM (Signal peptide probability 0.692) with cleavage site probability 0.216 between residues 29 and 30
529507017739	12 probable transmembrane helices predicted for PMI3599 by TMHMM2.0 at aa 9-28, 340-359, 366-388, 392-414, 438-460, 475-497, 537-554, 870-889, 896-918, 923-945, 972-994 and 1004-1026
529507017740	zinc/cadmium/mercury/lead-transporting ATPase; Provisional; Region: zntA; PRK11033
529507017741	Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones. HMA domain...; Region: HMA; cd00371
529507017742	metal-binding site [ion binding]
529507017743	E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122
529507017744	Soluble P-type ATPase [General function prediction only]; Region: COG4087
529507017745	PS00141 Eukaryotic and viral aspartyl proteases active site.
529507017746	7 probable transmembrane helices predicted for PMI3600 by TMHMM2.0 at aa 166-183, 187-204, 216-235, 239-258, 386-408, 423-445 and 730-752
529507017747	HMMPfam hit to PF00702, haloacid dehalogenase-like hydrolase, score 7.2e-28
529507017748	PS01229 Hypothetical cof family signature 2.
529507017749	PS00154 E1-E2 ATPases phosphorylation site.
529507017750	HMMPfam hit to PF00122, E1-E2 ATPase, score 1.3e-92
529507017751	HMMPfam hit to PF00403, Heavy-metal-associated domain, score 4e-10
529507017752	PS01047 Heavy-metal-associated domain.
529507017753	Predicted membrane protein [Function unknown]; Region: COG3714
529507017754	7 probable transmembrane helices predicted for PMI3601 by TMHMM2.0 at aa 28-45, 49-68, 75-97, 102-121, 128-147, 157-176 and 189-207
529507017755	HMMPfam hit to PF07947, YhhN-like protein, score 1e-30
529507017756	Protein of unknown function (DUF2500); Region: DUF2500; pfam10694
529507017757	Signal peptide predicted for PMI3602 by SignalP 2.0 HMM (Signal peptide probability 0.699) with cleavage site probability 0.309 between residues 22 and 23
529507017758	hypothetical protein; Provisional; Region: PRK10910
529507017759	HMMPfam hit to PF06611, Protein of unknown function (DUF1145), score 7.6e-26
529507017760	3 probable transmembrane helices predicted for PMI3603 by TMHMM2.0 at aa 4-26, 31-48 and 63-80
529507017761	N6-adenine-specific methylase [DNA replication, recombination, and repair]; Region: COG0742
529507017762	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
529507017763	S-adenosylmethionine binding site [chemical binding]; other site
529507017764	HMMPfam hit to PF03602, Conserved hypothetical protein, score 3.1e-85
529507017765	PS00092 N-6 Adenine-specific DNA methylases signature.
529507017766	signal recognition particle-docking protein FtsY; Provisional; Region: PRK10416
529507017767	SRP54-type protein, helical bundle domain; Region: SRP54_N; pfam02881
529507017768	The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes. SRP recognizes N-terminal sighnal sequences of newly synthesized polypeptides at the ribosome. The...; Region: SRP; cd03115
529507017769	P loop; other site
529507017770	GTP binding site [chemical binding]; other site
529507017771	HMMPfam hit to PF02881, SRP54-type protein, helical bundle domain, score 3.3e-20
529507017772	HMMPfam hit to PF00448, SRP54-type protein, GTPase domain, score 7.1e-128
529507017773	PS00017 ATP/GTP-binding site motif A (P-loop).
529507017774	PS00300 SRP54-type proteins GTP-binding domain signature.
529507017775	cell division protein FtsE; Provisional; Region: PRK10908
529507017776	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
529507017777	Walker A/P-loop; other site
529507017778	ATP binding site [chemical binding]; other site
529507017779	Q-loop/lid; other site
529507017780	ABC transporter signature motif; other site
529507017781	Walker B; other site
529507017782	D-loop; other site
529507017783	H-loop/switch region; other site
529507017784	HMMPfam hit to PF00005, ABC transporter, score 6e-70
529507017785	PS00017 ATP/GTP-binding site motif A (P-loop).
529507017786	PS00211 ABC transporters family signature.
529507017787	cell division ABC transporter subunit FtsX; Provisional; Region: ftsX; PRK11026
529507017788	putative protein insertion permease FtsX; Region: ftsX; TIGR00439
529507017789	4 probable transmembrane helices predicted for PMI3607 by TMHMM2.0 at aa 45-67, 193-215, 245-267 and 291-313
529507017790	HMMPfam hit to PF02687, Predicted permease, score 1.9e-16
529507017791	RNA polymerase factor sigma-32; Reviewed; Region: PRK06596
529507017792	Sigma-70 factor, region 1.2; Region: Sigma70_r1_2; pfam00140
529507017793	Sigma-70 region 2; Region: Sigma70_r2; pfam04542
529507017794	Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs). A SF is a dissociable subunit of RNA polymerase, it directs bacterial or...; Region: Sigma70_r4; cd06171
529507017795	DNA binding residues [nucleotide binding]
529507017796	HMMPfam hit to PF04542, Sigma-70 region, score 7.4e-22
529507017797	PS00715 Sigma-70 factors family signature 1.
529507017798	HMMPfam hit to PF04545, Sigma-70, region, score 2e-17
529507017799	PS00716 Sigma-70 factors family signature 2.
529507017800	Glycerate kinase [Carbohydrate transport and metabolism]; Region: COG1929
529507017801	HMMPfam hit to PF02595, Glycerate kinase family, score 1e-196
529507017802	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cd04301
529507017803	Coenzyme A binding pocket [chemical binding]; other site
529507017804	HMMPfam hit to PF00583, Acetyltransferase (GNAT) family, score 0.00079
529507017805	drug resistance transporter, Bcr/CflA subfamily; Region: efflux_Bcr_CflA; TIGR00710
529507017806	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507017807	putative substrate translocation pore; other site
529507017808	HMMPfam hit to PF00083, Sugar (and other) transporter, score 3.1e-05
529507017809	12 probable transmembrane helices predicted for PMI3611 by TMHMM2.0 at aa 7-29, 44-66, 73-95, 99-121, 133-155, 160-182, 212-234, 244-261, 273-295, 300-322, 335-357 and 362-384
529507017810	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 6.7e-59
529507017811	Signal peptide predicted for PMI3611 by SignalP 2.0 HMM (Signal peptide probability 0.997) with cleavage site probability 0.918 between residues 22 and 23
529507017812	helix_turn_helix multiple antibiotic resistance protein; Region: HTH_MARR; smart00347
529507017813	MarR family; Region: MarR_2; cl17246
529507017814	HMMPfam hit to PF01047, MarR family, score 2.2e-14
529507017815	Zn-dependent protease with chaperone function [Posttranslational modification, protein turnover, chaperones]; Region: HtpX; COG0501
529507017816	HMMPfam hit to PF01435, Peptidase family M48, score 3.9e-25
529507017817	PS00012 Phosphopantetheine attachment site.
529507017818	glycerol-3-phosphate transporter ATP-binding subunit; Provisional; Region: ugpC; PRK11650
529507017819	The N-terminal ATPase domain of the maltose transporter, MalK; Region: ABC_MalK_N; cd03301
529507017820	Walker A/P-loop; other site
529507017821	ATP binding site [chemical binding]; other site
529507017822	Q-loop/lid; other site
529507017823	ABC transporter signature motif; other site
529507017824	Walker B; other site
529507017825	D-loop; other site
529507017826	H-loop/switch region; other site
529507017827	TOBE domain; Region: TOBE_2; pfam08402
529507017828	HMMPfam hit to PF00005, ABC transporter, score 8.1e-70
529507017829	PS00211 ABC transporters family signature.
529507017830	PS00017 ATP/GTP-binding site motif A (P-loop).
529507017831	ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism]; Region: UgpE; COG0395
529507017832	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
529507017833	dimer interface [polypeptide binding]; other site
529507017834	conserved gate region; other site
529507017835	putative PBP binding loops; other site
529507017836	ABC-ATPase subunit interface; other site
529507017837	HMMPfam hit to PF00528, Binding-protein-dependent transport syst, score 9.5e-19
529507017838	6 probable transmembrane helices predicted for PMI3615 by TMHMM2.0 at aa 7-29, 83-105, 112-131, 146-168, 189-211 and 251-268
529507017839	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
529507017840	ABC-type polysaccharide transport system, permease component [Carbohydrate transport and metabolism]; Region: LplB; COG4209
529507017841	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
529507017842	dimer interface [polypeptide binding]; other site
529507017843	conserved gate region; other site
529507017844	putative PBP binding loops; other site
529507017845	ABC-ATPase subunit interface; other site
529507017846	HMMPfam hit to PF00528, Binding-protein-dependent transport syst, score 2.4e-13
529507017847	6 probable transmembrane helices predicted for PMI3616 by TMHMM2.0 at aa 12-34, 72-94, 106-128, 157-179, 206-228 and 266-288
529507017848	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
529507017849	ABC-type sugar transport system, periplasmic component [Carbohydrate transport and metabolism]; Region: UgpB; COG1653
529507017850	Bacterial extracellular solute-binding protein; Region: SBP_bac_1; cl17199
529507017851	HMMPfam hit to PF01547, Bacterial extracellular solute-binding prot, score 4.8e-20
529507017852	Signal peptide predicted for PMI3617 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.998 between residues 22 and 23
529507017853	cytoplasmic glycerophosphodiester phosphodiesterase; Provisional; Region: ugpQ; PRK09454
529507017854	Glycerophosphodiester phosphodiesterase domain in Escherichia coli cytosolic glycerophosphodiester phosphodiesterase UgpQ and similar proteins; Region: GDPD_EcUgpQ_like; cd08562
529507017855	putative active site [active]
529507017856	catalytic site [active]
529507017857	putative metal binding site [ion binding]; other site
529507017858	HMMPfam hit to PF03009, Glycerophosphoryl diester phosphodiesterase, score 3.8e-52
529507017859	putative cyanate transporter; Provisional; Region: cynX; PRK09705
529507017860	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
529507017861	putative substrate translocation pore; other site
529507017862	12 probable transmembrane helices predicted for PMI3619 by TMHMM2.0 at aa 12-34, 49-71, 78-97, 102-124, 137-159, 164-186, 206-228, 243-265, 272-293, 297-319, 331-353 and 363-382
529507017863	HMMPfam hit to PF07690, Major Facilitator Superfamily, score 2.4e-23
529507017864	10 probable transmembrane helices predicted for PMI3620 by TMHMM2.0 at aa 12-29, 39-59, 72-94, 109-128, 135-153, 157-176, 189-206, 226-248, 261-283 and 293-315
529507017865	Protein of unknown function (DUF1240); Region: DUF1240; pfam06836
529507017866	Signal peptide predicted for PMI3621 by SignalP 2.0 HMM (Signal peptide probability 0.727) with cleavage site probability 0.520 between residues 31 and 32
529507017867	1 probable transmembrane helix predicted for PMI3621 by TMHMM2.0 at aa 15-37
529507017868	Factor for inversion stimulation Fis, transcriptional activator [Transcription / DNA replication, recombination, and repair]; Region: Fis; COG2901
529507017869	global DNA-binding transcriptional dual regulator Fis; Provisional; Region: fis; PRK00430
529507017870	HMMPfam hit to PF02954, Bacterial regulatory protein, Fis family, score 4.1e-16
529507017871	tRNA-dihydrouridine synthase B; Provisional; Region: PRK10415
529507017872	Dihydrouridine synthase-like (DUS-like) FMN-binding domain. Members of this family catalyze the reduction of the 5,6-double bond of a uridine residue on tRNA. Dihydrouridine modification of tRNA is widely observed in prokaryotes and eukaryotes, and also...; Region: DUS_like_FMN; cd02801
529507017873	FMN binding site [chemical binding]; other site
529507017874	active site
529507017875	catalytic residues [active]
529507017876	substrate binding site [chemical binding]; other site
529507017877	HMMPfam hit to PF01207, Dihydrouridine synthase (Dus), score 1.6e-155
529507017878	PS01136 Uncharacterized protein family UPF0034 signature.
529507017879	Ribosomal protein L11 methyltransferase (PrmA); Region: PrmA; pfam06325
529507017880	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cl17173
529507017881	HMMPfam hit to PF06325, Ribosomal protein L11 methyltransferase (Prm, score 3.1e-166
529507017882	PS00017 ATP/GTP-binding site motif A (P-loop).
529507017883	Na(+)/pantothenate cotransporters: PanF of Escherichia coli and related proteins; solute binding domain; Region: SLC5sbd_PanF; cd10327
529507017884	Na binding site [ion binding]; other site
529507017885	13 probable transmembrane helices predicted for PMI3625 by TMHMM2.0 at aa 5-24, 37-59, 72-94, 123-145, 160-182, 187-209, 229-251, 272-294, 319-341, 369-386, 391-413, 420-442 and 446-465
529507017886	HMMPfam hit to PF00474, Sodium:solute symporter family, score 1.1e-178
529507017887	PS00456 Sodium:solute symporter family signature 1.
529507017888	hypothetical protein; Provisional; Region: PRK10633
529507017889	HMMPfam hit to PF06196, Protein of unknown function (DUF997), score 2.5e-34
529507017890	2 probable transmembrane helices predicted for PMI3626 by TMHMM2.0 at aa 13-32 and 42-64
529507017891	acetyl-CoA carboxylase biotin carboxylase subunit; Validated; Region: PRK08591
529507017892	Carbamoyl-phosphate synthase L chain, N-terminal domain; Region: CPSase_L_chain; pfam00289
529507017893	Carbamoyl-phosphate synthase L chain, ATP binding domain; Region: CPSase_L_D2; pfam02786
529507017894	Biotin carboxylase C-terminal domain; Region: Biotin_carb_C; smart00878
529507017895	HMMPfam hit to PF02785, Biotin carboxylase C-terminal domain, score 2.3e-68
529507017896	HMMPfam hit to PF02786, Carbamoyl-phosphate synthase L chain,, score 1.1e-123
529507017897	PS00867 Carbamoyl-phosphate synthase subdomain signature 2.
529507017898	PS00866 Carbamoyl-phosphate synthase subdomain signature 1.
529507017899	HMMPfam hit to PF00289, Carbamoyl-phosphate synthase L chain,, score 2.4e-58
529507017900	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated; Region: PRK06302
529507017901	The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase; Region: biotinyl_domain; cd06850
529507017902	carboxyltransferase (CT) interaction site; other site
529507017903	biotinylation site [posttranslational modification]; other site
529507017904	HMMPfam hit to PF00364, Biotin-requiring enzyme, score 8.6e-39
529507017905	PS00188 Biotin-requiring enzymes attachment site.
529507017906	Dehydroquinase (DHQase), type II. Dehydroquinase (or 3-dehydroquinate dehydratase) catalyzes the reversible dehydration of 3-dehydroquinate to form 3-dehydroshikimate. This reaction is part of two metabolic pathways: the biosynthetic shikimate pathway...; Region: DHQase_II; cd00466
529507017907	Dehydroquinase class II; Region: DHquinase_II; pfam01220
529507017908	active site
529507017909	trimer interface [polypeptide binding]; other site
529507017910	dimer interface [polypeptide binding]; other site
529507017911	HMMPfam hit to PF01220, Dehydroquinase class II, score 3.8e-88
529507017912	PS01029 Dehydroquinase class II signature.
529507017913	Yhdh putative quinone oxidoreductases; Region: MDR_yhdh; cd08288
529507017914	putative quinone oxidoreductase, YhdH/YhfP family; Region: oxido_YhdH; TIGR02823
529507017915	NADP binding site [chemical binding]; other site
529507017916	dimer interface [polypeptide binding]; other site
529507017917	HMMPfam hit to PF00107, Zinc-binding dehydrogenase, score 1e-32
529507017918	rod shape-determining protein MreB; Provisional; Region: PRK13927
529507017919	MreB and similar proteins; Region: MreB_like; cd10225
529507017920	nucleotide binding site [chemical binding]; other site
529507017921	Mg binding site [ion binding]; other site
529507017922	putative protofilament interaction site [polypeptide binding]; other site
529507017923	RodZ interaction site [polypeptide binding]; other site
529507017924	HMMPfam hit to PF06723, MreB/Mbl protein, score 2.2e-235
529507017925	rod shape-determining protein MreC; Region: mreC; TIGR00219
529507017926	rod shape-determining protein MreC; Region: MreC; pfam04085
529507017927	1 probable transmembrane helix predicted for PMI3632 by TMHMM2.0 at aa 13-35
529507017928	HMMPfam hit to PF04085, rod shape-determining protein MreC, score 1.2e-65
529507017929	rod shape-determining protein MreD; Provisional; Region: PRK11060
529507017930	HMMPfam hit to PF04093, rod shape-determining protein MreD, score 6.2e-38
529507017931	4 probable transmembrane helices predicted for PMI3633 by TMHMM2.0 at aa 12-29, 70-92, 99-121 and 136-153
529507017932	Maf-like protein; Region: Maf; pfam02545
529507017933	Nucleotide binding protein Maf. Maf has been implicated in inhibition of septum formation in eukaryotes, bacteria and archaea, but homologs in B.subtilis and S.cerevisiae are nonessential for cell division. Maf has been predicted to be a nucleotide- or...; Region: Maf; cd00555
529507017934	active site
529507017935	dimer interface [polypeptide binding]; other site
529507017936	HMMPfam hit to PF02545, Maf-like protein, score 4.2e-73
529507017937	ribonuclease G; Provisional; Region: PRK11712
529507017938	S1_RNase_E: RNase E and RNase G, S1-like RNA-binding domain. RNase E is an essential endoribonuclease in the processing and degradation of RNA. In addition to its role in mRNA degradation, RNase E has also been implicated in the processing of rRNA, and...; Region: S1_RNase_E; cd04453
529507017939	homodimer interface [polypeptide binding]; other site
529507017940	oligonucleotide binding site [chemical binding]; other site
529507017941	Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes; Region: PLPDE_III; cl00261
529507017942	HMMPfam hit to PF00575, S1 RNA binding domain, score 1.4e-14
529507017943	hypothetical protein; Provisional; Region: PRK10899
529507017944	AsmA-like C-terminal region; Region: AsmA_2; pfam13502
529507017945	PS00430 TonB-dependent receptor proteins signature 1.
529507017946	Signal peptide predicted for PMI3636 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.604 between residues 20 and 21
529507017947	PS00225 Crystallins beta and gamma 'Greek key' motif signature.
529507017948	nitrilase; Region: PLN02798
529507017949	Nit1, Nit 2, and related proteins, and the Nit1-like domain of NitFhit (class 10 nitrilases); Region: nit; cd07572
529507017950	putative active site [active]
529507017951	catalytic triad [active]
529507017952	dimer interface [polypeptide binding]; other site
529507017953	HMMPfam hit to PF00795, Carbon-nitrogen hydrolase, score 1.4e-32
529507017954	PS01227 Uncharacterized protein family UPF0012 signature.
529507017955	protease TldD; Provisional; Region: tldD; PRK10735
529507017956	HMMPfam hit to PF01523, modulator of DNA gyrase, score 1.9e-105
529507017957	microbial_RNases. Ribonucleases (RNAses) cleave phosphodiester bonds in RNA and are essential  for both non-specific RNA degradation and for numerous forms of RNA processing. The alignment contains fungal RNases (U2, T1, F1, Th,  Pb, N1, and Ms) and...; Region: microbial_RNases; cl00212
529507017958	active site
529507017959	1 probable transmembrane helix predicted for PMI3639 by TMHMM2.0 at aa 5-24
529507017960	HMMPfam hit to PF00545, ribonuclease, score 2.4e-14
529507017961	Barstar is an intracellular inhibitor of barnase, an extracellular ribonuclease of Bacillus amyloliquefaciens. Barstar binds tightly to the barnase active site and sterically blocks it thus inhibiting its potentially lethal RNase activity inside the cell; Region: Barstar; cd05142
529507017962	RNAase interaction site [polypeptide binding]; other site
529507017963	HMMPfam hit to PF01337, Barstar (barnase inhibitor), score 1.5e-05
529507017964	hypothetical protein; Provisional; Region: PRK05255
529507017965	HMMPfam hit to PF04751, Protein of unknown function (DUF615), score 8.2e-94
529507017966	peptidase PmbA; Provisional; Region: PRK11040
529507017967	HMMPfam hit to PF01523, modulator of DNA gyrase, score 3.8e-80
529507017968	nucleoside diphosphate kinase regulator; Provisional; Region: PRK05753
529507017969	Transcription elongation factor, GreA/GreB, C-term; Region: GreA_GreB; pfam01272
529507017970	Histidine-containing phosphocarrier protein (HPr)-like proteins. HPr is a central component of the bacterial phosphoenolpyruvate sugar phosphotransferase system (PTS). The PTS catalyses the phosphorylation of sugar substrates during their translocation...; Region: PTS-HPr_like; cd00367
529507017971	dimerization domain swap beta strand [polypeptide binding]; other site
529507017972	regulatory protein interface [polypeptide binding]; other site
529507017973	active site
529507017974	regulatory phosphorylation site [posttranslational modification]; other site
529507017975	HMMPfam hit to PF00381, PTS HPr component phosphorylation site, score 3.5e-26
529507017976	PS00369 PTS HPR component histidine phosphorylation site signature.
529507017977	P-loop ATPase protein family; Region: ATP_bind_2; pfam03668
529507017978	HMMPfam hit to PF03668, P-loop ATPase protein family, score 2.3e-205
529507017979	PS00017 ATP/GTP-binding site motif A (P-loop).
529507017980	PTS_IIA, PTS system, fructose/mannitol specific IIA subunit. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. This...; Region: PTS_IIA_fru; cd00211
529507017981	active site
529507017982	phosphorylation site [posttranslational modification]
529507017983	HMMPfam hit to PF00359, Phosphoenolpyruvate-dependent sugar phosph, score 1.3e-42
529507017984	PS00372 PTS EIIA domains phosphorylation site signature 2.
529507017985	RaiA ("ribosome-associated inhibitor A", also known as Protein Y (PY), YfiA, and SpotY,  is a stress-response protein that binds the ribosomal subunit interface and arrests translation by interfering with aminoacyl-tRNA binding to the ribosomal...; Region: RaiA; cd00552
529507017986	30S subunit binding site; other site
529507017987	HMMPfam hit to PF02482, Sigma 54 modulation protein / S30EA r, score 2.6e-45
529507017988	RNA polymerase factor sigma-54; Reviewed; Region: PRK05932
529507017989	Sigma-54 factor, core binding domain; Region: Sigma54_CBD; pfam04963
529507017990	Sigma-54, DNA binding domain; Region: Sigma54_DBD; pfam04552
529507017991	HMMPfam hit to PF04552, Sigma-54, DNA binding domain, score 7.8e-107
529507017992	PS00718 Sigma-54 factors family signature 2.
529507017993	PS00717 Sigma-54 factors family signature 1.
529507017994	HMMPfam hit to PF04963, Sigma-54 factor, core binding domain, score 1.7e-96
529507017995	HMMPfam hit to PF00309, Sigma-54 factor, Activator interacting do, score 6e-20
529507017996	PS00041 Bacterial regulatory proteins, araC family signature.
529507017997	lipopolysaccharide ABC transporter ATP-binding protein; Provisional; Region: PRK10895
529507017998	ATP-binding cassette component of YhbG transport system; Region: ABC_YhbG; cd03218
529507017999	Walker A/P-loop; other site
529507018000	ATP binding site [chemical binding]; other site
529507018001	Q-loop/lid; other site
529507018002	ABC transporter signature motif; other site
529507018003	Walker B; other site
529507018004	D-loop; other site
529507018005	H-loop/switch region; other site
529507018006	HMMPfam hit to PF00005, ABC transporter, score 2e-61
529507018007	PS00211 ABC transporters family signature.
529507018008	PS00017 ATP/GTP-binding site motif A (P-loop).
529507018009	lipopolysaccharide transport periplasmic protein LptA; Provisional; Region: PRK10894
529507018010	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG1934
529507018011	HMMPfam hit to PF03968, OstA-like protein, score 2.4e-54
529507018012	Signal peptide predicted for PMI3650 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.763 between residues 23 and 24
529507018013	lipopolysaccharide exporter periplasmic protein; Provisional; Region: PRK10893
529507018014	Lipopolysaccharide-assembly, LptC-related; Region: LptC; pfam06835
529507018015	HMMPfam hit to PF06835, Protein of unknown function (DUF1239), score 3.6e-54
529507018016	Signal peptide predicted for PMI3651 by SignalP 2.0 HMM (Signal peptide probability 0.969) with cleavage site probability 0.386 between residues 27 and 28
529507018017	HAD-superfamily hydrolase, subfamily IIIA; Region: HAD-SF-IIIA; TIGR01662
529507018018	Haloacid dehalogenase-like hydrolases. The haloacid dehalogenase-like (HAD) superfamily includes L-2-haloacid dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, and many others; Region: HAD_like; cd01427
529507018019	active site
529507018020	motif I; other site
529507018021	motif II; other site
529507018022	D-arabinose 5-phosphate isomerase; Provisional; Region: PRK10892
529507018023	KpsF-like protein. KpsF is an arabinose-5-phosphate isomerase which contains SIS (Sugar ISomerase) domains. SIS domains are found in many phosphosugar isomerases and phosphosugar binding proteins. KpsF catalyzes the reversible reaction of ribulose...; Region: SIS_Kpsf; cd05014
529507018024	putative active site [active]
529507018025	This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein.  These APIs catalyze the conversion of the pentose pathway...; Region: CBS_pair_KpsF_GutQ_assoc; cd04604
529507018026	HMMPfam hit to PF00571, CBS domain, score 2.1e-10
529507018027	HMMPfam hit to PF00571, CBS domain, score 7.8e-06
529507018028	HMMPfam hit to PF01380, SIS domain, score 6.9e-36
529507018029	putative calcium/sodium:proton antiporter; Provisional; Region: PRK10734
529507018030	Sodium/calcium exchanger protein; Region: Na_Ca_ex; pfam01699
529507018031	Sodium/calcium exchanger protein; Region: Na_Ca_ex; pfam01699
529507018032	11 probable transmembrane helices predicted for PMI3654 by TMHMM2.0 at aa 5-22, 26-45, 58-80, 95-117, 130-152, 156-173, 200-222, 232-254, 267-289, 299-318 and 331-350
529507018033	HMMPfam hit to PF01699, Sodium/calcium exchanger protein, score 6.2e-34
529507018034	HMMPfam hit to PF01699, Sodium/calcium exchanger protein, score 5e-29
529507018035	Signal peptide predicted for PMI3654 by SignalP 2.0 HMM (Signal peptide probability 0.888) with cleavage site probability 0.660 between residues 44 and 45
529507018036	putative ABC transporter ATP-binding protein YrbF; Provisional; Region: PRK11831
529507018037	ATP-binding cassette transport system involved in resistant to organic solvents; Region: ABC_Org_Solvent_Resistant; cd03261
529507018038	Walker A/P-loop; other site
529507018039	ATP binding site [chemical binding]; other site
529507018040	Q-loop/lid; other site
529507018041	ABC transporter signature motif; other site
529507018042	Walker B; other site
529507018043	D-loop; other site
529507018044	H-loop/switch region; other site
529507018045	HMMPfam hit to PF00005, ABC transporter, score 7.4e-51
529507018046	PS00017 ATP/GTP-binding site motif A (P-loop).
529507018047	PS00211 ABC transporters family signature.
529507018048	ABC-type transport system involved in resistance to organic solvents, permease component [Secondary metabolites biosynthesis, transport, and catabolism]; Region: Ttg2B; COG0767
529507018049	conserved hypothetical integral membrane protein; Region: TIGR00056
529507018050	6 probable transmembrane helices predicted for PMI3656 by TMHMM2.0 at aa 10-32, 54-76, 86-108, 149-171, 198-218 and 238-257
529507018051	HMMPfam hit to PF02405, Domain of unknown function DUF140, score 9.3e-126
529507018052	ABC-type transport system involved in resistance to organic solvents, periplasmic component [Secondary metabolites biosynthesis, transport, and catabolism]; Region: Ttg2C; COG1463
529507018053	mce related protein; Region: MCE; pfam02470
529507018054	Signal peptide predicted for PMI3657 by SignalP 2.0 HMM (Signal peptide probability 0.644) with cleavage site probability 0.228 between residues 29 and 30
529507018055	1 probable transmembrane helix predicted for PMI3657 by TMHMM2.0 at aa 7-26
529507018056	HMMPfam hit to PF02470, mce related protein, score 1.9e-32
529507018057	ABC transporter periplasmic binding protein MlaC; Provisional; Region: PRK15117
529507018058	Signal peptide predicted for PMI3658 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 1.000 between residues 19 and 20
529507018059	HMMPfam hit to PF05494, Toluene tolerance, Ttg2, score 5.3e-82
529507018060	Sulphate Transporter and Anti-Sigma factor antagonist) domain of anti-anti-sigma factors, key regulators of anti-sigma factors by phosphorylation; Region: STAS_anti-anti-sigma_factors; cd07043
529507018061	anti sigma factor interaction site; other site
529507018062	regulatory phosphorylation site [posttranslational modification]; other site
529507018063	HMMPfam hit to PF01740, STAS domain, score 0.00037
529507018064	Predicted transcriptional regulator, BolA superfamily [Transcription]; Region: COG5007
529507018065	HMMPfam hit to PF01722, BolA-like protein, score 1.6e-36
529507018066	UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Region: murA; TIGR01072
529507018067	UDP-N-acetylglucosamine enolpyruvyl transferase catalyzes enolpyruvyl transfer as part of the first step in the biosynthesis of peptidoglycan, a component of the bacterial cell wall. The reaction is phosphoenolpyruvate + UDP-N-acetyl-D-glucosamine =...; Region: UdpNAET; cd01555
529507018068	hinge; other site
529507018069	active site
529507018070	HMMPfam hit to PF00275, EPSP synthase (3-phosphoshikimate 1-car, score 1.1e-178
529507018071	PS00017 ATP/GTP-binding site motif A (P-loop).
529507018072	SIR2-like domain; Region: SIR2_2; pfam13289
529507018073	10 probable transmembrane helices predicted for PMI3664 by TMHMM2.0 at aa 51-73, 83-102, 109-131, 141-160, 167-189, 199-221, 226-248, 263-282, 289-306 and 310-329
529507018074	serine endoprotease; Provisional; Region: PRK10898
529507018075	Trypsin-like peptidase domain; Region: Trypsin_2; pfam13365
529507018076	PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis. May be responsible for substrate recognition and/or binding, as most PDZ domains bind...; Region: PDZ_serine_protease; cd00987
529507018077	protein binding site [polypeptide binding]; other site
529507018078	HMMPfam hit to PF00595, PDZ domain (Also known as DHR or GLGF), score 2.6e-08
529507018079	HMMPfam hit to PF00089, Trypsin, score 7.5e-13
529507018080	1 probable transmembrane helix predicted for PMI3665 by TMHMM2.0 at aa 9-31
529507018081	Signal peptide predicted for PMI3665 by SignalP 2.0 HMM (Signal peptide probability 0.969) with cleavage site probability 0.765 between residues 22 and 23
529507018082	serine endoprotease; Provisional; Region: PRK10139
529507018083	Trypsin-like peptidase domain; Region: Trypsin_2; pfam13365
529507018084	PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis. May be responsible for substrate recognition and/or binding, as most PDZ domains bind...; Region: PDZ_serine_protease; cd00987
529507018085	protein binding site [polypeptide binding]; other site
529507018086	PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis. May be responsible for substrate recognition and/or binding, as most PDZ domains bind...; Region: PDZ_serine_protease; cd00987
529507018087	HMMPfam hit to PF00595, PDZ domain (Also known as DHR or GLGF), score 3.8e-11
529507018088	HMMPfam hit to PF00595, PDZ domain (Also known as DHR or GLGF), score 1.6e-18
529507018089	HMMPfam hit to PF00089, Trypsin, score 1.8e-19
529507018090	Signal peptide predicted for PMI3666 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.968 between residues 30 and 31
529507018091	hypothetical protein; Provisional; Region: PRK11677
529507018092	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG3105
529507018093	HMMPfam hit to PF06295, Protein of unknown function (DUF1043), score 7.8e-80
529507018094	1 probable transmembrane helix predicted for PMI3667 by TMHMM2.0 at aa 4-21
529507018095	Predicted ATPase [General function prediction only]; Region: COG1485
529507018096	HMMPfam hit to PF03969, AFG1-like ATPase, score 3.1e-193
529507018097	PS00017 ATP/GTP-binding site motif A (P-loop).
529507018098	Ribosomal protein L13.  Protein L13, a large ribosomal subunit protein, is one of five proteins required for an early folding intermediate of 23S rRNA in the assembly of the large subunit. L13 is situated on the bottom of the large subunit, near the...; Region: Ribosomal_L13; cd00392
529507018099	23S rRNA interface [nucleotide binding]; other site
529507018100	L3 interface [polypeptide binding]; other site
529507018101	HMMPfam hit to PF00572, Ribosomal protein L13, score 1.6e-85
529507018102	PS00783 Ribosomal protein L13 signature.
529507018103	30S ribosomal protein S9; Reviewed; Region: rpsI; PRK00132
529507018104	HMMPfam hit to PF00380, Ribosomal protein S9/S16, score 1.6e-68
529507018105	PS00360 Ribosomal protein S9 signature.
529507018106	stringent starvation protein A; Provisional; Region: sspA; PRK09481
529507018107	GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E. coli. It is implicated in survival...; Region: GST_N_SspA; cd03059
529507018108	C-terminal domain interface [polypeptide binding]; other site
529507018109	putative GSH binding site (G-site) [chemical binding]; other site
529507018110	dimer interface [polypeptide binding]; other site
529507018111	C-terminal, alpha helical domain of Stringent starvation protein A; Region: GST_C_SspA; cd03186
529507018112	dimer interface [polypeptide binding]; other site
529507018113	N-terminal domain interface [polypeptide binding]; other site
529507018114	HMMPfam hit to PF02798, Glutathione S-transferase, N-terminal domain, score 8.7e-22
529507018115	HMMPfam hit to PF00043, Glutathione S-transferase, C-terminal domain, score 1.1e-13
529507018116	ClpXP protease specificity-enhancing factor; Provisional; Region: PRK11798
529507018117	HMMPfam hit to PF04386, Stringent starvation protein B, score 6.3e-73
529507018118	Helix-Turn-Helix DNA binding domain of the transcription regulators TipAL, Mta, and SkgA; Region: HTH_TipAL-Mta; cd01106
529507018119	MerR HTH family regulatory protein; Region: MerR_1; pfam13411
529507018120	DNA binding residues [nucleotide binding]
529507018121	dimer interface [polypeptide binding]; other site
529507018122	TipAS antibiotic-recognition domain; Region: TipAS; pfam07739
529507018123	TipAS antibiotic-recognition domain; Region: TipAS; pfam07739
529507018124	HMMPfam hit to PF05583, Albicidin resistance domain, score 4.4e-09
529507018125	HMMPfam hit to PF00376, MerR family regulatory protein, score 2e-11
529507018126	PS00552 Bacterial regulatory proteins, merR family signature.
529507018127	Metal-dependent amidase/aminoacylase/carboxypeptidase [General function prediction only]; Region: AbgB; COG1473
529507018128	M20 Peptidases Aminoacyclase-1 indole-3-acetic-L-aspartic acid hydrolase from bacteria and archaea; Region: M20_Acy1_IAAspH_bact; cd05665
529507018129	putative metal binding site [ion binding]; other site
529507018130	dimer interface [polypeptide binding]; other site
529507018131	HMMPfam hit to PF01546, Peptidase family M20/M25/M40, score 2.5e-30
529507018132	HMMPfam hit to PF07687, Peptidase dimerisation domain, score 0.00078
529507018133	C4-dicarboxylate transporter [Energy production and conversion]; Region: DcuC; COG3069
529507018134	11 probable transmembrane helices predicted for PMI3675 by TMHMM2.0 at aa 5-19, 26-48, 53-72, 93-115, 130-152, 173-195, 227-249, 256-278, 293-315, 328-350 and 377-399
529507018135	glutamate synthase small subunit family protein, proteobacterial; Region: gltD_gamma_fam; TIGR01318
529507018136	NAD(P)-binding Rossmann-like domain; Region: NAD_binding_8; cl17500
529507018137	Pyridine nucleotide-disulphide oxidoreductase; Region: Pyr_redox; pfam00070
529507018138	HMMPfam hit to PF00070, Pyridine nucleotide-disulphide oxidoreducta, score 1e-27
529507018139	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507018140	glutamate synthase subunit alpha; Provisional; Region: gltB; PRK11750
529507018141	Glutamine amidotransferases class-II (Gn-AT), glutamate synthase (GltS)-type. GltS is a homodimer that synthesizes L-glutamate from 2-oxoglutarate and L-glutamine, an important step in ammonia assimilation in bacteria, cyanobacteria and plants. The...; Region: GltS; cd00713
529507018142	active site
529507018143	dimer interface [polypeptide binding]; other site
529507018144	Glutamate synthase central domain; Region: Glu_syn_central; pfam04898
529507018145	Glutamate synthase (GltS) FMN-binding domain.  GltS is a complex iron-sulfur flavoprotein that catalyzes the reductive synthesis of L-glutamate from 2-oxoglutarate and L-glutamine via intramolecular channelling of ammonia, a reaction in the plant, yeast...; Region: GltS_FMN; cd02808
529507018146	active site
529507018147	FMN binding site [chemical binding]; other site
529507018148	substrate binding site [chemical binding]; other site
529507018149	3Fe-4S cluster binding site [ion binding]; other site
529507018150	gltb_C. This domain is found at the C-terminus of the large subunit (gltB) of glutamate synthase (GltS). GltS encodes a complex iron-sulfur flavoprotein that catalyzes the synthesis of L-glutamate from L-glutamine and 2-oxoglutarate. It requires the...; Region: gltB_C; cd00982
529507018151	domain interface; other site
529507018152	HMMPfam hit to PF01493, GXGXG motif, score 1.7e-94
529507018153	HMMPfam hit to PF01645, Conserved region in glutamate synthas, score 5.9e-236
529507018154	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507018155	HMMPfam hit to PF04898, Glutamate synthase central domain, score 1.4e-173
529507018156	HMMPfam hit to PF00310, Glutamine amidotransferases class-II, score 6.3e-206
529507018157	PS00017 ATP/GTP-binding site motif A (P-loop).
529507018158	aerobic respiration control sensor protein ArcB; Provisional; Region: PRK11091
529507018159	PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in...; Region: PAS; cd00130
529507018160	putative active site [active]
529507018161	heme pocket [chemical binding]; other site
529507018162	Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via...; Region: HisKA; cd00082
529507018163	dimer interface [polypeptide binding]; other site
529507018164	phosphorylation site [posttranslational modification]
529507018165	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
529507018166	ATP binding site [chemical binding]; other site
529507018167	Mg2+ binding site [ion binding]; other site
529507018168	G-X-G motif; other site
529507018169	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
529507018170	active site
529507018171	phosphorylation site [posttranslational modification]
529507018172	intermolecular recognition site; other site
529507018173	dimerization interface [polypeptide binding]; other site
529507018174	Histidine Phosphotransfer domain, involved in signalling through a two part component systems in which an autophosphorylating histidine protein kinase serves as a phosphoryl donor to a response regulator protein; the response regulator protein is...; Region: HPT; cd00088
529507018175	putative binding surface; other site
529507018176	active site
529507018177	Signal peptide predicted for PMI3678 by SignalP 2.0 HMM (Signal peptide probability 0.988) with cleavage site probability 0.477 between residues 47 and 48
529507018178	2 probable transmembrane helices predicted for PMI3678 by TMHMM2.0 at aa 20-42 and 55-77
529507018179	HMMPfam hit to PF00989, PAS domain, score 4e-09
529507018180	HMMPfam hit to PF00512, His Kinase A (phosphoacceptor) domain, score 3.2e-20
529507018181	HMMPfam hit to PF02518, Histidine kinase-, DNA gyrase B-, and HS, score 4.6e-39
529507018182	HMMPfam hit to PF00072, Response regulator receiver domain, score 4.8e-30
529507018183	HMMPfam hit to PF01627, Hpt domain, score 1.1e-13
529507018184	isoprenoid biosynthesis protein with amidotransferase-like domain; Provisional; Region: PRK11780
529507018185	Type 1 glutamine amidotransferase (GATase1)-like domain found in zebrafish ES1; Region: GATase1_ES1; cd03133
529507018186	conserved cys residue [active]
529507018187	HMMPfam hit to PF01965, DJ-1/PfpI family, score 4.7e-10
529507018188	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional; Region: mtgA; PRK00056
529507018189	Transglycosylase; Region: Transgly; cl17702
529507018190	Signal peptide predicted for PMI3680 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.655 between residues 34 and 35
529507018191	1 probable transmembrane helix predicted for PMI3680 by TMHMM2.0 at aa 13-35
529507018192	HMMPfam hit to PF00912, Transglycosylase, score 4.1e-67
529507018193	helix_turn_helix, arabinose operon control protein; Region: HTH_ARAC; smart00342
529507018194	Bacterial regulatory helix-turn-helix proteins, AraC family; Region: HTH_AraC; pfam00165
529507018195	HMMPfam hit to PF00165, Bacterial regulatory helix-turn-helix protei, score 2.3e-13
529507018196	PS00041 Bacterial regulatory proteins, araC family signature.
529507018197	HMMPfam hit to PF00165, Bacterial regulatory helix-turn-helix protei, score 4.6e-06
529507018198	UreD urease accessory protein; Region: UreD; pfam01774
529507018199	HMMPfam hit to PF01774, UreD urease accessory protein, score 5.8e-101
529507018200	Urease gamma-subunit; Urease is a nickel-dependent metalloenzyme that catalyzes the hydrolysis of urea to form ammonia and carbon dioxide. Nickel-dependent ureases are found in bacteria, archaea, fungi and plants. Their primary role is to allow the use...; Region: Urease_gamma; cd00390
529507018201	alpha-gamma subunit interface [polypeptide binding]; other site
529507018202	beta-gamma subunit interface [polypeptide binding]; other site
529507018203	HMMPfam hit to PF00547, Urease, gamma subunit, score 2.9e-71
529507018204	Urease beta-subunit; Urease is a nickel-dependent metalloenzyme that catalyzes the hydrolysis of urea to form ammonia and carbon dioxide. Nickel-dependent ureases are found in bacteria, archaea, fungi and plants. Their primary role is to allow the use of...; Region: Urease_beta; cd00407
529507018205	gamma-beta subunit interface [polypeptide binding]; other site
529507018206	alpha-beta subunit interface [polypeptide binding]; other site
529507018207	HMMPfam hit to PF00699, Urease beta subunit, score 1.1e-70
529507018208	urease subunit alpha; Reviewed; Region: ureC; PRK13207
529507018209	Urease alpha-subunit; Urease is a nickel-dependent metalloenzyme that catalyzes the hydrolysis of urea to form ammonia and carbon dioxide. Nickel-dependent ureases are found in bacteria, fungi and plants. Their primary role is to allow the use of...; Region: Urease_alpha; cd00375
529507018210	subunit interactions [polypeptide binding]; other site
529507018211	active site
529507018212	flap region; other site
529507018213	HMMPfam hit to PF00449, Urease alpha-subunit, N-terminal domain, score 2.6e-92
529507018214	HMMPfam hit to PF01979, Amidohydrolase family, score 7.4e-98
529507018215	PS01120 Urease nickel ligands signature.
529507018216	PS00145 Urease active site.
529507018217	urease accessory protein UreE; Provisional; Region: ureE; PRK13261
529507018218	UreE urease accessory protein. UreE is a metallochaperone assisting the insertion of a Ni2+ ion in the active site of urease, an important step in the in vivo assembly of urease, an enzyme that hydrolyses urea into ammonia and carbamic acid. The...; Region: UreE; cd00571
529507018219	dimer interface [polypeptide binding]; other site
529507018220	catalytic residues [active]
529507018221	HMMPfam hit to PF02814, UreE urease accessory protein, N-terminal do, score 2.3e-26
529507018222	HMMPfam hit to PF05194, UreE urease accessory protein, C-terminal do, score 4e-40
529507018223	Urease accessory protein UreF [Posttranslational modification, protein turnover, chaperones]; Region: UreF; COG0830
529507018224	UreF; Region: UreF; pfam01730
529507018225	HMMPfam hit to PF01730, UreF, score 2.4e-74
529507018226	PS00030 Eukaryotic RNA-binding region RNP-1 signature.
529507018227	The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain. Functionally, proteins in this superfamily use the energy from hydrolysis of NTP to transfer electron or ion; Region: Fer4_NifH; cl17203
529507018228	HMMPfam hit to PF02492, CobW/HypB/UreG, nucleotide-binding domain, score 1.2e-74
529507018229	PS00017 ATP/GTP-binding site motif A (P-loop).
529507018230	outer membrane lipoprotein; Provisional; Region: PRK11023
529507018231	BON domain; Region: BON; pfam04972
529507018232	HMMPfam hit to PF04972, phospholipid-binding domain, score 1.2e-09
529507018233	HMMPfam hit to PF04972, phospholipid-binding domain, score 5.8e-09
529507018234	Signal peptide predicted for PMI3689 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.431 between residues 31 and 32
529507018235	1 probable transmembrane helix predicted for PMI3689 by TMHMM2.0 at aa 4-26
529507018236	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507018237	Phosphoheptose isomerase is a member of the SIS (Sugar ISomerase) superfamily. Phosphoheptose isomerase catalyzes the isomerization of sedoheptulose 7-phosphate into D-glycero-D-mannoheptose 7-phosphate. This is the first step of the biosynthesis of...; Region: SIS_GmhA; cd05006
529507018238	dimer interface [polypeptide binding]; other site
529507018239	active site
529507018240	HMMPfam hit to PF01380, SIS domain, score 5.1e-21
529507018241	hypothetical protein; Reviewed; Region: PRK12497
529507018242	HMMPfam hit to PF02021, Uncharacterised protein family UPF0102, score 1.6e-36
529507018243	Type 1 periplasmic binding fold superfamily; Region: Periplasmic_Binding_Protein_Type_1; cl10011
529507018244	Periplasmic binding component of lipoprotein LppC, an immunodominant antigen; Region: PBP1_YraM_LppC_lipoprotein_like; cd06339
529507018245	putative ligand binding site [chemical binding]; other site
529507018246	HMMPfam hit to PF04348, LppC lipoprotein, score 5.2e-47
529507018247	Signal peptide predicted for PMI3692 by SignalP 2.0 HMM (Signal peptide probability 0.986) with cleavage site probability 0.485 between residues 30 and 31
529507018248	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507018249	SAM-dependent 16S ribosomal RNA C1402 ribose 2'-O-methyltransferase; Provisional; Region: PRK14994
529507018250	Ribosomal RNA small subunit methyltransferase I, also known as rRNA (cytidine-2'-O-)-methyltransferase RsmI; Region: RsmI; cd11648
529507018251	putative SAM binding site [chemical binding]; other site
529507018252	putative homodimer interface [polypeptide binding]; other site
529507018253	HMMPfam hit to PF00590, Tetrapyrrole (Corrin/Porphyrin) Methylas, score 2e-60
529507018254	PS01296 Uncharacterized protein family UPF0011 signature.
529507018255	Pirin-related protein [General function prediction only]; Region: COG1741
529507018256	Pirin; Region: Pirin; pfam02678
529507018257	HMMPfam hit to PF02678, Pirin, score 3.7e-20
529507018258	Bacterial regulatory helix-turn-helix protein, lysR family; Region: HTH_1; pfam00126
529507018259	putative DNA-binding transcriptional regulator; Provisional; Region: PRK11074
529507018260	The substrate binding domain of LysR-type transcriptional regulators (LTTRs), a member of the type 2 periplasmic binding fold protein superfamily; Region: PBP2_LTTR_substrate; cl11398
529507018261	dimerization interface [polypeptide binding]; other site
529507018262	HMMPfam hit to PF00126, Bacterial regulatory helix-turn-helix, score 7.5e-15
529507018263	PS00044 Bacterial regulatory proteins, lysR family signature.
529507018264	HMMPfam hit to PF03466, LysR substrate binding domain, score 2e-17
529507018265	Predicted membrane protein [Function unknown]; Region: COG2259
529507018266	4 probable transmembrane helices predicted for PMI3696 by TMHMM2.0 at aa 7-26, 46-68, 73-90 and 105-122
529507018267	HMMPfam hit to PF07681, DoxX, score 1.6e-35
529507018268	YqjK-like protein; Region: YqjK; pfam13997
529507018269	Predicted membrane protein [Function unknown]; Region: COG5393
529507018270	2 probable transmembrane helices predicted for PMI3698 by TMHMM2.0 at aa 50-72 and 82-104
529507018271	Uncharacterized conserved protein [Function unknown]; Region: ElaB; COG4575
529507018272	HMMPfam hit to PF05957, Bacterial protein of unknown function (DUF88, score 5.6e-46
529507018273	1 probable transmembrane helix predicted for PMI3699 by TMHMM2.0 at aa 81-98
529507018274	SNARE associated Golgi protein; Region: SNARE_assoc; cl00429
529507018275	Uncharacterized membrane-associated protein [Function unknown]; Region: DedA; COG0586
529507018276	6 probable transmembrane helices predicted for PMI3700 by TMHMM2.0 at aa 19-38, 42-61, 66-88, 126-148, 155-174 and 189-211
529507018277	HMMPfam hit to PF00597, DedA family, score 1.2e-55
529507018278	serine/threonine transporter SstT; Provisional; Region: PRK13628
529507018279	Na+/H+-dicarboxylate symporters [Energy production and conversion]; Region: GltP; COG1301
529507018280	8 probable transmembrane helices predicted for PMI3701 by TMHMM2.0 at aa 12-34, 49-71, 83-105, 140-162, 183-205, 215-237, 287-309 and 329-351
529507018281	HMMPfam hit to PF00375, Sodium:dicarboxylate symporter family, score 8.7e-140
529507018282	NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion]; Region: NemA; COG1902
529507018283	2,4-dienoyl-CoA reductase (DCR) FMN-binding domain. DCR in E. coli  is an iron-sulfur flavoenzyme which contains FMN, FAD, and a 4Fe-4S cluster. It is also a monomer, unlike that of its eukaryotic counterparts which form homotetramers and lack the...; Region: DCR_FMN; cd02930
529507018284	active site
529507018285	FMN binding site [chemical binding]; other site
529507018286	2,4-decadienoyl-CoA binding site; other site
529507018287	catalytic residue [active]
529507018288	4Fe-4S cluster binding site [ion binding]; other site
529507018289	Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only]; Region: HcaD; COG0446
529507018290	NAD(P)-binding Rossmann-like domain; Region: NAD_binding_8; pfam13450
529507018291	HMMPfam hit to PF00070, Pyridine nucleotide-disulphide oxidoredu, score 1.9e-09
529507018292	HMMPfam hit to PF00724, NADH:flavin oxidoreductase / NADH oxidas, score 2.2e-124
529507018293	DoxX; Region: DoxX; pfam07681
529507018294	HMMPfam hit to PF07681, DoxX, score 2.8e-26
529507018295	3 probable transmembrane helices predicted for PMI3703 by TMHMM2.0 at aa 54-76, 81-103 and 118-135
529507018296	Predicted Zn-dependent peptidases [General function prediction only]; Region: PqqL; COG0612
529507018297	Insulinase (Peptidase family M16); Region: Peptidase_M16; pfam00675
529507018298	Peptidase M16 inactive domain; Region: Peptidase_M16_C; pfam05193
529507018299	Peptidase M16 inactive domain; Region: Peptidase_M16_C; pfam05193
529507018300	PS00061 Short-chain dehydrogenases/reductases family signature.
529507018301	HMMPfam hit to PF05193, Peptidase M16 inactive domain, score 2.1e-17
529507018302	HMMPfam hit to PF05193, Peptidase M16 inactive domain, score 1.5e-10
529507018303	HMMPfam hit to PF00675, Insulinase (Peptidase family M16), score 6.1e-15
529507018304	Signal peptide predicted for PMI3704 by SignalP 2.0 HMM (Signal peptide probability 0.996) with cleavage site probability 0.313 between residues 22 and 23
529507018305	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507018306	ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only]; Region: COG4178
529507018307	ABC transporter transmembrane region 2; Region: ABC_membrane_2; cl00549
529507018308	ATP-binding cassette transporter nucleotide-binding domain; Region: ABC_ATPase; cl17201
529507018309	Walker A/P-loop; other site
529507018310	ATP binding site [chemical binding]; other site
529507018311	Q-loop/lid; other site
529507018312	ABC transporter signature motif; other site
529507018313	Walker B; other site
529507018314	D-loop; other site
529507018315	H-loop/switch region; other site
529507018316	HMMPfam hit to PF00005, ABC transporter, score 1.3e-30
529507018317	PS00211 ABC transporters family signature.
529507018318	PS00017 ATP/GTP-binding site motif A (P-loop).
529507018319	5 probable transmembrane helices predicted for PMI3705 by TMHMM2.0 at aa 20-42, 62-84, 147-169, 184-206 and 268-290
529507018320	Signal peptide predicted for PMI3705 by SignalP 2.0 HMM (Signal peptide probability 0.774) with cleavage site probability 0.448 between residues 37 and 38
529507018321	Secretin and TonB N terminus short domain; Region: STN; smart00965
529507018322	Outer membrane receptor proteins, mostly Fe transport [Inorganic ion transport and metabolism]; Region: CirA; COG1629
529507018323	Porin superfamily.  These outer membrane channels share a beta-barrel structure that differ in strand and shear number.  Classical (gram-negative ) porins are non-specific channels for small hydrophillic molecules and form 16 beta-stranded barrels (16,20)...; Region: OM_channels; cl17244
529507018324	TonB dependent receptor; Region: TonB_dep_Rec; pfam00593
529507018325	HMMPfam hit to PF00593, TonB dependent receptor, score 1.4e-12
529507018326	HMMPfam hit to PF07715, TonB-dependent Receptor Plug Domain, score 4.2e-15
529507018327	HMMPfam hit to PF07660, Secretin and TonB N terminus short domai, score 8.7e-07
529507018328	Signal peptide predicted for PMI3706 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.999 between residues 30 and 31
529507018329	Fe2+-dicitrate sensor, membrane component [Inorganic ion transport and metabolism / Signal transduction mechanisms]; Region: FecR; COG3712
529507018330	FecR protein; Region: FecR; pfam04773
529507018331	HMMPfam hit to PF04773, FecR protein, score 2.6e-26
529507018332	1 probable transmembrane helix predicted for PMI3707 by TMHMM2.0 at aa 96-118
529507018333	Sigma-70 region 2; Region: Sigma70_r2; pfam04542
529507018334	RNA polymerase sigma factor; Reviewed; Region: PRK12527
529507018335	Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs). A SF is a dissociable subunit of RNA polymerase, it directs bacterial or...; Region: Sigma70_r4; cd06171
529507018336	DNA binding residues [nucleotide binding]
529507018337	HMMPfam hit to PF04545, Sigma-70, region, score 3.1e-15
529507018338	HMMPfam hit to PF04542, Sigma-70 region, score 1.2e-10
529507018339	Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane]; Region: TonB; COG0810
529507018340	Gram-negative bacterial tonB protein; Region: TonB; pfam03544
529507018341	Signal peptide predicted for PMI3709 by SignalP 2.0 HMM (Signal peptide probability 0.635) with cleavage site probability 0.367 between residues 33 and 34
529507018342	1 probable transmembrane helix predicted for PMI3709 by TMHMM2.0 at aa 15-37
529507018343	Helix-turn-helix domain; Region: HTH_OrfB_IS605; pfam12323
529507018344	Transposase and inactivated derivatives [DNA replication, recombination, and repair]; Region: COG0675
529507018345	Probable transposase; Region: OrfB_IS605; pfam01385
529507018346	transposase, IS605 OrfB family, central region; Region: tspaseT_teng_C; TIGR01766
529507018347	HMMPfam hit to PF07282, transposase DNA-binding domai, score 5.8e-35
529507018348	HMMPfam hit to PF01385, Probable transposase, score 6.1e-132
529507018349	Transposase IS200 like; Region: Y1_Tnp; pfam01797
529507018350	HMMPfam hit to PF01797, Transposase IS200 like, score 1.2e-43
529507018351	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507018352	putative ABC transporter ATP-binding protein; Reviewed; Region: PRK11819
529507018353	ATP-binding cassette domain of elongation factor 3, subfamily F; Region: ABCF_EF-3; cd03221
529507018354	ATP-binding cassette domain of elongation factor 3, subfamily F; Region: ABCF_EF-3; cd03221
529507018355	ABC transporter; Region: ABC_tran_2; pfam12848
529507018356	ATP-binding cassette domain of elongation factor 3, subfamily F; Region: ABCF_EF-3; cd03221
529507018357	HMMPfam hit to PF00005, ABC transporter, score 1.7e-47
529507018358	PS00017 ATP/GTP-binding site motif A (P-loop).
529507018359	HMMPfam hit to PF00005, ABC transporter, score 5.7e-57
529507018360	PS00211 ABC transporters family signature.
529507018361	PS00017 ATP/GTP-binding site motif A (P-loop).
529507018362	lytic murein transglycosylase; Provisional; Region: PRK11619
529507018363	Lytic Transglycosylase (LT)  and Goose Egg White Lysozyme (GEWL) domain. Members include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as, the eukaryotic "goose-type" lysozymes (GEWL).  LTs...; Region: LT_GEWL; cd00254
529507018364	N-acetyl-D-glucosamine binding site [chemical binding]; other site
529507018365	catalytic residue [active]
529507018366	Signal peptide predicted for PMI3713 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.916 between residues 21 and 22
529507018367	HMMPfam hit to PF01464, Transglycosylase SLT domain, score 1.9e-32
529507018368	PS00922 Prokaryotic transglycosylases signature.
529507018369	Trp operon repressor; Provisional; Region: PRK01381
529507018370	HMMPfam hit to PF01371, Trp repressor protein, score 8.9e-37
529507018371	inosine/xanthosine triphosphatase; Reviewed; Region: PRK05074
529507018372	HMMPfam hit to PF01931, Protein of unknown function DUF84, score 4.8e-54
529507018373	Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction; Region: HP_PGM_like; cd07067
529507018374	catalytic core [active]
529507018375	HMMPfam hit to PF00300, Phosphoglycerate mutase family, score 5.6e-63
529507018376	PS00175 Phosphoglycerate mutase family phosphohistidine signature.
529507018377	1 probable transmembrane helix predicted for PMI3716 by TMHMM2.0 at aa 146-168
529507018378	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507018379	right oriC-binding transcriptional activator; Provisional; Region: PRK15121
529507018380	Bacterial regulatory helix-turn-helix proteins, AraC family; Region: HTH_AraC; pfam00165
529507018381	Bacterial transcription activator, effector binding domain; Region: AraC_E_bind; smart00871
529507018382	HMMPfam hit to PF06445, Bacterial transcription activator, effect, score 3.5e-12
529507018383	HMMPfam hit to PF00165, Bacterial regulatory helix-turn-helix pro, score 6.1e-11
529507018384	PS00041 Bacterial regulatory proteins, araC family signature.
529507018385	HMMPfam hit to PF00165, Bacterial regulatory helix-turn-helix pro, score 2.6e-11
529507018386	hypothetical protein; Provisional; Region: PRK10756
529507018387	CreA protein; Region: CreA; pfam05981
529507018388	Signal peptide predicted for PMI3718 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.991 between residues 22 and 23
529507018389	HMMPfam hit to PF05981, CreA protein, score 1.1e-80
529507018390	two-component response regulator; Provisional; Region: PRK11173
529507018391	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
529507018392	active site
529507018393	phosphorylation site [posttranslational modification]
529507018394	intermolecular recognition site; other site
529507018395	dimerization interface [polypeptide binding]; other site
529507018396	Effector domain of response regulator. Bacteria and certain eukaryotes like protozoa and higher plants use two-component signal transduction systems to detect and respond to changes in the environment. The system consists of a sensor histidine kinase and...; Region: trans_reg_C; cd00383
529507018397	DNA binding site [nucleotide binding]
529507018398	HMMPfam hit to PF00486, Transcriptional regulatory protein, C te, score 4.3e-18
529507018399	HMMPfam hit to PF00072, Response regulator receiver domain, score 8.9e-32
529507018400	Initiator Replication protein; Region: Rep_3; pfam01051
529507018401	Signal peptide predicted for PMIP01 by SignalP 2.0 HMM (Signal peptide probability 0.633) with cleavage site probability 0.483 between residues 42 and 43
529507018402	HMMPfam hit to PF01051, Initiator Replication protein, score 6.9e-28
529507018403	3 probable transmembrane helices predicted for PMIP02 by TMHMM2.0 at aa 44-66, 68-85 and 95-117
529507018404	Spo7-like protein; Region: Spo7; pfam03907
529507018405	2 probable transmembrane helices predicted for PMIP03 by TMHMM2.0 at aa 63-85 and 105-127
529507018406	Predicted helix-turn-helix motif with score 1309.000, SD 3.65 at aa 36-57, sequence SSIAELARLNNRHPDTVRKRLN
529507018407	Lytic Transglycosylase (LT)  and Goose Egg White Lysozyme (GEWL) domain. Members include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as, the eukaryotic "goose-type" lysozymes (GEWL).  LTs...; Region: LT_GEWL; cd00254
529507018408	N-acetyl-D-glucosamine binding site [chemical binding]; other site
529507018409	catalytic residue [active]
529507018410	Signal peptide predicted for PMIP07 by SignalP 2.0 HMM (Signal peptide probability 0.980) with cleavage site probability 0.979 between residues 19 and 20
529507018411	HMMPfam hit to PF01464, Transglycosylase SLT domain, score 1e-05
529507018412	PS00453 FKBP-type peptidyl-prolyl cis-trans isomerase signature 1.
529507018413	2 probable transmembrane helices predicted for PMIP08 by TMHMM2.0 at aa 32-54 and 59-78
529507018414	Type IV secretory pathway, VirB3-like protein; Region: VirB3; pfam05101
529507018415	type IV secretion/conjugal transfer ATPase, VirB4 family; Region: VirB4_CagE; TIGR00929
529507018416	CagE, TrbE, VirB family, component of type IV transporter system; Region: CagE_TrbE_VirB; pfam03135
529507018417	HMMPfam hit to PF05101, Type IV secretory pathway, VirB3-like, score 3.3e-24
529507018418	1 probable transmembrane helix predicted for PMIP09 by TMHMM2.0 at aa 13-35
529507018419	HMMPfam hit to PF03135, CagE, TrbE, VirB family, component of, score 1.2e-45
529507018420	PS00017 ATP/GTP-binding site motif A (P-loop).
529507018421	P-type DNA transfer protein VirB5; Region: VirB5; TIGR02791
529507018422	Type IV secretion system proteins; Region: T4SS; pfam07996
529507018423	HMMPfam hit to PF07996, Type IV secretion system proteins, score 1.9e-05
529507018424	Signal peptide predicted for PMIP10 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.990 between residues 23 and 24
529507018425	1 probable transmembrane helix predicted for PMIP10 by TMHMM2.0 at aa 7-29
529507018426	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507018427	TrbL/VirB6 plasmid conjugal transfer protein; Region: TrbL; pfam04610
529507018428	6 probable transmembrane helices predicted for PMIP12 by TMHMM2.0 at aa 68-90, 171-193, 200-222, 227-249, 268-290 and 305-327
529507018429	HMMPfam hit to PF04610, TrbL/VirB6 plasmid conjugal transfer protein, score 1.3e-40
529507018430	Prokaryotic membrane lipoprotein lipid attachment site; Region: LPAM_1; pfam08139
529507018431	VirB8 protein; Region: VirB8; pfam04335
529507018432	1 probable transmembrane helix predicted for PMIP13 by TMHMM2.0 at aa 33-55
529507018433	HMMPfam hit to PF04335, VirB8 protein, score 4.8e-47
529507018434	CDP-diacylglycerol pyrophosphatase; Region: CDH; cl00934
529507018435	VirB9/CagX/TrbG, a component of the type IV secretion system; Region: VirB9_CagX_TrbG; cd06911
529507018436	VirB7 interaction site; other site
529507018437	Signal peptide predicted for PMIP14 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.985 between residues 21 and 22
529507018438	HMMPfam hit to PF03524, Conjugal transfer protein, score 1.1e-29
529507018439	Bacterial conjugation TrbI-like protein; Region: TrbI; pfam03743
529507018440	1 probable transmembrane helix predicted for PMIP15 by TMHMM2.0 at aa 56-78
529507018441	HMMPfam hit to PF03743, Bacterial conjugation TrbI-like protein, score 1.9e-71
529507018442	P-type DNA transfer ATPase VirB11; Region: VirB11; TIGR02788
529507018443	Type IV secretory pathway component VirB11, and related ATPases. The homohexamer, VirB11 is one of eleven Vir proteins, which are required for T-pilus biogenesis and virulence in the transfer of T-DNA from the Ti (tumor-inducing) plasmid of bacterial to...; Region: VirB11-like_ATPase; cd01130
529507018444	ATP binding site [chemical binding]; other site
529507018445	Walker A motif; other site
529507018446	hexamer interface [polypeptide binding]; other site
529507018447	Walker B motif; other site
529507018448	HMMPfam hit to PF00437, Type II/IV secretion system protein, score 5.9e-31
529507018449	PS00017 ATP/GTP-binding site motif A (P-loop).
529507018450	Type IV secretory system Conjugative DNA transfer; Region: T4SS-DNA_transf; pfam02534
529507018451	RecA-like NTPases. This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and...; Region: RecA-like_NTPases; cl17233
529507018452	Walker A motif; other site
529507018453	ATP binding site [chemical binding]; other site
529507018454	Walker B motif; other site
529507018455	2 probable transmembrane helices predicted for PMIP17 by TMHMM2.0 at aa 10-32 and 63-85
529507018456	HMMPfam hit to PF02534, TraG/TraD family, score 1.3e-172
529507018457	Cag pathogenicity island protein Cag12; Region: Cag12; pfam13117
529507018458	Signal peptide predicted for PMIP18 by SignalP 2.0 HMM (Signal peptide probability 0.858) with cleavage site probability 0.369 between residues 21 and 22
529507018459	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507018460	TrbM; Region: TrbM; pfam07424
529507018461	HMMPfam hit to PF07424, TrbM, score 1e-45
529507018462	Signal peptide predicted for PMIP19 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.987 between residues 19 and 20
529507018463	Signal peptide predicted for PMIP20 by SignalP 2.0 HMM (Signal peptide probability 0.990) with cleavage site probability 0.988 between residues 30 and 31
529507018464	1 probable transmembrane helix predicted for PMIP20 by TMHMM2.0 at aa 7-29
529507018465	2 probable transmembrane helices predicted for PMIP21 by TMHMM2.0 at aa 21-43 and 58-80
529507018466	PS00213 Lipocalin signature.
529507018467	DNA topoisomerase III; Provisional; Region: PRK07726
529507018468	TOPRIM_TopoIA_TopoIII: The topoisomerase-primase (TORPIM) domain found in members of the type IA family of DNA topoisomerases (Topo IA) similar to topoisomerase III. Type IA DNA topoisomerases remove (relax) negative supercoils in the DNA by: cleaving...; Region: TOPRIM_TopoIA_TopoIII; cd03362
529507018469	active site
529507018470	putative interdomain interaction site [polypeptide binding]; other site
529507018471	putative metal-binding site [ion binding]; other site
529507018472	putative nucleotide binding site [chemical binding]; other site
529507018473	DNA Topoisomerase, subtype IA; DNA-binding, ATP-binding and catalytic domain of bacterial DNA topoisomerases I and III, and eukaryotic DNA topoisomerase III and eubacterial and archael reverse gyrases. Topoisomerases clevage single or double stranded DNA...; Region: TOP1Ac; cl11986
529507018474	domain I; other site
529507018475	DNA binding groove [nucleotide binding]
529507018476	phosphate binding site [ion binding]; other site
529507018477	domain II; other site
529507018478	domain III; other site
529507018479	nucleotide binding site [chemical binding]; other site
529507018480	catalytic site [active]
529507018481	domain IV; other site
529507018482	Topoisomerase DNA binding C4 zinc finger; Region: zf-C4_Topoisom; pfam01396
529507018483	C-terminal repeat of topoisomerase; Region: Toprim_Crpt; pfam13342
529507018484	HMMPfam hit to PF01751, Toprim domain, score 7e-17
529507018485	HMMPfam hit to PF01131, DNA topoisomerase, score 3.4e-87
529507018486	PS00396 Prokaryotic DNA topoisomerase I active site.
529507018487	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
529507018488	HMMPfam hit to PF01396, Topoisomerase DNA binding C4 zinc fing, score 8.7e-05
529507018489	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
529507018490	HMMPfam hit to PF01396, Topoisomerase DNA binding C4 zinc fing, score 0.11
529507018491	Domain in histone-like proteins of HNS family; Region: HNS; smart00528
529507018492	HMMPfam hit to PF00816, H-NS histone family, score 8e-13
529507018493	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely...; Region: SGNH_hydrolase; cl01053
529507018494	active site
529507018495	catalytic triad [active]
529507018496	oxyanion hole [active]
529507018497	Hok/gef family; Region: HOK_GEF; pfam01848
529507018498	1 probable transmembrane helix predicted for PMIP29 by TMHMM2.0 at aa 10-32
529507018499	Colicin pore forming domain; Region: Colicin; pfam01024
529507018500	PS00430 TonB-dependent receptor proteins signature 1.
529507018501	HMMPfam hit to PF01024, Colicin pore forming domain, score 4.1e-62
529507018502	PS00276 Channel forming colicins signature.
529507018503	2 probable transmembrane helices predicted for PMIP30 by TMHMM2.0 at aa 420-442 and 449-471
529507018504	Colicin immunity protein; Region: Colicin_im; pfam03857
529507018505	4 probable transmembrane helices predicted for PMIP31 by TMHMM2.0 at aa 11-33, 59-81, 97-119 and 144-166
529507018506	PS00225 Crystallins beta and gamma 'Greek key' motif signature.
529507018507	Plasmid stabilization system protein [General function prediction only]; Region: ParE; COG3668
529507018508	HMMPfam hit to PF05016, Plasmid stabilisation system protein, score 9.7e-16
529507018509	Antitoxin Phd_YefM, type II toxin-antitoxin system; Region: PhdYeFM_antitox; pfam02604
529507018510	HMMPfam hit to PF02604, Phd_YefM, score 1.8e-16
529507018511	ParA-like protein; Provisional; Region: PHA02518
529507018512	ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the...; Region: ParA; cd02042
529507018513	P-loop; other site
529507018514	Magnesium ion binding site [ion binding]; other site
529507018515	Restriction endonuclease; Region: Mrr_cat; pfam04471
529507018516	1 probable transmembrane helix predicted for PMIP36 by TMHMM2.0 at aa 5-24
529507018517	HMMPfam hit to PF04471, Restriction endonuclease, score 7.9e-07
529507018518	HMMPfam hit to PF03432, Relaxase/Mobilisation nuclease domain, score 0.00014
529507018519	TraY domain; Region: TraY; cl17675
529507018520	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cd00093
529507018521	non-specific DNA binding site [nucleotide binding]; other site
529507018522	sequence-specific DNA binding site [nucleotide binding]; other site
529507018523	salt bridge; other site
529507018524	HMMPfam hit to PF01381, Helix-turn-helix, score 5.7e-07
529507018525	Predicted helix-turn-helix motif with score 1697.000, SD 4.97 at aa 47-68, sequence RNISQLSKETGMSREGIYKALS
529507018526	putative addiction module killer protein; Region: upstrm_HI1419; TIGR02683
529507018527	HMMPfam hit to PF05973, Phage derived protein Gp49-like (DUF891), score 9.3e-23
529507018528	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cl17200
529507018529	non-specific DNA binding site [nucleotide binding]; other site
529507018530	salt bridge; other site
529507018531	sequence-specific DNA binding site [nucleotide binding]; other site
529507018532	Predicted helix-turn-helix motif with score 1509.000, SD 4.33 at aa 17-38, sequence LTQKEMAERYGVGIRTWQKKEE
529507018533	DnaJ domain or J-domain.  DnaJ/Hsp40 (heat shock protein 40) proteins are highly conserved and play crucial roles in protein translation, folding, unfolding, translocation, and degradation. They act primarily by stimulating the ATPase activity of Hsp70s; Region: DnaJ; cd06257
529507018534	HSP70 interaction site [polypeptide binding]; other site
529507018535	HMMPfam hit to PF00226, DnaJ domain, score 5.5e-13